F348383
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 138 | 233 | 566 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0040202|Ga0453684_0040202_2352_4070 |
| Length | 572 |
| Sequence | MEKRWNLLRPDEQDVARLQQELGISPILCRILVERGVRTFQDAHQFFRPSLESLHDPFLMKDMTLAVDRIMKAMVQRERILVYGDYDVDGTTAVGCMYRFLCKIYEKDLIDFYIPHRYREGYGVSRQGVDHAINQGYKLVIALDCGIKSQELISYAKEQGVDFIVCDHHLPDELLPPAVAILNPKQKDCPYPYKELCGCGVGLKLITAIVRQSDLPDELWMECLELTATAIAADIVPMTGENRVIAYYGLKRTNENPSVALKALMNVSGMKGKVLIQHLVFMIAPRVNAAGRMDDARKVVNLFIENDFDKAAEYAKELHSDNADRKEADLSITKEALSLIREYETIXKRKSTVVYQPHWHKGVVGIVASRLIEHYYRPTIVLTRSGDVVAGSARSIPGFNIHDGLEQCKDLLLGFGGHYFAAGMTMLPENVEAFSARFNEVVEGLLLEHYFTPEIRIDAEVHLADCNRKFYDIVHQMEPFGPENPQPVLVARGLRDTGHSKVVKDLHLRLVVKQDNSAVMSGIGFNLADKYQIIASGRPFDVVFTLDENEWQGNISLQMKVIDMKAAEKIER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 133 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 135 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 136 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 137 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 138 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.83 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001060 | 3300002459 | Bacteria | 5973 |
| 2 | JGI25160J50197_1001628 | 3300003354 | Bacteria | 11022 |
| 3 | Ga0065712_10017779 | 3300005290 | Bacteria | 2094 |
| 4 | Ga0065712_10069417 | 3300005290 | Bacteria | 7342 |
| 5 | Ga0065712_10072996 | 3300005290 | Bacteria | 4538 |
| 6 | Ga0070676_10005866 | 3300005328 | Bacteria | 6556 |
| 7 | Ga0070676_10005951 | 3300005328 | Bacteria | 6509 |
| 8 | Ga0070683_100014181 | 3300005329 | Bacteria | 6962 |
| 9 | Ga0070683_100051389 | 3300005329 | Bacteria | 3816 |
| 10 | Ga0070690_100066009 | 3300005330 | Bacteria | 2341 |
| 11 | Ga0070670_100013127 | 3300005331 | Bacteria | 7096 |
| 12 | Ga0070670_100018853 | 3300005331 | Bacteria | 5917 |
| 13 | Ga0068869_100006968 | 3300005334 | Bacteria | 7194 |
| 14 | Ga0068869_100034971 | 3300005334 | Bacteria | 3558 |
| 15 | Ga0068869_100074134 | 3300005334 | Unclassified | 2525 |
| 16 | Ga0068868_100096959 | 3300005338 | Bacteria | 2382 |
| 17 | Ga0070689_100007198 | 3300005340 | Bacteria | 7758 |
| 18 | Ga0070689_100012023 | 3300005340 | Bacteria | 6222 |
| 19 | Ga0070661_100001685 | 3300005344 | Bacteria | 15290 |
| 20 | Ga0070668_100038487 | 3300005347 | Bacteria | 3655 |
| 21 | Ga0070668_100052239 | 3300005347 | Bacteria | 3150 |
| 22 | Ga0070669_100002558 | 3300005353 | Bacteria | 13155 |
| 23 | Ga0070669_100008912 | 3300005353 | Bacteria | 7156 |
| 24 | Ga0070669_100035764 | 3300005353 | Bacteria | 3599 |
| 25 | Ga0070675_100007641 | 3300005354 | Bacteria | 8365 |
| 26 | Ga0070675_100013996 | 3300005354 | Bacteria | 6316 |
| 27 | Ga0070675_100016926 | 3300005354 | Bacteria | 5790 |
| 28 | Ga0070675_100040169 | 3300005354 | Bacteria | 3818 |
| 29 | Ga0070675_100042784 | 3300005354 | Bacteria | 3702 |
| 30 | Ga0070671_100025467 | 3300005355 | Bacteria | 4854 |
| 31 | Ga0070673_100010236 | 3300005364 | Bacteria | 6338 |
| 32 | Ga0070673_100017650 | 3300005364 | Bacteria | 5080 |
| 33 | Ga0070673_100110882 | 3300005364 | Bacteria | 2275 |
| 34 | Ga0070688_100023920 | 3300005365 | Bacteria | 3598 |
| 35 | Ga0070688_100071259 | 3300005365 | Bacteria | 2224 |
| 36 | Ga0070659_100039972 | 3300005366 | Bacteria | 3664 |
| 37 | Ga0070701_10030371 | 3300005438 | Bacteria | 2673 |
| 38 | Ga0070701_10038407 | 3300005438 | Bacteria | 2423 |
| 39 | Ga0070662_100017902 | 3300005457 | Bacteria | 4782 |
| 40 | Ga0068867_100027083 | 3300005459 | Bacteria | 4118 |
| 41 | Ga0070685_10002538 | 3300005466 | Bacteria | 9358 |
| 42 | Ga0070685_10003424 | 3300005466 | Bacteria | 8067 |
| 43 | Ga0070698_100002515 | 3300005471 | Bacteria | 20194 |
| 44 | Ga0070698_100007127 | 3300005471 | Bacteria | 12109 |
| 45 | Ga0070684_100001962 | 3300005535 | Bacteria | 15111 |
| 46 | Ga0070684_100003757 | 3300005535 | Bacteria | 11456 |
| 47 | Ga0068853_100002136 | 3300005539 | Bacteria | 14716 |
| 48 | Ga0068853_100027325 | 3300005539 | Bacteria | 4794 |
| 49 | Ga0070672_100111329 | 3300005543 | Bacteria | 2232 |
| 50 | Ga0070686_100011384 | 3300005544 | Bacteria | 5045 |
| 51 | Ga0070686_100023978 | 3300005544 | Bacteria | 3653 |
