F348383

General Info

Members Datasets Scaffolds Average Seq Length
235 138 233 566

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0040202|Ga0453684_0040202_2352_4070
Length 572
Sequence MEKRWNLLRPDEQDVARLQQELGISPILCRILVERGVRTFQDAHQFFRPSLESLHDPFLMKDMTLAVDRIMKAMVQRERILVYGDYDVDGTTAVGCMYRFLCKIYEKDLIDFYIPHRYREGYGVSRQGVDHAINQGYKLVIALDCGIKSQELISYAKEQGVDFIVCDHHLPDELLPPAVAILNPKQKDCPYPYKELCGCGVGLKLITAIVRQSDLPDELWMECLELTATAIAADIVPMTGENRVIAYYGLKRTNENPSVALKALMNVSGMKGKVLIQHLVFMIAPRVNAAGRMDDARKVVNLFIENDFDKAAEYAKELHSDNADRKEADLSITKEALSLIREYETIXKRKSTVVYQPHWHKGVVGIVASRLIEHYYRPTIVLTRSGDVVAGSARSIPGFNIHDGLEQCKDLLLGFGGHYFAAGMTMLPENVEAFSARFNEVVEGLLLEHYFTPEIRIDAEVHLADCNRKFYDIVHQMEPFGPENPQPVLVARGLRDTGHSKVVKDLHLRLVVKQDNSAVMSGIGFNLADKYQIIASGRPFDVVFTLDENEWQGNISLQMKVIDMKAAEKIER

