F348446

General Info

Members Datasets Scaffolds Average Seq Length
235 176 470 225

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0077387|Ga0495606_0077387_419_1093
Length 224
Sequence MVLKDIPADARPREKMLATGATSLADAELVALLLRTGLKGTSVLQLAQQTLDAFGGVQGLLHAQATDLLRVKGLGPAKRAEIAAVIELARRALSQELAQRPVFDMPAKVKSYLQLQLGSRNFEAFAVMFLDAQNRLLKFEEMFRGTLTQTSVYPREIVKRAIEVGASAVIFAHNHPSGMADPSQADERLTQTLKSALLLVDVRVLDHFVVGASEVVSFAERGLL

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
102 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
153 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
154 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
157 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
158 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
159 2547132374 Acidovorax radicis N35 Isolate Unclassified
160 2643221570 Acidovorax sp. Root568 Isolate Unclassified
161 2643221596 Acidovorax sp. Root70 Isolate Unclassified
162 2643221609 Acidovorax sp. Root217 Isolate Unclassified
163 2643221611 Acidovorax sp. Root219 Isolate Unclassified
164 2643221652 Acidovorax sp. Root402 Isolate Unclassified
165 2643221717 Acidovorax sp. Root267 Isolate Unclassified
166 2738543012 Acidovorax sp. CF301 Isolate Unclassified
167 2816332133 Acidovorax radicis 2721A Isolate Unclassified
168 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
169 2842747753 Variovorax sp. R-72060 Isolate Unclassified
170 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
171 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
172 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
173 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
174 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
175 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
176 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.91
Metatranscriptomes 0
Isolates 8.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.49
Nodule 0.85
Rhizoplane 2.13
Rhizosphere 47.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0077387 3300046507 Bacteria 2077
2 JGI25155J39150_1000702 3300002704 Bacteria 6077
3 JGI25156J39149_1001359 3300002705 Bacteria 10495
4 JGI25154J39366_1001111 3300002738 Bacteria 10495
5 JGI25157J39369_1001246 3300002741 Bacteria 10495
6 JGI25150J39212_1023953 3300002774 Bacteria 902
7 JGI25159J45721_1000358 3300002987 Bacteria 21142
8 JGI25159J45721_1004774 3300002987 Bacteria 4388
9 JGI25151J46595_10035557 3300003187 Bacteria 1891
10 JGI25160J50197_1001039 3300003354 Bacteria 14351
11 JGI25160J50197_1015320 3300003354 Bacteria 2521
12 JGI25161J50226_1000131 3300003374 Bacteria 53277
13 Ga0055526_1001193 3300003771 Bacteria 18783
14 Ga0055526_1006425 3300003771 Bacteria 6375
15 Ga0055537_1000820 3300003773 Bacteria 15253
16 Ga0055524_1000186 3300003775 Bacteria 69106
17 Ga0055524_1000333 3300003775 Bacteria 43683
18 Ga0055534_1000638 3300003784 Bacteria 17874
19 Ga0055528_1000268 3300003790 Bacteria 44260
20 Ga0055530_10000330 3300003791 Bacteria 42856
21 Ga0055540_1000058 3300003792 Bacteria 136015
22 Ga0055531_10003138 3300003794 Bacteria 10650
23 Ga0055543_1001038 3300004625 Bacteria 12346
24 Ga0065165_1016911 3300005262 Bacteria 2710
25 Ga0065714_10069419 3300005288 Bacteria 4237
26 Ga0068869_100800251 3300005334 Bacteria 810
27 Ga0070680_100745314 3300005336 Bacteria 843
28 Ga0070679_100170618 3300005530 Bacteria 2148
29 Ga0070679_100314171 3300005530 Bacteria 1516
30 Ga0068855_100109446 3300005563 Bacteria 3173
31 Ga0068855_100267085 3300005563 Bacteria 1904
32 Ga0075365_10008605 3300006038 Bacteria 5810
33 Ga0075365_10041934 3300006038 Bacteria 2990
34 Ga0075363_100005237 3300006048 Bacteria 5748
35 Ga0075364_10104414 3300006051 Bacteria 1887
