F348368

General Info

Members Datasets Scaffolds Average Seq Length
235 172 470 99

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0015259|Ga0451577_0015259_1117_1473
Length 118
Sequence MAACDDRQAMIYKFKSKAAGDVIMLQPTGDKVLGLIGKDVTPKGIIEPAQMAAAIQALADAVAVDDAARARAASGGQADTEEAAAGARDKISLRQRVWPLVEMMKRAQGADEPITWGV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
105 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
106 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
107 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
108 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
146 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
147 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
148 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
149 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
150 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
154 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
155 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
165 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
172 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 0
Rhizoplane 2.13
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0015259 3300042876 Bacteria 7149
2 rootH1_10097385 3300003316 Bacteria 1221
3 rootH2_10038579 3300003320 Bacteria 1240
4 rootL2_10176069 3300003322 Bacteria 2021
5 Ga0070676_10257501 3300005328 Bacteria 1167
6 Ga0070690_100528914 3300005330 Bacteria 886
7 Ga0068869_100217947 3300005334 Bacteria 1511
8 Ga0070661_100362790 3300005344 Bacteria 1139
9 Ga0070668_100082817 3300005347 Bacteria 2517
10 Ga0070675_101706590 3300005354 Bacteria 581
11 Ga0070671_100593016 3300005355 Bacteria 957
12 Ga0070674_100231167 3300005356 Bacteria 1443
13 Ga0070674_101082722 3300005356 Bacteria 707
14 Ga0070667_100479063 3300005367 Bacteria 1139
15 Ga0070700_100014555 3300005441 Bacteria 4443
16 Ga0070708_101587103 3300005445 Bacteria 609
17 Ga0070663_100760177 3300005455 Bacteria 828
18 Ga0070678_100102186 3300005456 Bacteria 2224
19 Ga0070678_100821807 3300005456 Bacteria 845
20 Ga0068867_100020712 3300005459 Bacteria 4687
21 Ga0068867_100052071 3300005459 Bacteria 3020
22 Ga0068867_100160757 3300005459 Bacteria 1771
23 Ga0068867_101017821 3300005459 Bacteria 752
24 Ga0068867_101582546 3300005459 Bacteria 612
25 Ga0070706_100031098 3300005467 Bacteria 4923
26 Ga0070707_100531452 3300005468 Bacteria 1138
27 Ga0070699_101481392 3300005518 Bacteria 622
28 Ga0070686_100845098 3300005544 Bacteria 741
29 Ga0070665_101540692 3300005548 Bacteria 673
30 Ga0068854_100133072 3300005578 Bacteria 1901
31 Ga0068859_101490370 3300005617 Bacteria 747
32 Ga0068866_10002740 3300005718 Bacteria 7264
33 Ga0068866_10490360 3300005718 Bacteria 811
34 Ga0068866_10906702 3300005718 Bacteria 620
35 Ga0068861_100005508 3300005719 Bacteria 8577
36 Ga0068861_100635358 3300005719 Bacteria 984
37 Ga0068863_100099353 3300005841 Bacteria 2765
38 Ga0068858_100520024 3300005842 Bacteria 1151
39 Ga0068860_100017835 3300005843 Bacteria 6913
40 Ga0068860_100166371 3300005843 Bacteria 2129
41 Ga0068862_100002626 3300005844 Bacteria 15828
42 Ga0068862_100032603 3300005844 Bacteria 4402
43 Ga0068862_100035259 3300005844 Bacteria 4235