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 0
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001060 3300002459 Bacteria 5973
2 JGI25160J50197_1001628 3300003354 Bacteria 11022
3 Ga0065712_10017779 3300005290 Bacteria 2094
4 Ga0065712_10069417 3300005290 Bacteria 7342
5 Ga0065712_10072996 3300005290 Bacteria 4538
6 Ga0070676_10005866 3300005328 Bacteria 6556
7 Ga0070676_10005951 3300005328 Bacteria 6509
8 Ga0070683_100014181 3300005329 Bacteria 6962
9 Ga0070683_100051389 3300005329 Bacteria 3816
10 Ga0070690_100066009 3300005330 Bacteria 2341
11 Ga0070670_100013127 3300005331 Bacteria 7096
12 Ga0070670_100018853 3300005331 Bacteria 5917
13 Ga0068869_100006968 3300005334 Bacteria 7194
14 Ga0068869_100034971 3300005334 Bacteria 3558
15 Ga0068869_100074134 3300005334 Unclassified 2525
16 Ga0068868_100096959 3300005338 Bacteria 2382
17 Ga0070689_100007198 3300005340 Bacteria 7758
18 Ga0070689_100012023 3300005340 Bacteria 6222
19 Ga0070661_100001685 3300005344 Bacteria 15290
20 Ga0070668_100038487 3300005347 Bacteria 3655
21 Ga0070668_100052239 3300005347 Bacteria 3150
22 Ga0070669_100002558 3300005353 Bacteria 13155
23 Ga0070669_100008912 3300005353 Bacteria 7156
24 Ga0070669_100035764 3300005353 Bacteria 3599
25 Ga0070675_100007641 3300005354 Bacteria 8365
26 Ga0070675_100013996 3300005354 Bacteria 6316
27 Ga0070675_100016926 3300005354 Bacteria 5790
28 Ga0070675_100040169 3300005354 Bacteria 3818
29 Ga0070675_100042784 3300005354 Bacteria 3702
30 Ga0070671_100025467 3300005355 Bacteria 4854
31 Ga0070673_100010236 3300005364 Bacteria 6338
32 Ga0070673_100017650 3300005364 Bacteria 5080
33 Ga0070673_100110882 3300005364 Bacteria 2275
34 Ga0070688_100023920 3300005365 Bacteria 3598
35 Ga0070688_100071259 3300005365 Bacteria 2224
36 Ga0070659_100039972 3300005366 Bacteria 3664
37 Ga0070701_10030371 3300005438 Bacteria 2673
38 Ga0070701_10038407 3300005438 Bacteria 2423
39 Ga0070662_100017902 3300005457 Bacteria 4782
40 Ga0068867_100027083 3300005459 Bacteria 4118
41 Ga0070685_10002538 3300005466 Bacteria 9358
42 Ga0070685_10003424 3300005466 Bacteria 8067
43 Ga0070698_100002515 3300005471 Bacteria 20194
44 Ga0070698_100007127 3300005471 Bacteria 12109
45 Ga0070684_100001962 3300005535 Bacteria 15111
46 Ga0070684_100003757 3300005535 Bacteria 11456
47 Ga0068853_100002136 3300005539 Bacteria 14716
48 Ga0068853_100027325 3300005539 Bacteria 4794
49 Ga0070672_100111329 3300005543 Bacteria 2232
50 Ga0070686_100011384 3300005544 Bacteria 5045
51 Ga0070686_100023978 3300005544 Bacteria 3653
52 Ga0070665_100213560 3300005548 Bacteria 1930
53 Ga0070664_100001137 3300005564 Bacteria 21035
54 Ga0070664_100003013 3300005564 Bacteria 13617
55 Ga0070664_100012818 3300005564 Bacteria 6819
56 Ga0070664_100025500 3300005564 Bacteria 4901
57 Ga0068857_100001716 3300005577 Bacteria 17629
58 Ga0068857_100097609 3300005577 Bacteria 2634
59 Ga0068854_100012732 3300005578 Bacteria 5509
60 Ga0070702_100001348 3300005615 Bacteria 9999
61 Ga0068852_100009539 3300005616 Bacteria 7214
62 Ga0068852_100016873 3300005616 Bacteria 5711
63 Ga0068852_100142394 3300005616 Unclassified 2220
64 Ga0068859_100016441 3300005617 Bacteria 7431
65 Ga0068859_100056549 3300005617 Bacteria 3949
66 Ga0068859_100065027 3300005617 Bacteria 3681
67 Ga0068866_10008075 3300005718 Bacteria 4423
68 Ga0068861_100023894 3300005719 Bacteria 4413
69 Ga0068861_100045619 3300005719 Bacteria 3302
70 Ga0068861_100083308 3300005719 Bacteria 2508
71 Ga0068870_10008993 3300005840 Bacteria 4519
72 Ga0068870_10011260 3300005840 Bacteria 4140
73 Ga0068863_100119539 3300005841 Bacteria 2512
74 Ga0068858_100055288 3300005842 Bacteria 3669
75 Ga0068858_100101744 3300005842 Bacteria 2680
76 Ga0068860_100000777 3300005843 Bacteria 35916