| 52 | Ga0070665_100213560 | 3300005548 | Bacteria | 1930 |
| 53 | Ga0070664_100001137 | 3300005564 | Bacteria | 21035 |
| 54 | Ga0070664_100003013 | 3300005564 | Bacteria | 13617 |
| 55 | Ga0070664_100012818 | 3300005564 | Bacteria | 6819 |
| 56 | Ga0070664_100025500 | 3300005564 | Bacteria | 4901 |
| 57 | Ga0068857_100001716 | 3300005577 | Bacteria | 17629 |
| 58 | Ga0068857_100097609 | 3300005577 | Bacteria | 2634 |
| 59 | Ga0068854_100012732 | 3300005578 | Bacteria | 5509 |
| 60 | Ga0070702_100001348 | 3300005615 | Bacteria | 9999 |
| 61 | Ga0068852_100009539 | 3300005616 | Bacteria | 7214 |
| 62 | Ga0068852_100016873 | 3300005616 | Bacteria | 5711 |
| 63 | Ga0068852_100142394 | 3300005616 | Unclassified | 2220 |
| 64 | Ga0068859_100016441 | 3300005617 | Bacteria | 7431 |
| 65 | Ga0068859_100056549 | 3300005617 | Bacteria | 3949 |
| 66 | Ga0068859_100065027 | 3300005617 | Bacteria | 3681 |
| 67 | Ga0068866_10008075 | 3300005718 | Bacteria | 4423 |
| 68 | Ga0068861_100023894 | 3300005719 | Bacteria | 4413 |
| 69 | Ga0068861_100045619 | 3300005719 | Bacteria | 3302 |
| 70 | Ga0068861_100083308 | 3300005719 | Bacteria | 2508 |
| 71 | Ga0068870_10008993 | 3300005840 | Bacteria | 4519 |
| 72 | Ga0068870_10011260 | 3300005840 | Bacteria | 4140 |
| 73 | Ga0068863_100119539 | 3300005841 | Bacteria | 2512 |
| 74 | Ga0068858_100055288 | 3300005842 | Bacteria | 3669 |
| 75 | Ga0068858_100101744 | 3300005842 | Bacteria | 2680 |
| 76 | Ga0068860_100000777 | 3300005843 | Bacteria | 35916 |
| 77 | Ga0068860_100042991 | 3300005843 | Bacteria | 4312 |
| 78 | Ga0068862_100076357 | 3300005844 | Bacteria | 2899 |
| 79 | Ga0068862_100077428 | 3300005844 | Bacteria | 2880 |
| 80 | Ga0075366_10003483 | 3300006195 | Bacteria | 8315 |
| 81 | Ga0097621_100011987 | 3300006237 | Bacteria | 6415 |
| 82 | Ga0068871_100007281 | 3300006358 | Bacteria | 7893 |
| 83 | Ga0068871_100094455 | 3300006358 | Bacteria | 2496 |
| 84 | Ga0075428_100050487 | 3300006844 | Bacteria | 4561 |
| 85 | Ga0075428_100080994 | 3300006844 | Bacteria | 3544 |
| 86 | Ga0075430_100019746 | 3300006846 | Bacteria | 5733 |
| 87 | Ga0075429_100000947 | 3300006880 | Bacteria | 22975 |
| 88 | Ga0097620_100016441 | 3300006931 | Bacteria | 7431 |
| 89 | Ga0097620_100056556 | 3300006931 | Bacteria | 3949 |
| 90 | Ga0097620_100065023 | 3300006931 | Bacteria | 3681 |
| 91 | Ga0111539_10001397 | 3300009094 | Bacteria | 32129 |
| 92 | Ga0111539_10182454 | 3300009094 | Bacteria | 2451 |
| 93 | Ga0105247_10004404 | 3300009101 | Bacteria | 8986 |
| 94 | Ga0105242_10002114 | 3300009176 | Bacteria | 15663 |
| 95 | Ga0105242_10033557 | 3300009176 | Bacteria | 4110 |
| 96 | Ga0105242_10051079 | 3300009176 | Bacteria | 3368 |
| 97 | Ga0105237_10019152 | 3300009545 | Bacteria | 7072 |
| 98 | Ga0105237_10072328 | 3300009545 | Bacteria | 3442 |
| 99 | Ga0105249_10000762 | 3300009553 | Bacteria | 28926 |
| 100 | Ga0105249_10002189 | 3300009553 | Bacteria | 16912 |
| 101 | Ga0105249_10005156 | 3300009553 | Bacteria | 11273 |
| 102 | Ga0105249_10070155 | 3300009553 | Bacteria | 3234 |
| 103 | Ga0105249_10142151 | 3300009553 | Bacteria | 2302 |
| 104 | Ga0105239_10015804 | 3300010375 | Bacteria | 8352 |
| 105 | Ga0157373_10000199 | 3300013100 | Bacteria | 49515 |
| 106 | Ga0157371_10002520 | 3300013102 | Bacteria | 17411 |
| 107 | Ga0157371_10015329 | 3300013102 | Bacteria | 5753 |
| 108 | Ga0157369_10008293 | 3300013105 | Bacteria | 11910 |
| 109 | Ga0157369_10033874 | 3300013105 | Bacteria | 5609 |
| 110 | Ga0157374_10027172 | 3300013296 | Bacteria | 5158 |
| 111 | Ga0157374_10028975 | 3300013296 | Bacteria | 5006 |
| 112 | Ga0157374_10213219 | 3300013296 | Bacteria | 1894 |
| 113 | Ga0157378_10000709 | 3300013297 | Bacteria | 31237 |
| 114 | Ga0157378_10024574 | 3300013297 | Bacteria | 5304 |
| 115 | Ga0157378_10091839 | 3300013297 | Bacteria | 2761 |
| 116 | Ga0163162_10006844 | 3300013306 | Bacteria | 11062 |
| 117 | Ga0163162_10007652 | 3300013306 | Bacteria | 10523 |
| 118 | Ga0163162_10052497 | 3300013306 | Bacteria | 4095 |
| 119 | Ga0163162_10105300 | 3300013306 | Bacteria | 2915 |
| 120 | Ga0157372_10027589 | 3300013307 | Bacteria | 6187 |
| 121 | Ga0157372_10044094 | 3300013307 | Bacteria | 4941 |
| 122 | Ga0157372_10061844 | 3300013307 | Bacteria | 4193 |