44 Ga0075368_10105209 3300006042 Bacteria 1161
45 Ga0075363_100221748 3300006048 Bacteria 1084
46 Ga0075366_10010694 3300006195 Bacteria 5158
47 Ga0075366_10025447 3300006195 Bacteria 3457
48 Ga0075366_10049812 3300006195 Bacteria 2486
49 Ga0075366_10068193 3300006195 Bacteria 2117
50 Ga0075366_10324781 3300006195 Bacteria 943
51 Ga0075366_10990908 3300006195 Bacteria 524
52 Ga0097621_101626954 3300006237 Bacteria 614
53 Ga0075370_10040634 3300006353 Bacteria 2624
54 Ga0075370_10263242 3300006353 Bacteria 1023
55 Ga0075370_10826070 3300006353 Bacteria 565
56 Ga0068871_101057102 3300006358 Bacteria 758
57 Ga0075430_100449790 3300006846 Bacteria 1063
58 Ga0075429_100006177 3300006880 Bacteria 10353
59 Ga0068865_100050852 3300006881 Bacteria 2865
60 Ga0097620_101490308 3300006931 Bacteria 747
61 Ga0105245_12748401 3300009098 Bacteria 545
62 Ga0105247_10423116 3300009101 Bacteria 954
63 Ga0105243_10014728 3300009148 Bacteria 5915
64 Ga0105243_10020108 3300009148 Bacteria 5061
65 Ga0105243_10353300 3300009148 Bacteria 1350
66 Ga0105242_10337409 3300009176 Bacteria 1388
67 Ga0105242_11024136 3300009176 Bacteria 835
68 Ga0105249_10017892 3300009553 Bacteria 6297
69 Ga0105249_10293441 3300009553 Bacteria 1628
70 Ga0105249_10623052 3300009553 Bacteria 1135
71 Ga0157374_10010932 3300013296 Bacteria 7836
72 Ga0157378_10003330 3300013297 Bacteria 14290
73 Ga0157378_10141586 3300013297 Bacteria 2234
74 Ga0163162_10005003 3300013306 Bacteria 12767
75 Ga0157375_10062210 3300013308 Bacteria 3708
76 Ga0157380_10061404 3300014326 Bacteria 3007
77 Ga0157380_10063579 3300014326 Bacteria 2960
78 Ga0157379_10029042 3300014968 Bacteria 4917
79 Ga0157379_10532529 3300014968 Bacteria 1091
80 Ga0157376_11225180 3300014969 Bacteria 779
81 Ga0163161_10080670 3300017792 Bacteria 2395
82 Ga0207682_10266201 3300025893 Bacteria 800
83 Ga0207642_10016280 3300025899 Bacteria 2796
84 Ga0207642_10610665 3300025899 Bacteria 680
85 Ga0207680_10573993 3300025903 Bacteria 806
86 Ga0207645_10270625 3300025907 Bacteria 1126
87 Ga0207684_10033806 3300025910 Bacteria 4349
88 Ga0207681_10303439 3300025923 Bacteria 1264
89 Ga0207659_11324653 3300025926 Bacteria 618
90 Ga0207687_10696352 3300025927 Bacteria 862
91 Ga0207686_10211559 3300025934 Bacteria 1394
92 Ga0207686_11031640 3300025934 Bacteria 668
93 Ga0207709_10014331 3300025935 Bacteria 4376
94 Ga0207709_10076087 3300025935 Bacteria 2148
95 Ga0207709_10229289 3300025935 Bacteria 1344
96 Ga0207669_10197093 3300025937 Bacteria 1458
97 Ga0207669_11284442 3300025937 Bacteria 621
98 Ga0207669_11407238 3300025937 Bacteria 594
99 Ga0207704_10003481 3300025938 Bacteria 7159
100 Ga0207691_10044864 3300025940 Bacteria 4067
101 Ga0207689_10533235 3300025942 Bacteria 985
102 Ga0207712_10165533 3300025961 Bacteria 1723
103 Ga0207712_10334836 3300025961 Bacteria 1253
104 Ga0207712_10713194 3300025961 Bacteria 876
105 Ga0207640_10277022 3300025981 Bacteria 1315
106 Ga0207658_10347072 3300025986 Bacteria 1291
107 Ga0207677_11088399 3300026023 Bacteria 728
108 Ga0207703_10623719 3300026035 Bacteria 1021
109 Ga0207703_10685778 3300026035 Bacteria 974
110 Ga0207678_10984854 3300026067 Bacteria 746
111 Ga0207708_10013014 3300026075 Bacteria 6207
112 Ga0207648_10000419 3300026089 Bacteria 46680
113 Ga0207648_10134465 3300026089 Bacteria 2178
114 Ga0207648_10414866 3300026089 Bacteria 1222
115 Ga0207648_11360362 3300026089 Bacteria 667
116 Ga0207675_100000693 3300026118 Bacteria 33301
117 Ga0207675_100516870 3300026118 Bacteria 1190
118 Ga0207683_10124817 3300026121 Bacteria 2313
119 Ga0209813_10100745 3300027866 Bacteria 982
120 Ga0268266_11656676 3300028379 Bacteria 615
121 Ga0268265_10013134 3300028380 Bacteria 5626
122 Ga0268265_10014510 3300028380 Bacteria 5370
123 Ga0268265_10163438 3300028380 Bacteria 1894
124 Ga0268264_10039249 3300028381 Bacteria 3912
125 Ga0268264_10102470 3300028381 Bacteria 2491
126 Ga0307515_10016911 3300028794 Bacteria 13333
127 Ga0307509_10330607 3300031507 Bacteria 1256
128 Ga0307408_100323312 3300031548 Bacteria 1300
129 Ga0307516_10000952 3300031730 Bacteria 39918
130 Ga0307516_10048497 3300031730 Bacteria 4179
131 Ga0307413_10603175 3300031824 Bacteria 899
132 Ga0307410_10168777 3300031852 Bacteria 1647
133 Ga0307406_10195078 3300031901 Bacteria 1486
134 Ga0307407_10419920 3300031903 Bacteria 964
135 Ga0307409_102216214 3300031995 Bacteria 579
136 Ga0307416_100090220 3300032002 Bacteria 2627
137 Ga0307414_10777918 3300032004 Bacteria 872
138 Ga0307415_101885323 3300032126 Bacteria 580
139 Ga0307510_10001950 3300033180 Bacteria 23220
140 Ga0373960_0440518 3300035121 Bacteria 509
141 Ga0373931_0788624 3300035691 Bacteria 633
142 Ga0373927_0231267 3300035695 Bacteria 1215
143 Ga0373937_0076404 3300036401 Bacteria 3093
144 Ga0373925_0014382 3300037068 Bacteria 5723
145 Ga0395900_0001308 3300037418 Bacteria 30266
146 Ga0395898_0002912 3300037466 Bacteria 19475
147 Ga0395898_0732779 3300037466 Bacteria 930
148 Ga0395905_0005907 3300037471 Bacteria 12410
149 Ga0395905_0283609 3300037471 Bacteria 1543
150 Ga0395905_1701497 3300037471 Bacteria 536
151 Ga0439461_0093152 3300041410 Bacteria 725
152 Ga0450919_000090 3300042121 Bacteria 8867
153 Ga0450920_010130 3300042122 Bacteria 1745
154 Ga0439446_0128593 3300042156 Bacteria 820
155 Ga0450918_000050 3300042531 Bacteria 24454
156 Ga0451577_0112030 3300042876 Bacteria 2442
157 Ga0451577_0737522 3300042876 Bacteria 891
158 Ga0466969_0059329 3300044656 Bacteria 1860
159 Ga0466965_0008073 3300044683 Bacteria 4862
160 Ga0466966_0002245 3300044684 Bacteria 12580
161 Ga0466966_0240923 3300044684 Bacteria 1090
162 Ga0466961_0001917 3300044693 Bacteria 12957
163 Ga0466961_0055885 3300044693 Bacteria 2515
164 Ga0466963_0809731 3300044694 Bacteria 660
165 Ga0466964_0014157 3300044706 Bacteria 3030
166 Ga0466964_0065099 3300044706 Bacteria 1526
167 Ga0453684_0227398 3300044712 Bacteria 2156
168 Ga0453684_0634857 3300044712 Unclassified 1167
169 Ga0466971_0262389 3300044719 Bacteria 824
170 Ga0466968_0095284 3300044735 Bacteria 1324
171 Ga0466970_0100048 3300044765 Bacteria 1578
172 Ga0466957_0121783 3300044842 Bacteria 1663
173 Ga0466957_0462501 3300044842 Bacteria 875
174 Ga0466959_0000132 3300045049 Bacteria 48490
175 Ga0466959_0055489 3300045049 Bacteria 2892
176 Ga0451576_0000114 3300045051 Bacteria 208462
177 Ga0451576_0071004 3300045051 Bacteria 3624
178 Ga0466958_0101781 3300045836 Bacteria 1786
179 Ga0466967_0185061 3300045976 Bacteria 1967
180 Ga0495650_0004342 3300046471 Bacteria 9773
181 Ga0495618_0113019 3300046514 Bacteria 1739
182 Ga0495643_0062955 3300046522 Bacteria 1963
183 Ga0495658_0019652 3300046683 Bacteria 3529
184 Ga0495686_0001272 3300047472 Bacteria 28580
185 Ga0495686_0114721 3300047472 Bacteria 1612
186 Ga0496102_0027006 3300048905 Bacteria 5126
187 Ga0496104_0142657 3300048907 Bacteria 2301
188 Ga0496105_0371325 3300048908 Unclassified 1139
189 Ga0496106_0040494 3300048909 Bacteria 3490
190 Ga0496113_0112344 3300048916 Bacteria 2122
191 Ga0501298_083485 3300049521 Bacteria 706
192 Ga0501032_0291326 3300049569 Bacteria 1056
193 Ga0501034_1664300 3300049571 Bacteria 511
194 Ga0501042_1355612 3300049578 Bacteria 519
195 Ga0501043_0000277 3300049579 Bacteria 46284
196 Ga0501046_0000345 3300049580 Bacteria 46730
197 Ga0501047_0000395 3300049581 Bacteria 48969
198 Ga0501048_0000111 3300049582 Bacteria 46009
199 Ga0501067_0383960 3300049583 Bacteria 783
200 Ga0501071_0653799 3300049587 Bacteria 809
201 Ga0501075_0455401 3300049591 Bacteria 976
202 Ga0501198_000023 3300049649 Bacteria 69100
203 Ga0501206_004296 3300049653 Bacteria 1811
204 Ga0501207_014093 3300049654 Bacteria 1217
205 Ga0501222_000031 3300049662 Bacteria 56867
206 Ga0501239_077718 3300049672 Bacteria 527
207 Ga0501253_013192 3300049683 Bacteria 1311
208 Ga0501257_016938 3300049686 Bacteria 1693
209 Ga0501221_259582 3300049704 Bacteria 502
210 Ga0501262_013596 3300049759 Bacteria 1051
211 Ga0501265_010813 3300049762 Bacteria 1119
212 Ga0501276_006621 3300049773 Bacteria 915
213 Ga0501045_0025746 3300049824 Bacteria 4230
214 nmdc:mga03n38_133599_c1 3300050490 Bacteria 1232
215 nmdc:mga0k408_249378_c1 3300050493 Bacteria 1060
216 nmdc:mga0k408_28834_c1 3300050493 Bacteria 3157
217 nmdc:mga0k408_43192_c1 3300050493 Bacteria 2597
218 nmdc:mga0k408_739661_c1 3300050493 Unclassified 575
219 nmdc:mga0k408_9843_c1 3300050493 Bacteria 5161
220 nmdc:mga04h51_119250_c1 3300050495 Bacteria 981
221 nmdc:mga07m45_31539_c1 3300050496 Bacteria 2937
222 nmdc:mga07m45_42791_c1 3300050496 Bacteria 2540
223 nmdc:mga07m45_70231_c1 3300050496 Bacteria 1992
224 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
225 nmdc:mga0qj67_1019411_c1 3300050509 Bacteria 649
226 Ga0500578_0033348 3300053086 Bacteria 3309
227 Ga0500593_000267 3300053117 Bacteria 21261
228 Ga0500652_281474 3300053131 Bacteria 649
229 Ga0500559_0001012 3300053136 Bacteria 17282
230 Ga0500636_0499980 3300053177 Bacteria 537
231 Ga0500645_001890 3300053730 Bacteria 9999
232 Ga0590075_058455 3300059424 Bacteria 993
233 Ga0466962_0003827 3300061719 Bacteria 7192
234 2644247264 2643221644 Bacteria 6865017
235 2644303521 2643221654 Bacteria 5273570
236 Ga0451577_0015259
237 rootH1_10097385
238 rootH2_10038579
239 rootL2_10176069
240 Ga0070676_10257501
241 Ga0070690_100528914
242 Ga0068869_100217947
243 Ga0070661_100362790
244 Ga0070668_100082817
245 Ga0070675_101706590
246 Ga0070671_100593016
247 Ga0070674_100231167
248 Ga0070674_101082722
249 Ga0070667_100479063
250 Ga0070700_100014555
251 Ga0070708_101587103
252 Ga0070663_100760177
253 Ga0070678_100102186
254 Ga0070678_100821807
255 Ga0068867_100020712
256 Ga0068867_100052071
257 Ga0068867_100160757
258 Ga0068867_101017821
259 Ga0068867_101582546
260 Ga0070706_100031098
261 Ga0070707_100531452
262 Ga0070699_101481392
263 Ga0070686_100845098
264 Ga0070665_101540692
265 Ga0068854_100133072
266 Ga0068859_101490370
267 Ga0068866_10002740
268 Ga0068866_10490360
269 Ga0068866_10906702
270 Ga0068861_100005508
271 Ga0068861_100635358
272 Ga0068863_100099353
273 Ga0068858_100520024
274 Ga0068860_100017835
275 Ga0068860_100166371
276 Ga0068862_100002626
277 Ga0068862_100032603
278 Ga0068862_100035259
279 Ga0075368_10105209
280 Ga0075363_100221748
281 Ga0075366_10010694
282 Ga0075366_10025447
283 Ga0075366_10049812
284 Ga0075366_10068193
285 Ga0075366_10324781
286 Ga0075366_10990908
287 Ga0097621_101626954
288 Ga0075370_10040634
289 Ga0075370_10263242
290 Ga0075370_10826070
291 Ga0068871_101057102
292 Ga0075430_100449790
293 Ga0075429_100006177
294 Ga0068865_100050852
295 Ga0097620_101490308
296 Ga0105245_12748401
297 Ga0105247_10423116
298 Ga0105243_10014728
299 Ga0105243_10020108
300 Ga0105243_10353300
301 Ga0105242_10337409
302 Ga0105242_11024136
303 Ga0105249_10017892
304 Ga0105249_10293441
305 Ga0105249_10623052
306 Ga0157374_10010932
307 Ga0157378_10003330
308 Ga0157378_10141586
309 Ga0163162_10005003
310 Ga0157375_10062210
311 Ga0157380_10061404
312 Ga0157380_10063579
313 Ga0157379_10029042
314 Ga0157379_10532529
315 Ga0157376_11225180
316 Ga0163161_10080670
317 Ga0207682_10266201
318 Ga0207642_10016280
319 Ga0207642_10610665
320 Ga0207680_10573993
321 Ga0207645_10270625
322 Ga0207684_10033806
323 Ga0207681_10303439
324 Ga0207659_11324653
325 Ga0207687_10696352
326 Ga0207686_10211559
327 Ga0207686_11031640
328 Ga0207709_10014331
329 Ga0207709_10076087
330 Ga0207709_10229289
331 Ga0207669_10197093
332 Ga0207669_11284442
333 Ga0207669_11407238
334 Ga0207704_10003481
335 Ga0207691_10044864
336 Ga0207689_10533235
337 Ga0207712_10165533
338 Ga0207712_10334836
339 Ga0207712_10713194
340 Ga0207640_10277022
341 Ga0207658_10347072
342 Ga0207677_11088399
343 Ga0207703_10623719
344 Ga0207703_10685778
345 Ga0207678_10984854
346 Ga0207708_10013014
347 Ga0207648_10000419
348 Ga0207648_10134465
349 Ga0207648_10414866
350 Ga0207648_11360362
351 Ga0207675_100000693
352 Ga0207675_100516870
353 Ga0207683_10124817
354 Ga0209813_10100745
355 Ga0268266_11656676
356 Ga0268265_10013134
357 Ga0268265_10014510
358 Ga0268265_10163438
359 Ga0268264_10039249
360 Ga0268264_10102470
361 Ga0307515_10016911
362 Ga0307509_10330607
363 Ga0307408_100323312
364 Ga0307516_10000952
365 Ga0307516_10048497
366 Ga0307413_10603175
367 Ga0307410_10168777
368 Ga0307406_10195078
369 Ga0307407_10419920
370 Ga0307409_102216214
371 Ga0307416_100090220
372 Ga0307414_10777918
373 Ga0307415_101885323
374 Ga0307510_10001950
375 Ga0373960_0440518
376 Ga0373931_0788624
377 Ga0373927_0231267
378 Ga0373937_0076404
379 Ga0373925_0014382
380 Ga0395900_0001308
381 Ga0395898_0002912
382 Ga0395898_0732779
383 Ga0395905_0005907
384 Ga0395905_0283609
385 Ga0395905_1701497
386 Ga0439461_0093152
387 Ga0450919_000090
388 Ga0450920_010130
389 Ga0439446_0128593
390 Ga0450918_000050
391 Ga0451577_0112030
392 Ga0451577_0737522
393 Ga0466969_0059329
394 Ga0466965_0008073
395 Ga0466966_0002245
396 Ga0466966_0240923
397 Ga0466961_0001917
398 Ga0466961_0055885
399 Ga0466963_0809731
400 Ga0466964_0014157
401 Ga0466964_0065099
402 Ga0453684_0227398
403 Ga0453684_0634857
404 Ga0466971_0262389
405 Ga0466968_0095284
406 Ga0466970_0100048
407 Ga0466957_0121783
408 Ga0466957_0462501
409 Ga0466959_0000132
410 Ga0466959_0055489
411 Ga0451576_0000114
412 Ga0451576_0071004
413 Ga0466958_0101781
414 Ga0466967_0185061
415 Ga0495650_0004342
416 Ga0495618_0113019
417 Ga0495643_0062955
418 Ga0495658_0019652
419 Ga0495686_0001272
420 Ga0495686_0114721
421 Ga0496102_0027006
422 Ga0496104_0142657
423 Ga0496105_0371325
424 Ga0496106_0040494
425 Ga0496113_0112344
426 Ga0501298_083485
427 Ga0501032_0291326
428 Ga0501034_1664300
429 Ga0501042_1355612
430 Ga0501043_0000277
431 Ga0501046_0000345
432 Ga0501047_0000395
433 Ga0501048_0000111
434 Ga0501067_0383960
435 Ga0501071_0653799
436 Ga0501075_0455401
437 Ga0501198_000023
438 Ga0501206_004296
439 Ga0501207_014093
440 Ga0501222_000031
441 Ga0501239_077718
442 Ga0501253_013192
443 Ga0501257_016938
444 Ga0501221_259582
445 Ga0501262_013596
446 Ga0501265_010813
447 Ga0501276_006621
448 Ga0501045_0025746
449 nmdc:mga03n38_133599_c1
450 nmdc:mga0k408_249378_c1
451 nmdc:mga0k408_28834_c1
452 nmdc:mga0k408_43192_c1
453 nmdc:mga0k408_739661_c1
454 nmdc:mga0k408_9843_c1
455 nmdc:mga04h51_119250_c1
456 nmdc:mga07m45_31539_c1
457 nmdc:mga07m45_42791_c1
458 nmdc:mga07m45_70231_c1
459 nmdc:mga09592_1109_c1
460 nmdc:mga0qj67_1019411_c1
461 Ga0500578_0033348
462 Ga0500593_000267
463 Ga0500652_281474
464 Ga0500559_0001012
465 Ga0500636_0499980
466 Ga0500645_001890
467 Ga0590075_058455
468 Ga0466962_0003827
469 2644247264
470 2644303521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08895

DUF1840

Domain of unknown function (DUF1840)

10

116

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jax-assembly1.cif.gz_A cryo-em structure of holo form of scbfr with o symmetry 0.8011 39 81
5hjf-assembly1.cif.gz_D the apo form of dps4 from nostoc punctiforme 0.7719 39 81
3qky-assembly1.cif.gz_A crystal structure of rhodothermus marinus bamd 0.7486 39 81
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.7186 39 82
3o4x-assembly2.cif.gz_F crystal structure of complex between amino and carboxy terminal fragments of mdia1 0.7002 39 81
ID Description Score Start End Superfamily
2w2uB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8083 39 81 1.20.58.80
af_Q9BL83_2_86_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8008 39 81 1.20.58.80
af_A0A0R4IPK7_4_76_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.7989 39 81 1.20.58.80
af_Q9VKK1_1266_1354_1.10.220.100 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;conserved c-terminal region of ge- 1 0.7935 39 81 1.10.220.100
af_P77453_7_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.783 33 89 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A6N8ITW3-F1-model_v4 DUF1840 family protein 0.9273 1 89
AF-A0A4S5BR63-F1-model_v4 DUF1840 domain-containing protein 0.9273 2 89
AF-A0A2T6JIU8-F1-model_v4 Cyclopropane-fatty-acyl-phospholipid synthase 0.927 1 89
AF-A0A177RKW2-F1-model_v4 deleted 0.9249 3 89
AF-A0A1Y0NBI2-F1-model_v4 DUF1840 domain-containing protein 0.9181 1 89

Map