36 Ga0075432_10006186 3300006058 Bacteria 4072
37 Ga0075362_10010863 3300006177 Bacteria 3570
38 Ga0075367_10056696 3300006178 Bacteria 2328
39 Ga0075367_10205321 3300006178 Bacteria 1231
40 Ga0075367_10282264 3300006178 Bacteria 1044
41 Ga0075370_10005067 3300006353 Bacteria 6493
42 Ga0068865_100167572 3300006881 Bacteria 1681
43 Ga0079104_1007217 3300006946 Bacteria 4067
44 Ga0105240_10010601 3300009093 Bacteria 12951
45 Ga0105245_10014284 3300009098 Bacteria 6920
46 Ga0105243_10001275 3300009148 Bacteria 22611
47 Ga0105238_10045717 3300009551 Bacteria 4423
48 Ga0157326_1004725 3300012513 Bacteria 1436
49 Ga0157378_10387884 3300013297 Bacteria 1373
50 Ga0182008_10058639 3300014497 Bacteria 1900
51 Ga0182008_10142232 3300014497 Bacteria 1201
52 Ga0157376_10006543 3300014969 Bacteria 8244
53 Ga0163161_10418252 3300017792 Bacteria 1078
54 Ga0209435_100002 3300025206 Bacteria 794178
55 Ga0207425_1014002 3300025245 Bacteria 1833
56 Ga0209646_1000001 3300025246 Bacteria 3092932
57 Ga0209026_1000001 3300025250 Bacteria 1228671
58 Ga0209759_1000001 3300025256 Bacteria 2799452
59 Ga0209565_1000143 3300025263 Bacteria 99302
60 Ga0209673_1000008 3300025273 Bacteria 626013
61 Ga0209130_1000072 3300025284 Bacteria 175726
62 Ga0209130_1000305 3300025284 Bacteria 59541
63 Ga0209675_1000750 3300025291 Bacteria 21886
64 Ga0209675_1001505 3300025291 Bacteria 13365
65 Ga0209676_1000023 3300025292 Bacteria 589732
66 Ga0209676_1033593 3300025292 Bacteria 1526
67 Ga0209025_1016126 3300025294 Bacteria 4442
68 Ga0209025_1043637 3300025294 Bacteria 1886
69 Ga0209025_1066438 3300025294 Bacteria 1310
70 Ga0209564_1000735 3300025295 Bacteria 46500
71 Ga0209564_1002857 3300025295 Bacteria 12689
72 Ga0209050_1000022 3300025298 Bacteria 565239
73 Ga0209050_1012117 3300025298 Bacteria 3996
74 Ga0209050_1023115 3300025298 Bacteria 2200
75 Ga0209256_1000001 3300025299 Bacteria 2166974
76 Ga0207426_1000320 3300025302 Bacteria 92467
77 Ga0207426_1000739 3300025302 Bacteria 37207
78 Ga0209051_1000013 3300025303 Bacteria 565239
79 Ga0209257_1000042 3300025304 Bacteria 537149
80 Ga0207654_10091744 3300025911 Bacteria 1853
81 Ga0207695_10279616 3300025913 Bacteria 1563
82 Ga0207660_10081112 3300025917 Bacteria 2384
83 Ga0207657_10024790 3300025919 Bacteria 5545
84 Ga0207652_10207567 3300025921 Bacteria 1763
85 Ga0207652_10675892 3300025921 Bacteria 922
86 Ga0207694_10120914 3300025924 Bacteria 2091
87 Ga0207704_10268830 3300025938 Bacteria 1290
88 Ga0207689_10057370 3300025942 Bacteria 3204
89 Ga0207667_10207582 3300025949 Bacteria 2008
90 Ga0209281_1018449 3300027111 Bacteria 1394
91 Ga0265334_10058853 3300028573 Bacteria 1453
92 Ga0307515_10001658 3300028794 Bacteria 49584
93 Ga0307515_10003085 3300028794 Bacteria 35271
94 Ga0307515_10004515 3300028794 Bacteria 28764
95 Ga0307515_10164927 3300028794 Bacteria 2238
96 Ga0307515_10177424 3300028794 Bacteria 2095
97 Ga0307512_10061848 3300030522 Bacteria 2879
98 Ga0265330_10000082 3300031235 Bacteria 79732
99 Ga0265332_10000090 3300031238 Bacteria 79736
100 Ga0265325_10006763 3300031241 Bacteria 6933
101 Ga0265340_10017987 3300031247 Bacteria 3653
102 Ga0307513_10000064 3300031456 Bacteria 141845
103 Ga0307513_10000117 3300031456 Bacteria 110951
104 Ga0307513_10085515 3300031456 Bacteria 3236
105 Ga0307513_10146228 3300031456 Bacteria 2281
106 Ga0307513_10379238 3300031456 Bacteria 1154
107 Ga0307509_10071993 3300031507 Bacteria 3603
108 Ga0307408_100000359 3300031548 Bacteria 42425
109 Ga0307408_100016571 3300031548 Bacteria 4921
110 Ga0307408_100078909 3300031548 Bacteria 2455
111 Ga0307508_10000082 3300031616 Bacteria 111720
112 Ga0307514_10058602 3300031649 Bacteria 2945
113 Ga0265314_10000247 3300031711 Bacteria 79736