| 123 | Ga0157372_10067961 | 3300013307 | Bacteria | 4006 |
| 124 | Ga0157372_10072526 | 3300013307 | Bacteria | 3880 |
| 125 | Ga0157372_10105605 | 3300013307 | Bacteria | 3221 |
| 126 | Ga0157372_10167475 | 3300013307 | Bacteria | 2541 |
| 127 | Ga0157375_10020664 | 3300013308 | Bacteria | 6019 |
| 128 | Ga0157375_10055764 | 3300013308 | Bacteria | 3898 |
| 129 | Ga0157375_10075406 | 3300013308 | Bacteria | 3397 |
| 130 | Ga0163163_10001556 | 3300014325 | Bacteria | 19351 |
| 131 | Ga0163163_10086740 | 3300014325 | Bacteria | 3139 |
| 132 | Ga0157380_10010105 | 3300014326 | Bacteria | 6778 |
| 133 | Ga0157377_10005648 | 3300014745 | Bacteria | 5895 |
| 134 | Ga0157377_10008569 | 3300014745 | Bacteria | 4991 |
| 135 | Ga0157379_10068647 | 3300014968 | Bacteria | 3169 |
| 136 | Ga0157376_10014112 | 3300014969 | Bacteria | 5984 |
| 137 | Ga0157376_10083249 | 3300014969 | Bacteria | 2752 |
| 138 | Ga0163161_10024857 | 3300017792 | Bacteria | 4235 |
| 139 | Ga0213876_10012025 | 3300021384 | Unclassified | 4609 |
| 140 | Ga0207426_1000104 | 3300025302 | Bacteria | 249464 |
| 141 | Ga0207642_10004146 | 3300025899 | Bacteria | 4653 |
| 142 | Ga0207647_10000491 | 3300025904 | Bacteria | 31654 |
| 143 | Ga0207645_10009721 | 3300025907 | Bacteria | 6644 |
| 144 | Ga0207643_10003438 | 3300025908 | Bacteria | 8518 |
| 145 | Ga0207705_10018038 | 3300025909 | Bacteria | 5046 |
| 146 | Ga0207662_10058275 | 3300025918 | Bacteria | 2311 |
| 147 | Ga0207649_10062692 | 3300025920 | Bacteria | 2344 |
| 148 | Ga0207681_10016644 | 3300025923 | Unclassified | 4604 |
| 149 | Ga0207650_10092823 | 3300025925 | Bacteria | 2310 |
| 150 | Ga0207659_10006734 | 3300025926 | Bacteria | 7060 |
| 151 | Ga0207644_10011349 | 3300025931 | Bacteria | 5894 |
| 152 | Ga0207644_10032667 | 3300025931 | Bacteria | 3633 |
| 153 | Ga0207690_10018682 | 3300025932 | Bacteria | 4254 |
| 154 | Ga0207706_10027015 | 3300025933 | Bacteria | 5134 |
| 155 | Ga0207706_10030989 | 3300025933 | Bacteria | 4766 |
| 156 | Ga0207706_10031432 | 3300025933 | Bacteria | 4730 |
| 157 | Ga0207686_10001023 | 3300025934 | Bacteria | 16552 |
| 158 | Ga0207670_10002872 | 3300025936 | Bacteria | 9089 |
| 159 | Ga0207704_10009475 | 3300025938 | Bacteria | 4700 |
| 160 | Ga0207691_10008415 | 3300025940 | Bacteria | 9913 |
| 161 | Ga0207691_10014903 | 3300025940 | Bacteria | 7408 |
| 162 | Ga0207691_10083925 | 3300025940 | Bacteria | 2860 |
| 163 | Ga0207691_10133171 | 3300025940 | Bacteria | 2194 |
| 164 | Ga0207689_10017893 | 3300025942 | Bacteria | 5985 |
| 165 | Ga0207689_10025610 | 3300025942 | Bacteria | 4943 |
| 166 | Ga0207689_10061309 | 3300025942 | Bacteria | 3093 |
| 167 | Ga0207661_10017740 | 3300025944 | Bacteria | 5274 |
| 168 | Ga0207679_10000777 | 3300025945 | Bacteria | 20886 |
| 169 | Ga0207651_10014463 | 3300025960 | Bacteria | 4559 |
| 170 | Ga0207651_10020492 | 3300025960 | Bacteria | 3992 |
| 171 | Ga0207651_10056154 | 3300025960 | Bacteria | 2708 |
| 172 | Ga0207651_10112573 | 3300025960 | Bacteria | 2046 |
| 173 | Ga0207712_10000883 | 3300025961 | Bacteria | 21786 |
| 174 | Ga0207712_10005652 | 3300025961 | Bacteria | 7888 |
| 175 | Ga0207640_10008037 | 3300025981 | Bacteria | 5831 |
| 176 | Ga0207658_10019680 | 3300025986 | Bacteria | 4669 |
| 177 | Ga0207703_10054372 | 3300026035 | Bacteria | 3256 |
| 178 | Ga0207639_10026983 | 3300026041 | Bacteria | 4178 |
| 179 | Ga0207678_10116136 | 3300026067 | Bacteria | 2283 |
| 180 | Ga0207708_10034135 | 3300026075 | Bacteria | 3868 |
| 181 | Ga0207708_10047493 | 3300026075 | Unclassified | 3268 |
| 182 | Ga0207641_10001211 | 3300026088 | Bacteria | 25807 |
| 183 | Ga0207648_10003652 | 3300026089 | Bacteria | 16108 |
| 184 | Ga0207648_10027695 | 3300026089 | Bacteria | 5029 |
| 185 | Ga0207648_10083838 | 3300026089 | Unclassified | 2780 |
| 186 | Ga0207676_10024768 | 3300026095 | Bacteria | 4444 |
| 187 | Ga0207676_10040991 | 3300026095 | Bacteria | 3552 |
| 188 | Ga0207676_10137138 | 3300026095 | Bacteria | 2089 |
| 189 | Ga0207674_10003303 | 3300026116 | Bacteria | 19833 |
| 190 | Ga0207674_10010027 | 3300026116 | Bacteria | 10780 |
| 191 | Ga0207674_10116937 | 3300026116 | Bacteria | 2637 |
| 192 | Ga0207675_100008354 | 3300026118 | Bacteria | 9755 |