77 Ga0068860_100042991 3300005843 Bacteria 4312
78 Ga0068862_100076357 3300005844 Bacteria 2899
79 Ga0068862_100077428 3300005844 Bacteria 2880
80 Ga0075366_10003483 3300006195 Bacteria 8315
81 Ga0097621_100011987 3300006237 Bacteria 6415
82 Ga0068871_100007281 3300006358 Bacteria 7893
83 Ga0068871_100094455 3300006358 Bacteria 2496
84 Ga0075428_100050487 3300006844 Bacteria 4561
85 Ga0075428_100080994 3300006844 Bacteria 3544
86 Ga0075430_100019746 3300006846 Bacteria 5733
87 Ga0075429_100000947 3300006880 Bacteria 22975
88 Ga0097620_100016441 3300006931 Bacteria 7431
89 Ga0097620_100056556 3300006931 Bacteria 3949
90 Ga0097620_100065023 3300006931 Bacteria 3681
91 Ga0111539_10001397 3300009094 Bacteria 32129
92 Ga0111539_10182454 3300009094 Bacteria 2451
93 Ga0105247_10004404 3300009101 Bacteria 8986
94 Ga0105242_10002114 3300009176 Bacteria 15663
95 Ga0105242_10033557 3300009176 Bacteria 4110
96 Ga0105242_10051079 3300009176 Bacteria 3368
97 Ga0105237_10019152 3300009545 Bacteria 7072
98 Ga0105237_10072328 3300009545 Bacteria 3442
99 Ga0105249_10000762 3300009553 Bacteria 28926
100 Ga0105249_10002189 3300009553 Bacteria 16912
101 Ga0105249_10005156 3300009553 Bacteria 11273
102 Ga0105249_10070155 3300009553 Bacteria 3234
103 Ga0105249_10142151 3300009553 Bacteria 2302
104 Ga0105239_10015804 3300010375 Bacteria 8352
105 Ga0157373_10000199 3300013100 Bacteria 49515
106 Ga0157371_10002520 3300013102 Bacteria 17411
107 Ga0157371_10015329 3300013102 Bacteria 5753
108 Ga0157369_10008293 3300013105 Bacteria 11910
109 Ga0157369_10033874 3300013105 Bacteria 5609
110 Ga0157374_10027172 3300013296 Bacteria 5158
111 Ga0157374_10028975 3300013296 Bacteria 5006
112 Ga0157374_10213219 3300013296 Bacteria 1894
113 Ga0157378_10000709 3300013297 Bacteria 31237
114 Ga0157378_10024574 3300013297 Bacteria 5304
115 Ga0157378_10091839 3300013297 Bacteria 2761
116 Ga0163162_10006844 3300013306 Bacteria 11062
117 Ga0163162_10007652 3300013306 Bacteria 10523
118 Ga0163162_10052497 3300013306 Bacteria 4095
119 Ga0163162_10105300 3300013306 Bacteria 2915
120 Ga0157372_10027589 3300013307 Bacteria 6187
121 Ga0157372_10044094 3300013307 Bacteria 4941
122 Ga0157372_10061844 3300013307 Bacteria 4193
123 Ga0157372_10067961 3300013307 Bacteria 4006
124 Ga0157372_10072526 3300013307 Bacteria 3880
125 Ga0157372_10105605 3300013307 Bacteria 3221
126 Ga0157372_10167475 3300013307 Bacteria 2541
127 Ga0157375_10020664 3300013308 Bacteria 6019
128 Ga0157375_10055764 3300013308 Bacteria 3898
129 Ga0157375_10075406 3300013308 Bacteria 3397
130 Ga0163163_10001556 3300014325 Bacteria 19351
131 Ga0163163_10086740 3300014325 Bacteria 3139
132 Ga0157380_10010105 3300014326 Bacteria 6778
133 Ga0157377_10005648 3300014745 Bacteria 5895
134 Ga0157377_10008569 3300014745 Bacteria 4991
135 Ga0157379_10068647 3300014968 Bacteria 3169
136 Ga0157376_10014112 3300014969 Bacteria 5984
137 Ga0157376_10083249 3300014969 Bacteria 2752
138 Ga0163161_10024857 3300017792 Bacteria 4235
139 Ga0213876_10012025 3300021384 Unclassified 4609
140 Ga0207426_1000104 3300025302 Bacteria 249464
141 Ga0207642_10004146 3300025899 Bacteria 4653
142 Ga0207647_10000491 3300025904 Bacteria 31654
143 Ga0207645_10009721 3300025907 Bacteria 6644
144 Ga0207643_10003438 3300025908 Bacteria 8518
145 Ga0207705_10018038 3300025909 Bacteria 5046
146 Ga0207662_10058275 3300025918 Bacteria 2311
147 Ga0207649_10062692 3300025920 Bacteria 2344
148 Ga0207681_10016644 3300025923 Unclassified 4604
149 Ga0207650_10092823 3300025925 Bacteria 2310
150 Ga0207659_10006734 3300025926 Bacteria 7060
151 Ga0207644_10011349 3300025931 Bacteria 5894
152 Ga0207644_10032667 3300025931 Bacteria 3633
153 Ga0207690_10018682 3300025932 Bacteria 4254
154 Ga0207706_10027015 3300025933 Bacteria 5134
155 Ga0207706_10030989 3300025933 Bacteria 4766