114 Ga0307516_10002190 3300031730 Bacteria 26468
115 Ga0307516_10042199 3300031730 Bacteria 4527
116 Ga0307406_10000369 3300031901 Bacteria 26025
117 Ga0307412_10008450 3300031911 Bacteria 5877
118 Ga0307412_10904948 3300031911 Bacteria 773
119 Ga0307416_100871235 3300032002 Bacteria 999
120 Ga0307414_10036974 3300032004 Bacteria 3265
121 Ga0307507_10043841 3300033179 Bacteria 4432
122 Ga0373925_0732083 3300037068 Bacteria 815
123 Ga0395899_0118953 3300037312 Bacteria 1894
124 Ga0395900_0010431 3300037418 Bacteria 9502
125 Ga0395900_0051207 3300037418 Bacteria 4254
126 Ga0395900_0207236 3300037418 Bacteria 1981
127 Ga0395898_0011568 3300037466 Bacteria 9162
128 Ga0395898_0220033 3300037466 Bacteria 1811
129 Ga0395905_0000088 3300037471 Bacteria 152506
130 Ga0395905_0000637 3300037471 Bacteria 46877
131 Ga0395905_0015440 3300037471 Bacteria 7260
132 Ga0395905_0034767 3300037471 Bacteria 4732
133 Ga0395905_0055794 3300037471 Bacteria 3697
134 Ga0395905_0061687 3300037471 Bacteria 3507
135 Ga0395905_0255615 3300037471 Bacteria 1636
136 Ga0395905_0604743 3300037471 Bacteria 998
137 Ga0395901_0026533 3300038443 Bacteria 5948
138 Ga0395901_0210103 3300038443 Bacteria 2037
139 Ga0395901_0455831 3300038443 Bacteria 1307
140 Ga0439438_068918 3300041405 Bacteria 877
141 Ga0451793_1314334 3300041452 Bacteria 1886
142 Ga0451835_0766080 3300041492 Bacteria 1382
143 Ga0451839_0330447 3300041496 Bacteria 1315
144 Ga0451843_0925831 3300041509 Bacteria 1435
145 Ga0439441_024802 3300042001 Bacteria 1129
146 Ga0450893_0002076 3300042532 Bacteria 3120
147 Ga0451577_0004913 3300042876 Bacteria 13922
148 Ga0466969_0017162 3300044656 Bacteria 3782
149 Ga0466972_0028798 3300044658 Bacteria 2737
150 Ga0466965_0128383 3300044683 Bacteria 1313
151 Ga0466966_0009967 3300044684 Bacteria 6297
152 Ga0466966_0086465 3300044684 Bacteria 1949
153 Ga0466966_0093652 3300044684 Bacteria 1863
154 Ga0466961_0035507 3300044693 Bacteria 3201
155 Ga0453684_0290591 3300044712 Bacteria 1861
156 Ga0453684_0430752 3300044712 Bacteria 1471
157 Ga0453684_0568895 3300044712 Bacteria 1246
158 Ga0466968_0117167 3300044735 Bacteria 1202
159 Ga0466970_0209593 3300044765 Bacteria 1085
160 Ga0466957_0405757 3300044842 Bacteria 933
161 Ga0466960_0020337 3300044901 Bacteria 2939
162 Ga0466960_0278495 3300044901 Bacteria 937
163 Ga0466959_0174335 3300045049 Bacteria 1507
164 Ga0451576_0001041 3300045051 Bacteria 51115
165 Ga0495610_0004891 3300046512 Bacteria 9738
166 Ga0495620_0043816 3300046515 Bacteria 1948
167 Ga0495632_0027118 3300046519 Bacteria 3004
168 Ga0495643_0128032 3300046522 Bacteria 1277
169 Ga0495663_0028287 3300046525 Bacteria 1649
170 Ga0495642_0011099 3300046528 Bacteria 3455
171 Ga0495654_0096728 3300046530 Bacteria 1364
172 Ga0495633_0114209 3300046558 Bacteria 1252
173 Ga0495625_0001168 3300046660 Bacteria 33801
174 Ga0495669_0119159 3300046684 Bacteria 1236
175 Ga0495671_0096059 3300046692 Bacteria 1450
176 Ga0495677_0095650 3300047445 Bacteria 1122
177 Ga0496106_0055864 3300048909 Bacteria 2985
178 Ga0496110_0529060 3300048913 Bacteria 1072
179 Ga0496111_0305593 3300048914 Bacteria 1179
180 Ga0496113_0645934 3300048916 Bacteria 846
181 Ga0496116_0023522 3300048919 Bacteria 4586
182 Ga0496121_0118090 3300048924 Bacteria 2008
183 Ga0496122_0126791 3300048925 Bacteria 1632
184 Ga0496125_0174212 3300048928 Bacteria 1442
185 Ga0501034_0083232 3300049571 Bacteria 3201
186 Ga0501034_0322354 3300049571 Bacteria 1478
187 Ga0501037_0023055 3300049573 Bacteria 4604
188 Ga0501038_0343913 3300049574 Bacteria 1163
189 Ga0501046_0060582 3300049580 Bacteria 2961
190 Ga0501047_0056928 3300049581 Bacteria 3781
191 Ga0501080_0674265 3300049742 Bacteria 913