| 193 | Ga0207675_100016834 | 3300026118 | Bacteria | 6830 |
| 194 | Ga0207683_10006924 | 3300026121 | Bacteria | 9708 |
| 195 | Ga0207683_10011596 | 3300026121 | Bacteria | 7526 |
| 196 | Ga0207698_10004661 | 3300026142 | Bacteria | 8377 |
| 197 | Ga0207698_10010210 | 3300026142 | Bacteria | 6019 |
| 198 | Ga0268264_10001090 | 3300028381 | Bacteria | 26846 |
| 199 | Ga0265327_10000974 | 3300031251 | Bacteria | 40908 |
| 200 | Ga0395900_0195158 | 3300037418 | Bacteria | 2051 |
| 201 | Ga0436365_0212609 | 3300039437 | Bacteria | 25185 |
| 202 | Ga0450894_003256 | 3300042131 | Bacteria | 2130 |
| 203 | Ga0453684_0023157 | 3300044712 | Bacteria | 9166 |
| 204 | Ga0453684_0040202 | 3300044712 | Bacteria | 6358 |
| 205 | Ga0495630_0004081 | 3300046517 | Bacteria | 10226 |
| 206 | Ga0495668_0000212 | 3300046616 | Bacteria | 84542 |
| 207 | Ga0495672_0047528 | 3300047320 | Bacteria | 2551 |
| 208 | Ga0495686_0010470 | 3300047472 | Bacteria | 6593 |
| 209 | Ga0501034_0007696 | 3300049571 | Bacteria | 11462 |
| 210 | Ga0501036_0008875 | 3300049572 | Bacteria | 8256 |
| 211 | Ga0501037_0013848 | 3300049573 | Bacteria | 5943 |
| 212 | Ga0501038_0014503 | 3300049574 | Bacteria | 7182 |
| 213 | Ga0501039_0006695 | 3300049575 | Bacteria | 8762 |
| 214 | Ga0501039_0029121 | 3300049575 | Bacteria | 4253 |
| 215 | Ga0501043_0003681 | 3300049579 | Bacteria | 12590 |
| 216 | Ga0501046_0003394 | 3300049580 | Bacteria | 14611 |
| 217 | Ga0501067_0006884 | 3300049583 | Bacteria | 6308 |
| 218 | Ga0501070_0009462 | 3300049586 | Bacteria | 8237 |
| 219 | Ga0501074_0002265 | 3300049590 | Bacteria | 13385 |
| 220 | Ga0501080_0016638 | 3300049742 | Bacteria | 6792 |
| 221 | Ga0501083_0010295 | 3300049744 | Bacteria | 6589 |
| 222 | Ga0501035_0093657 | 3300049822 | Bacteria | 2643 |
| 223 | Ga0501044_0016285 | 3300049823 | Bacteria | 7988 |
| 224 | Ga0501044_0020439 | 3300049823 | Bacteria | 7070 |
| 225 | Ga0501044_0028605 | 3300049823 | Bacteria | 5883 |
| 226 | Ga0501044_0034366 | 3300049823 | Bacteria | 5317 |
| 227 | nmdc:mga0k408_17861_c1 | 3300050493 | Bacteria | 3954 |
| 228 | nmdc:mga09592_30892_c1 | 3300050508 | Bacteria | 4460 |
| 229 | Ga0500644_0010482 | 3300053088 | Bacteria | 2511 |
| 230 | Ga0500646_0006570 | 3300053090 | Bacteria | 2958 |
| 231 | Ga0500562_000073 | 3300053108 | Bacteria | 47462 |
| 232 | Ga0500568_0001078 | 3300053139 | Bacteria | 18433 |
| 233 | Ga0500661_001277 | 3300055283 | Bacteria | 4701 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_0004081 | Ga0495630_0004081_678_2096 | 460 |
| 2 | 3300053088 | Ga0500644_0010482 | Ga0500644_0010482_10_1503 | 485 |
| 3 | 3300049823 | Ga0501044_0034366 | Ga0501044_0034366_53_1573 | 494 |
| 4 | 3300013307 | Ga0157372_10067961 | Ga0157372_100679613 | 517 |
| 5 | 3300005577 | Ga0068857_100097609 | Ga0068857_1000976091 | 541 |
| 6 | 3300005841 | Ga0068863_100119539 | Ga0068863_1001195391 | 541 |
| 7 | 3300025940 | Ga0207691_10083925 | Ga0207691_100839252 | 541 |
| 8 | 3300026095 | Ga0207676_10024768 | Ga0207676_100247683 | 541 |
| 9 | 3300026116 | Ga0207674_10116937 | Ga0207674_101169372 | 541 |
| 10 | 3300021384 | Ga0213876_10012025 | Ga0213876_100120252 | 544 |
| 11 | 3300039437 | Ga0436365_0212609 | Ga0436365_0212609_20552_22222 | 544 |
| 12 | 3300005328 | Ga0070676_10005866 | Ga0070676_100058662 | 545 |
| 13 | 3300005354 | Ga0070675_100016926 | Ga0070675_1000169265 | 545 |
| 14 | 3300005355 | Ga0070671_100025467 | Ga0070671_1000254672 | 545 |
| 15 | 3300005544 | Ga0070686_100023978 | Ga0070686_1000239783 | 545 |
| 16 | 3300005564 | Ga0070664_100003013 | Ga0070664_1000030137 | 545 |
| 17 | 3300005615 | Ga0070702_100001348 | Ga0070702_1000013486 | 545 |
| 18 | 3300005616 | Ga0068852_100142394 | Ga0068852_1001423942 | 545 |
| 19 | 3300005842 | Ga0068858_100101744 | Ga0068858_1001017442 | 545 |
| 20 | 3300025920 | Ga0207649_10062692 | Ga0207649_100626922 | 545 |
| 21 | 3300025931 | Ga0207644_10011349 | Ga0207644_100113493 | 545 |
| 22 | 3300025940 | Ga0207691_10014903 | Ga0207691_100149031 | 545 |
| 23 | 3300005548 | Ga0070665_100213560 | Ga0070665_1002135602 | 548 |
| 24 | 3300026067 | Ga0207678_10116136 | Ga0207678_101161361 | 548 |
| 25 | 3300046616 | Ga0495668_0000212 | Ga0495668_0000212_74621_76318 | 548 |