156 Ga0207706_10031432 3300025933 Bacteria 4730
157 Ga0207686_10001023 3300025934 Bacteria 16552
158 Ga0207670_10002872 3300025936 Bacteria 9089
159 Ga0207704_10009475 3300025938 Bacteria 4700
160 Ga0207691_10008415 3300025940 Bacteria 9913
161 Ga0207691_10014903 3300025940 Bacteria 7408
162 Ga0207691_10083925 3300025940 Bacteria 2860
163 Ga0207691_10133171 3300025940 Bacteria 2194
164 Ga0207689_10017893 3300025942 Bacteria 5985
165 Ga0207689_10025610 3300025942 Bacteria 4943
166 Ga0207689_10061309 3300025942 Bacteria 3093
167 Ga0207661_10017740 3300025944 Bacteria 5274
168 Ga0207679_10000777 3300025945 Bacteria 20886
169 Ga0207651_10014463 3300025960 Bacteria 4559
170 Ga0207651_10020492 3300025960 Bacteria 3992
171 Ga0207651_10056154 3300025960 Bacteria 2708
172 Ga0207651_10112573 3300025960 Bacteria 2046
173 Ga0207712_10000883 3300025961 Bacteria 21786
174 Ga0207712_10005652 3300025961 Bacteria 7888
175 Ga0207640_10008037 3300025981 Bacteria 5831
176 Ga0207658_10019680 3300025986 Bacteria 4669
177 Ga0207703_10054372 3300026035 Bacteria 3256
178 Ga0207639_10026983 3300026041 Bacteria 4178
179 Ga0207678_10116136 3300026067 Bacteria 2283
180 Ga0207708_10034135 3300026075 Bacteria 3868
181 Ga0207708_10047493 3300026075 Unclassified 3268
182 Ga0207641_10001211 3300026088 Bacteria 25807
183 Ga0207648_10003652 3300026089 Bacteria 16108
184 Ga0207648_10027695 3300026089 Bacteria 5029
185 Ga0207648_10083838 3300026089 Unclassified 2780
186 Ga0207676_10024768 3300026095 Bacteria 4444
187 Ga0207676_10040991 3300026095 Bacteria 3552
188 Ga0207676_10137138 3300026095 Bacteria 2089
189 Ga0207674_10003303 3300026116 Bacteria 19833
190 Ga0207674_10010027 3300026116 Bacteria 10780
191 Ga0207674_10116937 3300026116 Bacteria 2637
192 Ga0207675_100008354 3300026118 Bacteria 9755
193 Ga0207675_100016834 3300026118 Bacteria 6830
194 Ga0207683_10006924 3300026121 Bacteria 9708
195 Ga0207683_10011596 3300026121 Bacteria 7526
196 Ga0207698_10004661 3300026142 Bacteria 8377
197 Ga0207698_10010210 3300026142 Bacteria 6019
198 Ga0268264_10001090 3300028381 Bacteria 26846
199 Ga0265327_10000974 3300031251 Bacteria 40908
200 Ga0395900_0195158 3300037418 Bacteria 2051
201 Ga0436365_0212609 3300039437 Bacteria 25185
202 Ga0450894_003256 3300042131 Bacteria 2130
203 Ga0453684_0023157 3300044712 Bacteria 9166
204 Ga0453684_0040202 3300044712 Bacteria 6358
205 Ga0495630_0004081 3300046517 Bacteria 10226
206 Ga0495668_0000212 3300046616 Bacteria 84542
207 Ga0495672_0047528 3300047320 Bacteria 2551
208 Ga0495686_0010470 3300047472 Bacteria 6593
209 Ga0501034_0007696 3300049571 Bacteria 11462
210 Ga0501036_0008875 3300049572 Bacteria 8256
211 Ga0501037_0013848 3300049573 Bacteria 5943
212 Ga0501038_0014503 3300049574 Bacteria 7182
213 Ga0501039_0006695 3300049575 Bacteria 8762
214 Ga0501039_0029121 3300049575 Bacteria 4253
215 Ga0501043_0003681 3300049579 Bacteria 12590
216 Ga0501046_0003394 3300049580 Bacteria 14611
217 Ga0501067_0006884 3300049583 Bacteria 6308
218 Ga0501070_0009462 3300049586 Bacteria 8237
219 Ga0501074_0002265 3300049590 Bacteria 13385
220 Ga0501080_0016638 3300049742 Bacteria 6792
221 Ga0501083_0010295 3300049744 Bacteria 6589
222 Ga0501035_0093657 3300049822 Bacteria 2643
223 Ga0501044_0016285 3300049823 Bacteria 7988
224 Ga0501044_0020439 3300049823 Bacteria 7070
225 Ga0501044_0028605 3300049823 Bacteria 5883
226 Ga0501044_0034366 3300049823 Bacteria 5317
227 nmdc:mga0k408_17861_c1 3300050493 Bacteria 3954
228 nmdc:mga09592_30892_c1 3300050508 Bacteria 4460
229 Ga0500644_0010482 3300053088 Bacteria 2511
230 Ga0500646_0006570 3300053090 Bacteria 2958
231 Ga0500562_000073 3300053108 Bacteria 47462
232 Ga0500568_0001078 3300053139 Bacteria 18433
233 Ga0500661_001277 3300055283 Bacteria 4701