192 Ga0501044_0032069 3300049823 Bacteria 5524
193 nmdc:mga03683_167562_c1 3300050489 Bacteria 997
194 nmdc:mga03683_75445_c1 3300050489 Bacteria 1448
195 nmdc:mga03n38_50565_c1 3300050490 Bacteria 1853
196 nmdc:mga00v17_163396_c1 3300050491 Bacteria 1434
197 nmdc:mga0yw44_23607_c1 3300050492 Bacteria 3468
198 nmdc:mga0yw44_56677_c1 3300050492 Bacteria 2389
199 nmdc:mga0k408_2525_c1 3300050493 Bacteria 9734
200 nmdc:mga0k408_270798_c1 3300050493 Bacteria 1014
201 nmdc:mga0k408_385928_c1 3300050493 Bacteria 834
202 nmdc:mga0k408_411312_c1 3300050493 Bacteria 805
203 nmdc:mga0k408_66732_c1 3300050493 Bacteria 2096
204 nmdc:mga06z11_329660_c1 3300050494 Bacteria 911
205 nmdc:mga06z11_7983_c1 3300050494 Bacteria 4385
206 nmdc:mga07m45_1488_c1 3300050496 Bacteria 10756
207 Ga0500578_0015191 3300053086 Bacteria 4948
208 Ga0500644_0005450 3300053088 Bacteria 3213
209 Ga0500593_027929 3300053117 Bacteria 2519
210 Ga0500619_000829 3300053154 Bacteria 5263
211 Ga0500634_0066769 3300053161 Bacteria 1894
212 Ga0500645_000734 3300053730 Bacteria 20209
213 Ga0500645_005403 3300053730 Bacteria 4710
214 Ga0500645_006895 3300053730 Bacteria 4010
215 Ga0500587_000334 3300053739 Bacteria 5305
216 Ga0500661_002122 3300055283 Bacteria 3741
217 2511246518 2511231002 Bacteria 5042903
218 2548499727 2547132374 Bacteria 5530232
219 2643867975 2643221570 Bacteria 5103772
220 2643991836 2643221596 Bacteria 5006805
221 2644059520 2643221609 Bacteria 6756331
222 2644074668 2643221611 Bacteria 6820941
223 2644293580 2643221652 Bacteria 5140275
224 2644644956 2643221717 Bacteria 5676132
225 2739241052 2738543012 Bacteria 7115078
226 2816471870 2816332133 Bacteria 7249298
227 2842718469 2842718218 Bacteria 4560148
228 2842748783 2842747753 Bacteria 5578255
229 2881103540 2881101125 Bacteria 4590519
230 2904483452 2904479285 Bacteria 5073931
231 2919467091 2919462493 Bacteria 5817112
232 2928120740 2928115317 Bacteria 6477646
233 2945910217 2945909444 Bacteria 7065066
234 2945987757 2945984333 Bacteria 7358892
235 2990713661 2990710928 Bacteria 5002431
236 Ga0495606_0077387
237 JGI25155J39150_1000702
238 JGI25156J39149_1001359
239 JGI25154J39366_1001111
240 JGI25157J39369_1001246
241 JGI25150J39212_1023953
242 JGI25159J45721_1000358
243 JGI25159J45721_1004774
244 JGI25151J46595_10035557
245 JGI25160J50197_1001039
246 JGI25160J50197_1015320
247 JGI25161J50226_1000131
248 Ga0055526_1001193
249 Ga0055526_1006425
250 Ga0055537_1000820
251 Ga0055524_1000186
252 Ga0055524_1000333
253 Ga0055534_1000638
254 Ga0055528_1000268
255 Ga0055530_10000330
256 Ga0055540_1000058
257 Ga0055531_10003138
258 Ga0055543_1001038
259 Ga0065165_1016911
260 Ga0065714_10069419
261 Ga0068869_100800251
262 Ga0070680_100745314
263 Ga0070679_100170618
264 Ga0070679_100314171
265 Ga0068855_100109446
266 Ga0068855_100267085
267 Ga0075365_10008605
268 Ga0075365_10041934
269 Ga0075363_100005237
270 Ga0075364_10104414
271 Ga0075432_10006186
272 Ga0075362_10010863
273 Ga0075367_10056696
274 Ga0075367_10205321
275 Ga0075367_10282264
276 Ga0075370_10005067
277 Ga0068865_100167572
278 Ga0079104_1007217
279 Ga0105240_10010601
280 Ga0105245_10014284
281 Ga0105243_10001275
282 Ga0105238_10045717
283 Ga0157326_1004725
284 Ga0157378_10387884
285 Ga0182008_10058639
286 Ga0182008_10142232
287 Ga0157376_10006543
288 Ga0163161_10418252
289 Ga0209435_100002
290 Ga0207425_1014002
291 Ga0209646_1000001
292 Ga0209026_1000001
293 Ga0209759_1000001
294 Ga0209565_1000143
295 Ga0209673_1000008
296 Ga0209130_1000072
297 Ga0209130_1000305
298 Ga0209675_1000750
299 Ga0209675_1001505
300 Ga0209676_1000023
301 Ga0209676_1033593
302 Ga0209025_1016126
303 Ga0209025_1043637
304 Ga0209025_1066438