| 26 | iso_pu_bacteria | 2818991444 | 2819588088 | 551 |
| 27 | 3300013297 | Ga0157378_10000709 | Ga0157378_100007096 | 552 |
| 28 | 3300014745 | Ga0157377_10008569 | Ga0157377_100085693 | 552 |
| 29 | iso_pu_bacteria | 2929154850 | 2929157917 | 552 |
| 30 | 3300005290 | Ga0065712_10069417 | Ga0065712_100694172 | 553 |
| 31 | 3300005466 | Ga0070685_10002538 | Ga0070685_100025387 | 553 |
| 32 | 3300005617 | Ga0068859_100056549 | Ga0068859_1000565493 | 553 |
| 33 | 3300005719 | Ga0068861_100045619 | Ga0068861_1000456192 | 553 |
| 34 | 3300005843 | Ga0068860_100000777 | Ga0068860_10000077720 | 553 |
| 35 | 3300006358 | Ga0068871_100094455 | Ga0068871_1000944551 | 553 |
| 36 | 3300006844 | Ga0075428_100080994 | Ga0075428_1000809943 | 553 |
| 37 | 3300006931 | Ga0097620_100056556 | Ga0097620_1000565562 | 553 |
| 38 | 3300009176 | Ga0105242_10002114 | Ga0105242_100021142 | 553 |
| 39 | 3300009545 | Ga0105237_10072328 | Ga0105237_100723282 | 553 |
| 40 | 3300009553 | Ga0105249_10002189 | Ga0105249_100021898 | 553 |
| 41 | 3300009553 | Ga0105249_10070155 | Ga0105249_100701552 | 553 |
| 42 | 3300010375 | Ga0105239_10015804 | Ga0105239_100158047 | 553 |
| 43 | 3300013105 | Ga0157369_10008293 | Ga0157369_100082935 | 553 |
| 44 | 3300013296 | Ga0157374_10028975 | Ga0157374_100289752 | 553 |
| 45 | 3300013306 | Ga0163162_10105300 | Ga0163162_101053002 | 553 |
| 46 | 3300013307 | Ga0157372_10027589 | Ga0157372_100275892 | 553 |
| 47 | 3300013307 | Ga0157372_10061844 | Ga0157372_100618442 | 553 |
| 48 | 3300025934 | Ga0207686_10001023 | Ga0207686_1000102313 | 553 |
| 49 | 3300025961 | Ga0207712_10005652 | Ga0207712_100056523 | 553 |
| 50 | 3300026088 | Ga0207641_10001211 | Ga0207641_100012113 | 553 |
| 51 | 3300028381 | Ga0268264_10001090 | Ga0268264_1000109013 | 553 |
| 52 | 3300044712 | Ga0453684_0023157 | Ga0453684_0023157_7112_8809 | 553 |
| 53 | 3300049572 | Ga0501036_0008875 | Ga0501036_0008875_190_1887 | 553 |
| 54 | 3300049573 | Ga0501037_0013848 | Ga0501037_0013848_1825_3522 | 553 |
| 55 | 3300049575 | Ga0501039_0006695 | Ga0501039_0006695_4648_6345 | 553 |
| 56 | 3300049579 | Ga0501043_0003681 | Ga0501043_0003681_2166_3863 | 553 |
| 57 | 3300049822 | Ga0501035_0093657 | Ga0501035_0093657_714_2411 | 553 |
| 58 | 3300049823 | Ga0501044_0020439 | Ga0501044_0020439_3599_5296 | 553 |
| 59 | 3300049823 | Ga0501044_0028605 | Ga0501044_0028605_1829_3526 | 553 |
| 60 | 3300005290 | Ga0065712_10017779 | Ga0065712_100177791 | 554 |
| 61 | 3300005331 | Ga0070670_100018853 | Ga0070670_1000188532 | 554 |
| 62 | 3300005334 | Ga0068869_100006968 | Ga0068869_1000069683 | 554 |
| 63 | 3300005334 | Ga0068869_100074134 | Ga0068869_1000741342 | 554 |
| 64 | 3300005338 | Ga0068868_100096959 | Ga0068868_1000969592 | 554 |
| 65 | 3300005340 | Ga0070689_100007198 | Ga0070689_1000071982 | 554 |
| 66 | 3300005347 | Ga0070668_100052239 | Ga0070668_1000522392 | 554 |
| 67 | 3300005353 | Ga0070669_100008912 | Ga0070669_1000089126 | 554 |
| 68 | 3300005353 | Ga0070669_100035764 | Ga0070669_1000357642 | 554 |
| 69 | 3300005354 | Ga0070675_100040169 | Ga0070675_1000401692 | 554 |
| 70 | 3300005364 | Ga0070673_100110882 | Ga0070673_1001108822 | 554 |
| 71 | 3300005365 | Ga0070688_100071259 | Ga0070688_1000712592 | 554 |
| 72 | 3300005438 | Ga0070701_10030371 | Ga0070701_100303712 | 554 |
| 73 | 3300005466 | Ga0070685_10003424 | Ga0070685_100034243 | 554 |
| 74 | 3300005471 | Ga0070698_100002515 | Ga0070698_1000025158 | 554 |
| 75 | 3300005471 | Ga0070698_100007127 | Ga0070698_1000071273 | 554 |
| 76 | 3300005539 | Ga0068853_100027325 | Ga0068853_1000273252 | 554 |
| 77 | 3300005616 | Ga0068852_100016873 | Ga0068852_1000168733 | 554 |
| 78 | 3300005617 | Ga0068859_100016441 | Ga0068859_1000164412 | 554 |
| 79 | 3300005617 | Ga0068859_100065027 | Ga0068859_1000650272 | 554 |
| 80 | 3300005719 | Ga0068861_100083308 | Ga0068861_1000833082 | 554 |
| 81 | 3300005840 | Ga0068870_10008993 | Ga0068870_100089933 | 554 |
| 82 | 3300005840 | Ga0068870_10011260 | Ga0068870_100112602 | 554 |
| 83 | 3300005842 | Ga0068858_100055288 | Ga0068858_1000552882 | 554 |
| 84 | 3300005843 | Ga0068860_100042991 | Ga0068860_1000429913 | 554 |
| 85 | 3300005844 | Ga0068862_100077428 | Ga0068862_1000774282 | 554 |