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0004081 Ga0495630_0004081_678_2096 460
2 3300053088 Ga0500644_0010482 Ga0500644_0010482_10_1503 485
3 3300049823 Ga0501044_0034366 Ga0501044_0034366_53_1573 494
4 3300013307 Ga0157372_10067961 Ga0157372_100679613 517
5 3300005577 Ga0068857_100097609 Ga0068857_1000976091 541
6 3300005841 Ga0068863_100119539 Ga0068863_1001195391 541
7 3300025940 Ga0207691_10083925 Ga0207691_100839252 541
8 3300026095 Ga0207676_10024768 Ga0207676_100247683 541
9 3300026116 Ga0207674_10116937 Ga0207674_101169372 541
10 3300021384 Ga0213876_10012025 Ga0213876_100120252 544
11 3300039437 Ga0436365_0212609 Ga0436365_0212609_20552_22222 544
12 3300005328 Ga0070676_10005866 Ga0070676_100058662 545
13 3300005354 Ga0070675_100016926 Ga0070675_1000169265 545
14 3300005355 Ga0070671_100025467 Ga0070671_1000254672 545
15 3300005544 Ga0070686_100023978 Ga0070686_1000239783 545
16 3300005564 Ga0070664_100003013 Ga0070664_1000030137 545
17 3300005615 Ga0070702_100001348 Ga0070702_1000013486 545
18 3300005616 Ga0068852_100142394 Ga0068852_1001423942 545
19 3300005842 Ga0068858_100101744 Ga0068858_1001017442 545
20 3300025920 Ga0207649_10062692 Ga0207649_100626922 545
21 3300025931 Ga0207644_10011349 Ga0207644_100113493 545
22 3300025940 Ga0207691_10014903 Ga0207691_100149031 545
23 3300005548 Ga0070665_100213560 Ga0070665_1002135602 548
24 3300026067 Ga0207678_10116136 Ga0207678_101161361 548
25 3300046616 Ga0495668_0000212 Ga0495668_0000212_74621_76318 548
26 iso_pu_bacteria 2818991444 2819588088 551
27 3300013297 Ga0157378_10000709 Ga0157378_100007096 552
28 3300014745 Ga0157377_10008569 Ga0157377_100085693 552
29 iso_pu_bacteria 2929154850 2929157917 552
30 3300005290 Ga0065712_10069417 Ga0065712_100694172 553
31 3300005466 Ga0070685_10002538 Ga0070685_100025387 553
32 3300005617 Ga0068859_100056549 Ga0068859_1000565493 553
33 3300005719 Ga0068861_100045619 Ga0068861_1000456192 553
34 3300005843 Ga0068860_100000777 Ga0068860_10000077720 553
35 3300006358 Ga0068871_100094455 Ga0068871_1000944551 553
36 3300006844 Ga0075428_100080994 Ga0075428_1000809943 553
37 3300006931 Ga0097620_100056556 Ga0097620_1000565562 553
38 3300009176 Ga0105242_10002114 Ga0105242_100021142 553
39 3300009545 Ga0105237_10072328 Ga0105237_100723282 553
40 3300009553 Ga0105249_10002189 Ga0105249_100021898 553
41 3300009553 Ga0105249_10070155 Ga0105249_100701552 553
42 3300010375 Ga0105239_10015804 Ga0105239_100158047 553
43 3300013105 Ga0157369_10008293 Ga0157369_100082935 553
44 3300013296 Ga0157374_10028975 Ga0157374_100289752 553
45 3300013306 Ga0163162_10105300 Ga0163162_101053002 553
46 3300013307 Ga0157372_10027589 Ga0157372_100275892 553
47 3300013307 Ga0157372_10061844 Ga0157372_100618442 553
48 3300025934 Ga0207686_10001023 Ga0207686_1000102313 553
49 3300025961 Ga0207712_10005652 Ga0207712_100056523 553
50 3300026088 Ga0207641_10001211 Ga0207641_100012113 553
51 3300028381 Ga0268264_10001090 Ga0268264_1000109013 553
52 3300044712 Ga0453684_0023157 Ga0453684_0023157_7112_8809 553
53 3300049572 Ga0501036_0008875 Ga0501036_0008875_190_1887 553
54 3300049573 Ga0501037_0013848 Ga0501037_0013848_1825_3522 553
55 3300049575 Ga0501039_0006695 Ga0501039_0006695_4648_6345 553
56 3300049579 Ga0501043_0003681 Ga0501043_0003681_2166_3863 553
57 3300049822 Ga0501035_0093657 Ga0501035_0093657_714_2411 553
58 3300049823 Ga0501044_0020439 Ga0501044_0020439_3599_5296 553
59 3300049823 Ga0501044_0028605 Ga0501044_0028605_1829_3526 553
60 3300005290 Ga0065712_10017779 Ga0065712_100177791 554
61 3300005331 Ga0070670_100018853 Ga0070670_1000188532 554
62 3300005334 Ga0068869_100006968 Ga0068869_1000069683 554
63 3300005334 Ga0068869_100074134 Ga0068869_1000741342 554
64 3300005338 Ga0068868_100096959 Ga0068868_1000969592 554
65 3300005340 Ga0070689_100007198 Ga0070689_1000071982 554
66 3300005347 Ga0070668_100052239 Ga0070668_1000522392 554
67 3300005353 Ga0070669_100008912 Ga0070669_1000089126 554
68 3300005353 Ga0070669_100035764 Ga0070669_1000357642 554
69 3300005354 Ga0070675_100040169 Ga0070675_1000401692 554
70 3300005364 Ga0070673_100110882 Ga0070673_1001108822 554
71 3300005365 Ga0070688_100071259 Ga0070688_1000712592 554
72 3300005438 Ga0070701_10030371 Ga0070701_100303712 554
73 3300005466 Ga0070685_10003424 Ga0070685_100034243 554
74 3300005471 Ga0070698_100002515 Ga0070698_1000025158 554
75 3300005471 Ga0070698_100007127 Ga0070698_1000071273 554
76 3300005539 Ga0068853_100027325 Ga0068853_1000273252 554
77 3300005616 Ga0068852_100016873 Ga0068852_1000168733 554
78 3300005617 Ga0068859_100016441 Ga0068859_1000164412 554
79 3300005617 Ga0068859_100065027 Ga0068859_1000650272 554