305 Ga0209564_1000735
306 Ga0209564_1002857
307 Ga0209050_1000022
308 Ga0209050_1012117
309 Ga0209050_1023115
310 Ga0209256_1000001
311 Ga0207426_1000320
312 Ga0207426_1000739
313 Ga0209051_1000013
314 Ga0209257_1000042
315 Ga0207654_10091744
316 Ga0207695_10279616
317 Ga0207660_10081112
318 Ga0207657_10024790
319 Ga0207652_10207567
320 Ga0207652_10675892
321 Ga0207694_10120914
322 Ga0207704_10268830
323 Ga0207689_10057370
324 Ga0207667_10207582
325 Ga0209281_1018449
326 Ga0265334_10058853
327 Ga0307515_10001658
328 Ga0307515_10003085
329 Ga0307515_10004515
330 Ga0307515_10164927
331 Ga0307515_10177424
332 Ga0307512_10061848
333 Ga0265330_10000082
334 Ga0265332_10000090
335 Ga0265325_10006763
336 Ga0265340_10017987
337 Ga0307513_10000064
338 Ga0307513_10000117
339 Ga0307513_10085515
340 Ga0307513_10146228
341 Ga0307513_10379238
342 Ga0307509_10071993
343 Ga0307408_100000359
344 Ga0307408_100016571
345 Ga0307408_100078909
346 Ga0307508_10000082
347 Ga0307514_10058602
348 Ga0265314_10000247
349 Ga0307516_10002190
350 Ga0307516_10042199
351 Ga0307406_10000369
352 Ga0307412_10008450
353 Ga0307412_10904948
354 Ga0307416_100871235
355 Ga0307414_10036974
356 Ga0307507_10043841
357 Ga0373925_0732083
358 Ga0395899_0118953
359 Ga0395900_0010431
360 Ga0395900_0051207
361 Ga0395900_0207236
362 Ga0395898_0011568
363 Ga0395898_0220033
364 Ga0395905_0000088
365 Ga0395905_0000637
366 Ga0395905_0015440
367 Ga0395905_0034767
368 Ga0395905_0055794
369 Ga0395905_0061687
370 Ga0395905_0255615
371 Ga0395905_0604743
372 Ga0395901_0026533
373 Ga0395901_0210103
374 Ga0395901_0455831
375 Ga0439438_068918
376 Ga0451793_1314334
377 Ga0451835_0766080
378 Ga0451839_0330447
379 Ga0451843_0925831
380 Ga0439441_024802
381 Ga0450893_0002076
382 Ga0451577_0004913
383 Ga0466969_0017162
384 Ga0466972_0028798
385 Ga0466965_0128383
386 Ga0466966_0009967
387 Ga0466966_0086465
388 Ga0466966_0093652
389 Ga0466961_0035507
390 Ga0453684_0290591
391 Ga0453684_0430752
392 Ga0453684_0568895
393 Ga0466968_0117167
394 Ga0466970_0209593
395 Ga0466957_0405757
396 Ga0466960_0020337
397 Ga0466960_0278495
398 Ga0466959_0174335
399 Ga0451576_0001041
400 Ga0495610_0004891
401 Ga0495620_0043816
402 Ga0495632_0027118
403 Ga0495643_0128032
404 Ga0495663_0028287
405 Ga0495642_0011099
406 Ga0495654_0096728
407 Ga0495633_0114209
408 Ga0495625_0001168
409 Ga0495669_0119159
410 Ga0495671_0096059
411 Ga0495677_0095650
412 Ga0496106_0055864
413 Ga0496110_0529060
414 Ga0496111_0305593
415 Ga0496113_0645934
416 Ga0496116_0023522
417 Ga0496121_0118090
418 Ga0496122_0126791
419 Ga0496125_0174212
420 Ga0501034_0083232
421 Ga0501034_0322354
422 Ga0501037_0023055
423 Ga0501038_0343913
424 Ga0501046_0060582
425 Ga0501047_0056928
426 Ga0501080_0674265
427 Ga0501044_0032069
428 nmdc:mga03683_167562_c1
429 nmdc:mga03683_75445_c1
430 nmdc:mga03n38_50565_c1
431 nmdc:mga00v17_163396_c1
432 nmdc:mga0yw44_23607_c1
433 nmdc:mga0yw44_56677_c1
434 nmdc:mga0k408_2525_c1
435 nmdc:mga0k408_270798_c1
436 nmdc:mga0k408_385928_c1
437 nmdc:mga0k408_411312_c1
438 nmdc:mga0k408_66732_c1
439 nmdc:mga06z11_329660_c1
440 nmdc:mga06z11_7983_c1
441 nmdc:mga07m45_1488_c1
442 Ga0500578_0015191
443 Ga0500644_0005450
444 Ga0500593_027929
445 Ga0500619_000829
446 Ga0500634_0066769
447 Ga0500645_000734
448 Ga0500645_005403
449 Ga0500645_006895
450 Ga0500587_000334
451 Ga0500661_002122
452 2511246518
453 2548499727
454 2643867975
455 2643991836
456 2644059520
457 2644074668
458 2644293580
459 2644644956
460 2739241052
461 2816471870
462 2842718469
463 2842748783
464 2881103540
465 2904483452
466 2919467091
467 2928120740
468 2945910217
469 2945987757
470 2990713661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04002