| 86 | 3300006358 | Ga0068871_100007281 | Ga0068871_1000072812 | 554 |
| 87 | 3300006844 | Ga0075428_100050487 | Ga0075428_1000504872 | 554 |
| 88 | 3300006846 | Ga0075430_100019746 | Ga0075430_1000197463 | 554 |
| 89 | 3300006880 | Ga0075429_100000947 | Ga0075429_10000094712 | 554 |
| 90 | 3300006931 | Ga0097620_100016441 | Ga0097620_1000164412 | 554 |
| 91 | 3300006931 | Ga0097620_100065023 | Ga0097620_1000650232 | 554 |
| 92 | 3300009094 | Ga0111539_10182454 | Ga0111539_101824542 | 554 |
| 93 | 3300009101 | Ga0105247_10004404 | Ga0105247_100044047 | 554 |
| 94 | 3300009176 | Ga0105242_10033557 | Ga0105242_100335572 | 554 |
| 95 | 3300009553 | Ga0105249_10005156 | Ga0105249_1000515612 | 554 |
| 96 | 3300009553 | Ga0105249_10142151 | Ga0105249_101421512 | 554 |
| 97 | 3300013105 | Ga0157369_10033874 | Ga0157369_100338745 | 554 |
| 98 | 3300014745 | Ga0157377_10005648 | Ga0157377_100056482 | 554 |
| 99 | 3300025904 | Ga0207647_10000491 | Ga0207647_1000049115 | 554 |
| 100 | 3300025923 | Ga0207681_10016644 | Ga0207681_100166441 | 554 |
| 101 | 3300025925 | Ga0207650_10092823 | Ga0207650_100928232 | 554 |
| 102 | 3300025936 | Ga0207670_10002872 | Ga0207670_100028722 | 554 |
| 103 | 3300025940 | Ga0207691_10008415 | Ga0207691_100084156 | 554 |
| 104 | 3300025942 | Ga0207689_10017893 | Ga0207689_100178934 | 554 |
| 105 | 3300025960 | Ga0207651_10056154 | Ga0207651_100561542 | 554 |
| 106 | 3300025960 | Ga0207651_10112573 | Ga0207651_101125732 | 554 |
| 107 | 3300025961 | Ga0207712_10000883 | Ga0207712_100008834 | 554 |
| 108 | 3300025986 | Ga0207658_10019680 | Ga0207658_100196802 | 554 |
| 109 | 3300026075 | Ga0207708_10047493 | Ga0207708_100474932 | 554 |
| 110 | 3300026089 | Ga0207648_10003652 | Ga0207648_100036523 | 554 |
| 111 | 3300026121 | Ga0207683_10006924 | Ga0207683_1000692410 | 554 |
| 112 | 3300026142 | Ga0207698_10004661 | Ga0207698_100046617 | 554 |
| 113 | 3300031251 | Ga0265327_10000974 | Ga0265327_100009749 | 554 |
| 114 | 3300042131 | Ga0450894_003256 | Ga0450894_003256_248_1948 | 554 |
| 115 | 3300047320 | Ga0495672_0047528 | Ga0495672_0047528_574_2274 | 554 |
| 116 | 3300047472 | Ga0495686_0010470 | Ga0495686_0010470_1189_2892 | 554 |
| 117 | 3300049571 | Ga0501034_0007696 | Ga0501034_0007696_5902_7602 | 554 |
| 118 | 3300049574 | Ga0501038_0014503 | Ga0501038_0014503_2006_3706 | 554 |
| 119 | 3300049575 | Ga0501039_0029121 | Ga0501039_0029121_793_2493 | 554 |
| 120 | 3300049580 | Ga0501046_0003394 | Ga0501046_0003394_11034_12734 | 554 |
| 121 | 3300049583 | Ga0501067_0006884 | Ga0501067_0006884_3590_5290 | 554 |
| 122 | 3300049586 | Ga0501070_0009462 | Ga0501070_0009462_3938_5638 | 554 |
| 123 | 3300049590 | Ga0501074_0002265 | Ga0501074_0002265_9565_11265 | 554 |
| 124 | 3300049742 | Ga0501080_0016638 | Ga0501080_0016638_665_2365 | 554 |
| 125 | 3300049744 | Ga0501083_0010295 | Ga0501083_0010295_4854_6554 | 554 |
| 126 | 3300049823 | Ga0501044_0016285 | Ga0501044_0016285_5644_7344 | 554 |
| 127 | 3300050508 | nmdc:mga09592_30892_c1 | nmdc:mga09592_30892_c1_24_1724 | 554 |
| 128 | 3300003354 | JGI25160J50197_1001628 | JGI25160J50197_10016282 | 555 |
| 129 | 3300005290 | Ga0065712_10072996 | Ga0065712_100729966 | 555 |
| 130 | 3300005328 | Ga0070676_10005951 | Ga0070676_100059513 | 555 |
| 131 | 3300005329 | Ga0070683_100014181 | Ga0070683_1000141812 | 555 |
| 132 | 3300005329 | Ga0070683_100051389 | Ga0070683_1000513894 | 555 |
| 133 | 3300005334 | Ga0068869_100034971 | Ga0068869_1000349712 | 555 |
| 134 | 3300005340 | Ga0070689_100012023 | Ga0070689_1000120236 | 555 |
| 135 | 3300005344 | Ga0070661_100001685 | Ga0070661_10000168513 | 555 |
| 136 | 3300005353 | Ga0070669_100002558 | Ga0070669_10000255812 | 555 |
| 137 | 3300005354 | Ga0070675_100007641 | Ga0070675_1000076412 | 555 |
| 138 | 3300005354 | Ga0070675_100013996 | Ga0070675_1000139964 | 555 |
| 139 | 3300005354 | Ga0070675_100042784 | Ga0070675_1000427842 | 555 |
| 140 | 3300005364 | Ga0070673_100010236 | Ga0070673_1000102363 | 555 |
| 141 | 3300005364 | Ga0070673_100017650 | Ga0070673_1000176503 | 555 |
| 142 | 3300005365 | Ga0070688_100023920 | Ga0070688_1000239201 | 555 |
| 143 | 3300005366 | Ga0070659_100039972 | Ga0070659_1000399722 | 555 |
| 144 | 3300005438 | Ga0070701_10038407 | Ga0070701_100384071 | 555 |