80 3300005719 Ga0068861_100083308 Ga0068861_1000833082 554
81 3300005840 Ga0068870_10008993 Ga0068870_100089933 554
82 3300005840 Ga0068870_10011260 Ga0068870_100112602 554
83 3300005842 Ga0068858_100055288 Ga0068858_1000552882 554
84 3300005843 Ga0068860_100042991 Ga0068860_1000429913 554
85 3300005844 Ga0068862_100077428 Ga0068862_1000774282 554
86 3300006358 Ga0068871_100007281 Ga0068871_1000072812 554
87 3300006844 Ga0075428_100050487 Ga0075428_1000504872 554
88 3300006846 Ga0075430_100019746 Ga0075430_1000197463 554
89 3300006880 Ga0075429_100000947 Ga0075429_10000094712 554
90 3300006931 Ga0097620_100016441 Ga0097620_1000164412 554
91 3300006931 Ga0097620_100065023 Ga0097620_1000650232 554
92 3300009094 Ga0111539_10182454 Ga0111539_101824542 554
93 3300009101 Ga0105247_10004404 Ga0105247_100044047 554
94 3300009176 Ga0105242_10033557 Ga0105242_100335572 554
95 3300009553 Ga0105249_10005156 Ga0105249_1000515612 554
96 3300009553 Ga0105249_10142151 Ga0105249_101421512 554
97 3300013105 Ga0157369_10033874 Ga0157369_100338745 554
98 3300014745 Ga0157377_10005648 Ga0157377_100056482 554
99 3300025904 Ga0207647_10000491 Ga0207647_1000049115 554
100 3300025923 Ga0207681_10016644 Ga0207681_100166441 554
101 3300025925 Ga0207650_10092823 Ga0207650_100928232 554
102 3300025936 Ga0207670_10002872 Ga0207670_100028722 554
103 3300025940 Ga0207691_10008415 Ga0207691_100084156 554
104 3300025942 Ga0207689_10017893 Ga0207689_100178934 554
105 3300025960 Ga0207651_10056154 Ga0207651_100561542 554
106 3300025960 Ga0207651_10112573 Ga0207651_101125732 554
107 3300025961 Ga0207712_10000883 Ga0207712_100008834 554
108 3300025986 Ga0207658_10019680 Ga0207658_100196802 554
109 3300026075 Ga0207708_10047493 Ga0207708_100474932 554
110 3300026089 Ga0207648_10003652 Ga0207648_100036523 554
111 3300026121 Ga0207683_10006924 Ga0207683_1000692410 554
112 3300026142 Ga0207698_10004661 Ga0207698_100046617 554
113 3300031251 Ga0265327_10000974 Ga0265327_100009749 554
114 3300042131 Ga0450894_003256 Ga0450894_003256_248_1948 554
115 3300047320 Ga0495672_0047528 Ga0495672_0047528_574_2274 554
116 3300047472 Ga0495686_0010470 Ga0495686_0010470_1189_2892 554
117 3300049571 Ga0501034_0007696 Ga0501034_0007696_5902_7602 554
118 3300049574 Ga0501038_0014503 Ga0501038_0014503_2006_3706 554
119 3300049575 Ga0501039_0029121 Ga0501039_0029121_793_2493 554
120 3300049580 Ga0501046_0003394 Ga0501046_0003394_11034_12734 554
121 3300049583 Ga0501067_0006884 Ga0501067_0006884_3590_5290 554
122 3300049586 Ga0501070_0009462 Ga0501070_0009462_3938_5638 554
123 3300049590 Ga0501074_0002265 Ga0501074_0002265_9565_11265 554
124 3300049742 Ga0501080_0016638 Ga0501080_0016638_665_2365 554
125 3300049744 Ga0501083_0010295 Ga0501083_0010295_4854_6554 554
126 3300049823 Ga0501044_0016285 Ga0501044_0016285_5644_7344 554
127 3300050508 nmdc:mga09592_30892_c1 nmdc:mga09592_30892_c1_24_1724 554
128 3300003354 JGI25160J50197_1001628 JGI25160J50197_10016282 555
129 3300005290 Ga0065712_10072996 Ga0065712_100729966 555
130 3300005328 Ga0070676_10005951 Ga0070676_100059513 555
131 3300005329 Ga0070683_100014181 Ga0070683_1000141812 555
132 3300005329 Ga0070683_100051389 Ga0070683_1000513894 555
133 3300005334 Ga0068869_100034971 Ga0068869_1000349712 555
134 3300005340 Ga0070689_100012023 Ga0070689_1000120236 555
135 3300005344 Ga0070661_100001685 Ga0070661_10000168513 555
136 3300005353 Ga0070669_100002558 Ga0070669_10000255812 555
137 3300005354 Ga0070675_100007641 Ga0070675_1000076412 555
138 3300005354 Ga0070675_100013996 Ga0070675_1000139964 555
139 3300005354 Ga0070675_100042784 Ga0070675_1000427842 555
140 3300005364 Ga0070673_100010236 Ga0070673_1000102363 555
141 3300005364 Ga0070673_100017650 Ga0070673_1000176503 555
142 3300005365 Ga0070688_100023920 Ga0070688_1000239201 555
143 3300005366 Ga0070659_100039972 Ga0070659_1000399722 555
144 3300005438 Ga0070701_10038407 Ga0070701_100384071 555
145 3300005457 Ga0070662_100017902 Ga0070662_1000179022 555
146 3300005459 Ga0068867_100027083 Ga0068867_1000270834 555
147 3300005535 Ga0070684_100001962 Ga0070684_1000019628 555
148 3300005535 Ga0070684_100003757 Ga0070684_1000037573 555
149 3300005539 Ga0068853_100002136 Ga0068853_1000021367 555
150 3300005543 Ga0070672_100111329 Ga0070672_1001113292 555
151 3300005544 Ga0070686_100011384 Ga0070686_1000113843 555
152 3300005564 Ga0070664_100001137 Ga0070664_10000113712 555
153 3300005564 Ga0070664_100012818 Ga0070664_1000128187 555
154 3300005564 Ga0070664_100025500 Ga0070664_1000255002 555
155 3300005577 Ga0068857_100001716 Ga0068857_10000171617 555
156 3300005578 Ga0068854_100012732 Ga0068854_1000127325 555