RadC

RadC-like JAB domain

103

223

0.97

PF20582

UPF0758_N

UPF0758 N-terminal

3

80

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.9302 104 224
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.9019 104 224
3bs7-assembly2.cif.gz_B crystal structure of the sterile alpha motif (sam) domain of hyphen/aveugle 0.7562 44 92
8ak4-assembly1.cif.gz_A structure of the c-terminally truncated nad+-dependent dna ligase from the poly-extremophile deinococcus radiodurans 0.7289 44 90
2mut-assembly1.cif.gz_A solution structure of the f231l mutant ercc1-xpf dimerization region 0.7264 26 86
ID Description Score Start End Superfamily
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9696 105 222 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9463 104 222 3.40.140.10
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9418 101 224 3.40.140.10
2qlcA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9347 104 224 3.40.140.10
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9345 101 224 3.40.140.10
ID Description Score Start End GO Terms
AF-Q1BUB2-F1-model_v4 UPF0758 protein Bcen_1890 0.9093 5 224 GO:0006508
GO:0008237
GO:0046872
AF-A0A220S038-F1-model_v4 Uncharacterized protein 0.909 3 224 GO:0006508
GO:0008237
GO:0046872
AF-A0A220S038-F1-model_v4 Uncharacterized protein 0.8976 3 224 GO:0006508
GO:0008237
GO:0046872
AF-A0A7X7CV74-F1-model_v4 DNA repair protein RadC 0.8897 9 224 GO:0006508
GO:0008237
GO:0046872
AF-G2J931-F1-model_v4 DNA repair protein RadC 0.8871 3 224 GO:0006508
GO:0008237
GO:0046872

Map