| 145 | 3300005457 | Ga0070662_100017902 | Ga0070662_1000179022 | 555 |
| 146 | 3300005459 | Ga0068867_100027083 | Ga0068867_1000270834 | 555 |
| 147 | 3300005535 | Ga0070684_100001962 | Ga0070684_1000019628 | 555 |
| 148 | 3300005535 | Ga0070684_100003757 | Ga0070684_1000037573 | 555 |
| 149 | 3300005539 | Ga0068853_100002136 | Ga0068853_1000021367 | 555 |
| 150 | 3300005543 | Ga0070672_100111329 | Ga0070672_1001113292 | 555 |
| 151 | 3300005544 | Ga0070686_100011384 | Ga0070686_1000113843 | 555 |
| 152 | 3300005564 | Ga0070664_100001137 | Ga0070664_10000113712 | 555 |
| 153 | 3300005564 | Ga0070664_100012818 | Ga0070664_1000128187 | 555 |
| 154 | 3300005564 | Ga0070664_100025500 | Ga0070664_1000255002 | 555 |
| 155 | 3300005577 | Ga0068857_100001716 | Ga0068857_10000171617 | 555 |
| 156 | 3300005578 | Ga0068854_100012732 | Ga0068854_1000127325 | 555 |
| 157 | 3300005616 | Ga0068852_100009539 | Ga0068852_1000095393 | 555 |
| 158 | 3300005718 | Ga0068866_10008075 | Ga0068866_100080754 | 555 |
| 159 | 3300006195 | Ga0075366_10003483 | Ga0075366_100034832 | 555 |
| 160 | 3300006237 | Ga0097621_100011987 | Ga0097621_1000119872 | 555 |
| 161 | 3300009094 | Ga0111539_10001397 | Ga0111539_1000139721 | 555 |
| 162 | 3300009176 | Ga0105242_10051079 | Ga0105242_100510792 | 555 |
| 163 | 3300009545 | Ga0105237_10019152 | Ga0105237_100191523 | 555 |
| 164 | 3300013100 | Ga0157373_10000199 | Ga0157373_1000019933 | 555 |
| 165 | 3300013102 | Ga0157371_10002520 | Ga0157371_100025203 | 555 |
| 166 | 3300013102 | Ga0157371_10015329 | Ga0157371_100153292 | 555 |
| 167 | 3300013296 | Ga0157374_10027172 | Ga0157374_100271723 | 555 |
| 168 | 3300013297 | Ga0157378_10024574 | Ga0157378_100245743 | 555 |
| 169 | 3300013297 | Ga0157378_10091839 | Ga0157378_100918392 | 555 |
| 170 | 3300013306 | Ga0163162_10007652 | Ga0163162_100076526 | 555 |
| 171 | 3300013306 | Ga0163162_10052497 | Ga0163162_100524973 | 555 |
| 172 | 3300013307 | Ga0157372_10044094 | Ga0157372_100440945 | 555 |
| 173 | 3300013307 | Ga0157372_10072526 | Ga0157372_100725262 | 555 |
| 174 | 3300013307 | Ga0157372_10105605 | Ga0157372_101056052 | 555 |
| 175 | 3300013308 | Ga0157375_10020664 | Ga0157375_100206642 | 555 |
| 176 | 3300013308 | Ga0157375_10055764 | Ga0157375_100557642 | 555 |
| 177 | 3300014325 | Ga0163163_10001556 | Ga0163163_1000155614 | 555 |
| 178 | 3300014325 | Ga0163163_10086740 | Ga0163163_100867404 | 555 |
| 179 | 3300014326 | Ga0157380_10010105 | Ga0157380_100101054 | 555 |
| 180 | 3300014968 | Ga0157379_10068647 | Ga0157379_100686472 | 555 |
| 181 | 3300014969 | Ga0157376_10014112 | Ga0157376_100141124 | 555 |
| 182 | 3300014969 | Ga0157376_10083249 | Ga0157376_100832492 | 555 |
| 183 | 3300017792 | Ga0163161_10024857 | Ga0163161_100248573 | 555 |
| 184 | 3300025302 | Ga0207426_1000104 | Ga0207426_1000104148 | 555 |
| 185 | 3300025899 | Ga0207642_10004146 | Ga0207642_100041461 | 555 |
| 186 | 3300025907 | Ga0207645_10009721 | Ga0207645_100097212 | 555 |
| 187 | 3300025908 | Ga0207643_10003438 | Ga0207643_100034385 | 555 |
| 188 | 3300025909 | Ga0207705_10018038 | Ga0207705_100180384 | 555 |
| 189 | 3300025918 | Ga0207662_10058275 | Ga0207662_100582752 | 555 |
| 190 | 3300025926 | Ga0207659_10006734 | Ga0207659_100067345 | 555 |
| 191 | 3300025931 | Ga0207644_10032667 | Ga0207644_100326673 | 555 |
| 192 | 3300025932 | Ga0207690_10018682 | Ga0207690_100186823 | 555 |
| 193 | 3300025933 | Ga0207706_10027015 | Ga0207706_100270152 | 555 |
| 194 | 3300025933 | Ga0207706_10030989 | Ga0207706_100309893 | 555 |
| 195 | 3300025933 | Ga0207706_10031432 | Ga0207706_100314321 | 555 |
| 196 | 3300025938 | Ga0207704_10009475 | Ga0207704_100094753 | 555 |
| 197 | 3300025940 | Ga0207691_10133171 | Ga0207691_101331712 | 555 |
| 198 | 3300025942 | Ga0207689_10025610 | Ga0207689_100256102 | 555 |
| 199 | 3300025942 | Ga0207689_10061309 | Ga0207689_100613092 | 555 |
| 200 | 3300025944 | Ga0207661_10017740 | Ga0207661_100177403 | 555 |
| 201 | 3300025945 | Ga0207679_10000777 | Ga0207679_1000077710 | 555 |
| 202 | 3300025960 | Ga0207651_10014463 | Ga0207651_100144634 | 555 |
| 203 | 3300025960 | Ga0207651_10020492 | Ga0207651_100204925 | 555 |
| 204 | 3300025981 | Ga0207640_10008037 | Ga0207640_100080372 | 555 |