157 3300005616 Ga0068852_100009539 Ga0068852_1000095393 555
158 3300005718 Ga0068866_10008075 Ga0068866_100080754 555
159 3300006195 Ga0075366_10003483 Ga0075366_100034832 555
160 3300006237 Ga0097621_100011987 Ga0097621_1000119872 555
161 3300009094 Ga0111539_10001397 Ga0111539_1000139721 555
162 3300009176 Ga0105242_10051079 Ga0105242_100510792 555
163 3300009545 Ga0105237_10019152 Ga0105237_100191523 555
164 3300013100 Ga0157373_10000199 Ga0157373_1000019933 555
165 3300013102 Ga0157371_10002520 Ga0157371_100025203 555
166 3300013102 Ga0157371_10015329 Ga0157371_100153292 555
167 3300013296 Ga0157374_10027172 Ga0157374_100271723 555
168 3300013297 Ga0157378_10024574 Ga0157378_100245743 555
169 3300013297 Ga0157378_10091839 Ga0157378_100918392 555
170 3300013306 Ga0163162_10007652 Ga0163162_100076526 555
171 3300013306 Ga0163162_10052497 Ga0163162_100524973 555
172 3300013307 Ga0157372_10044094 Ga0157372_100440945 555
173 3300013307 Ga0157372_10072526 Ga0157372_100725262 555
174 3300013307 Ga0157372_10105605 Ga0157372_101056052 555
175 3300013308 Ga0157375_10020664 Ga0157375_100206642 555
176 3300013308 Ga0157375_10055764 Ga0157375_100557642 555
177 3300014325 Ga0163163_10001556 Ga0163163_1000155614 555
178 3300014325 Ga0163163_10086740 Ga0163163_100867404 555
179 3300014326 Ga0157380_10010105 Ga0157380_100101054 555
180 3300014968 Ga0157379_10068647 Ga0157379_100686472 555
181 3300014969 Ga0157376_10014112 Ga0157376_100141124 555
182 3300014969 Ga0157376_10083249 Ga0157376_100832492 555
183 3300017792 Ga0163161_10024857 Ga0163161_100248573 555
184 3300025302 Ga0207426_1000104 Ga0207426_1000104148 555
185 3300025899 Ga0207642_10004146 Ga0207642_100041461 555
186 3300025907 Ga0207645_10009721 Ga0207645_100097212 555
187 3300025908 Ga0207643_10003438 Ga0207643_100034385 555
188 3300025909 Ga0207705_10018038 Ga0207705_100180384 555
189 3300025918 Ga0207662_10058275 Ga0207662_100582752 555
190 3300025926 Ga0207659_10006734 Ga0207659_100067345 555
191 3300025931 Ga0207644_10032667 Ga0207644_100326673 555
192 3300025932 Ga0207690_10018682 Ga0207690_100186823 555
193 3300025933 Ga0207706_10027015 Ga0207706_100270152 555
194 3300025933 Ga0207706_10030989 Ga0207706_100309893 555
195 3300025933 Ga0207706_10031432 Ga0207706_100314321 555
196 3300025938 Ga0207704_10009475 Ga0207704_100094753 555
197 3300025940 Ga0207691_10133171 Ga0207691_101331712 555
198 3300025942 Ga0207689_10025610 Ga0207689_100256102 555
199 3300025942 Ga0207689_10061309 Ga0207689_100613092 555
200 3300025944 Ga0207661_10017740 Ga0207661_100177403 555
201 3300025945 Ga0207679_10000777 Ga0207679_1000077710 555
202 3300025960 Ga0207651_10014463 Ga0207651_100144634 555
203 3300025960 Ga0207651_10020492 Ga0207651_100204925 555
204 3300025981 Ga0207640_10008037 Ga0207640_100080372 555
205 3300026035 Ga0207703_10054372 Ga0207703_100543722 555
206 3300026041 Ga0207639_10026983 Ga0207639_100269833 555
207 3300026075 Ga0207708_10034135 Ga0207708_100341355 555
208 3300026089 Ga0207648_10027695 Ga0207648_100276956 555
209 3300026089 Ga0207648_10083838 Ga0207648_100838382 555
210 3300026116 Ga0207674_10003303 Ga0207674_100033039 555
211 3300026116 Ga0207674_10010027 Ga0207674_100100279 555
212 3300026118 Ga0207675_100008354 Ga0207675_1000083545 555
213 3300026121 Ga0207683_10011596 Ga0207683_100115964 555
214 3300026142 Ga0207698_10010210 Ga0207698_100102107 555
215 3300037418 Ga0395900_0195158 Ga0395900_0195158_290_2005 555
216 3300044712 Ga0453684_0040202 Ga0453684_0040202_2352_4070 555
217 3300050493 nmdc:mga0k408_17861_c1 nmdc:mga0k408_17861_c1_1270_3003 555
218 3300053090 Ga0500646_0006570 Ga0500646_0006570_800_2515 555
219 3300053108 Ga0500562_000073 Ga0500562_000073_18290_19993 555
220 3300053139 Ga0500568_0001078 Ga0500568_0001078_15589_17298 555
221 3300055283 Ga0500661_001277 Ga0500661_001277_1415_3118 555
222 3300013307 Ga0157372_10167475 Ga0157372_101674752 557
223 3300005347 Ga0070668_100038487 Ga0070668_1000384871 558
224 3300005719 Ga0068861_100023894 Ga0068861_1000238942 558
225 3300005844 Ga0068862_100076357 Ga0068862_1000763572 558
226 3300026118 Ga0207675_100016834 Ga0207675_1000168342 558
227 3300005330 Ga0070690_100066009 Ga0070690_1000660092 559
228 3300002459 JGI24751J29686_10001060 JGI24751J29686_100010603 561
229 3300005331 Ga0070670_100013127 Ga0070670_1000131273 561
230 3300009553 Ga0105249_10000762 Ga0105249_1000076220 561
231 3300013296 Ga0157374_10213219 Ga0157374_102132191 561
232 3300013306 Ga0163162_10006844 Ga0163162_100068448 561
233 3300013308 Ga0157375_10075406 Ga0157375_100754062 561
234 3300026095 Ga0207676_10040991 Ga0207676_100409913 561
235 3300026095 Ga0207676_10137138 Ga0207676_101371381 561

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17768

RecJ_OB

RecJ OB domain

457

563

0.94

PF01368

DHH

DHH family

79

231

0.93

PF02272

DHHA1

DHHA1 domain

315

442

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zxr-assembly1.cif.gz_A crystal structure of recj in complex with mg2+ from thermus thermophilus hb8 0.898 10 559
2zxp-assembly1.cif.gz_A crystal structure of recj in complex with mn2+ from thermus thermophilus hb8 0.8869 10 559
5f54-assembly1.cif.gz_A structure of recj complexed with dtmp 0.8395 8 556
6lrd-assembly1.cif.gz_A structure of recj complexed with a 5'-p-dspacer-modified ssdna 0.837 9 559
5f56-assembly1.cif.gz_A structure of recj complexed with dna and ssb-ct 0.821 6 559
ID Description Score Start End Superfamily
af_P21893_50_326_3.90.1640.30 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.9137 62 311 3.90.1640.30
af_P21893_327_456_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9092 316 435 3.10.310.30
af_Q2FXT9_57_316_3.90.1640.30 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.9087 60 309 3.90.1640.30
af_Q2FXT9_317_441_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9004 315 435 3.10.310.30
5f56A02 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.8919 66 310 3.90.1640.30
ID Description Score Start End GO Terms
AF-A0A4Q3RHM7-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9698 285 557 GO:0003676
GO:0004527
AF-A0A5C9CDG9-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9642 7 557 GO:0003676
GO:0006281
GO:0006310
GO:0008409
AF-A0A4Q3RHM7-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9629 285 557 GO:0003676
GO:0004527
AF-A0A7C1GAB8-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9595 7 557 GO:0003676
GO:0006281
GO:0006310
GO:0008409
AF-A0A2G4I0H2-F1-model_v4 Single-stranded-DNA-specific exonuclease RecJ 0.9568 7 559 GO:0003676
GO:0006281
GO:0006310
GO:0008409

Feature Viewer

pLDDT pTM Quality
87.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map