| 205 | 3300026035 | Ga0207703_10054372 | Ga0207703_100543722 | 555 |
| 206 | 3300026041 | Ga0207639_10026983 | Ga0207639_100269833 | 555 |
| 207 | 3300026075 | Ga0207708_10034135 | Ga0207708_100341355 | 555 |
| 208 | 3300026089 | Ga0207648_10027695 | Ga0207648_100276956 | 555 |
| 209 | 3300026089 | Ga0207648_10083838 | Ga0207648_100838382 | 555 |
| 210 | 3300026116 | Ga0207674_10003303 | Ga0207674_100033039 | 555 |
| 211 | 3300026116 | Ga0207674_10010027 | Ga0207674_100100279 | 555 |
| 212 | 3300026118 | Ga0207675_100008354 | Ga0207675_1000083545 | 555 |
| 213 | 3300026121 | Ga0207683_10011596 | Ga0207683_100115964 | 555 |
| 214 | 3300026142 | Ga0207698_10010210 | Ga0207698_100102107 | 555 |
| 215 | 3300037418 | Ga0395900_0195158 | Ga0395900_0195158_290_2005 | 555 |
| 216 | 3300044712 | Ga0453684_0040202 | Ga0453684_0040202_2352_4070 | 555 |
| 217 | 3300050493 | nmdc:mga0k408_17861_c1 | nmdc:mga0k408_17861_c1_1270_3003 | 555 |
| 218 | 3300053090 | Ga0500646_0006570 | Ga0500646_0006570_800_2515 | 555 |
| 219 | 3300053108 | Ga0500562_000073 | Ga0500562_000073_18290_19993 | 555 |
| 220 | 3300053139 | Ga0500568_0001078 | Ga0500568_0001078_15589_17298 | 555 |
| 221 | 3300055283 | Ga0500661_001277 | Ga0500661_001277_1415_3118 | 555 |
| 222 | 3300013307 | Ga0157372_10167475 | Ga0157372_101674752 | 557 |
| 223 | 3300005347 | Ga0070668_100038487 | Ga0070668_1000384871 | 558 |
| 224 | 3300005719 | Ga0068861_100023894 | Ga0068861_1000238942 | 558 |
| 225 | 3300005844 | Ga0068862_100076357 | Ga0068862_1000763572 | 558 |
| 226 | 3300026118 | Ga0207675_100016834 | Ga0207675_1000168342 | 558 |
| 227 | 3300005330 | Ga0070690_100066009 | Ga0070690_1000660092 | 559 |
| 228 | 3300002459 | JGI24751J29686_10001060 | JGI24751J29686_100010603 | 561 |
| 229 | 3300005331 | Ga0070670_100013127 | Ga0070670_1000131273 | 561 |
| 230 | 3300009553 | Ga0105249_10000762 | Ga0105249_1000076220 | 561 |
| 231 | 3300013296 | Ga0157374_10213219 | Ga0157374_102132191 | 561 |
| 232 | 3300013306 | Ga0163162_10006844 | Ga0163162_100068448 | 561 |
| 233 | 3300013308 | Ga0157375_10075406 | Ga0157375_100754062 | 561 |
| 234 | 3300026095 | Ga0207676_10040991 | Ga0207676_100409913 | 561 |
| 235 | 3300026095 | Ga0207676_10137138 | Ga0207676_101371381 | 561 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zxr-assembly1.cif.gz_A | crystal structure of recj in complex with mg2+ from thermus thermophilus hb8 | 0.898 | 10 | 559 |
| 2zxp-assembly1.cif.gz_A | crystal structure of recj in complex with mn2+ from thermus thermophilus hb8 | 0.8869 | 10 | 559 |
| 5f54-assembly1.cif.gz_A | structure of recj complexed with dtmp | 0.8395 | 8 | 556 |
| 6lrd-assembly1.cif.gz_A | structure of recj complexed with a 5'-p-dspacer-modified ssdna | 0.837 | 9 | 559 |
| 5f56-assembly1.cif.gz_A | structure of recj complexed with dna and ssb-ct | 0.821 | 6 | 559 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P21893_50_326_3.90.1640.30 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); | 0.9137 | 62 | 311 | 3.90.1640.30 |
| af_P21893_327_456_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.9092 | 316 | 435 | 3.10.310.30 |
| af_Q2FXT9_57_316_3.90.1640.30 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); | 0.9087 | 60 | 309 | 3.90.1640.30 |
| af_Q2FXT9_317_441_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.9004 | 315 | 435 | 3.10.310.30 |
| 5f56A02 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); | 0.8919 | 66 | 310 | 3.90.1640.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RHM7-F1-model_v4 | Single-stranded-DNA-specific exonuclease RecJ | 0.9698 | 285 | 557 |
GO:0003676
GO:0004527 |
| AF-A0A5C9CDG9-F1-model_v4 | Single-stranded-DNA-specific exonuclease RecJ | 0.9642 | 7 | 557 |
GO:0003676
GO:0006281 GO:0006310 GO:0008409 |
| AF-A0A4Q3RHM7-F1-model_v4 | Single-stranded-DNA-specific exonuclease RecJ | 0.9629 | 285 | 557 |
GO:0003676
GO:0004527 |
| AF-A0A7C1GAB8-F1-model_v4 | Single-stranded-DNA-specific exonuclease RecJ | 0.9595 | 7 | 557 |
GO:0003676
GO:0006281 GO:0006310 GO:0008409 |
| AF-A0A2G4I0H2-F1-model_v4 | Single-stranded-DNA-specific exonuclease RecJ | 0.9568 | 7 | 559 |
GO:0003676
GO:0006281 GO:0006310 GO:0008409 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar