F348687

General Info

Members Datasets Scaffolds Average Seq Length
236 168 234 175

Family's Representative Sequence

Representative Sequence 3300003161|Ga0006765J45826_106640|Ga0006765J45826_1066406
Length 177
Sequence MSRVAKNPVTLPAGVEVKMTASEIIVKGPLGSTSRVIPPVVQIKLENNALTFAAVDESKHSRAMSGTMRALLNNMVNGVSKGFERKLNLVGVGYRAQAAGDTLNLTLGFSHPVAHKMPAGVKVETPTQTEIVLKGVDKQQVGQVAAEVRAYRAPEPYKGKGVRYSDEVVVIKETKKK

Samples

Sample ID Description Type Environment
1 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
2 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003717 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
77 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
79 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
83 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
84 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
97 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
98 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
99 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
100 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
101 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
102 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
103 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
106 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
151 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
152 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
164 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
165 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
166 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
167 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
168 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.41
Metatranscriptomes 9.75
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 4.24
Rhizosphere 82.2
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006765J45826_106640 3300003161 Bacteria 8906
2 Ga0006759J45824_1026362 3300003163 Bacteria 8907
3 Ga0006758J48902_1015967 3300003300 Bacteria 4965
4 Ga0006770J48903_1021042 3300003305 Bacteria 2673
5 rootL2_10004257 3300003322 Bacteria 11441
6 Ga0007416J51690_1023149 3300003577 Bacteria 4016
7 Ga0006766_113576 3300003717 Bacteria 2845
8 Ga0070682_100566985 3300005337 Bacteria 891
9 Ga0070660_101070402 3300005339 Bacteria 682
10 Ga0070689_100609831 3300005340 Bacteria 946
11 Ga0070691_10071558 3300005341 Bacteria 1684
12 Ga0070659_100019759 3300005366 Bacteria 5112
13 Ga0070705_100078538 3300005440 Bacteria 2019
14 Ga0070694_100100245 3300005444 Bacteria 2048
15 Ga0070694_100315375 3300005444 Bacteria 1202
16 Ga0070708_100066911 3300005445 Bacteria 3225
17 Ga0070678_100775188 3300005456 Bacteria 869
18 Ga0070662_100068585 3300005457 Bacteria 2607
19 Ga0070681_10010917 3300005458 Bacteria 8982
20 Ga0068867_100373191 3300005459 Bacteria 1196
21 Ga0070706_100117928 3300005467 Bacteria 2472
22 Ga0070707_100064367 3300005468 Bacteria 3521
23 Ga0070699_100043286 3300005518 Bacteria 3897
24 Ga0070699_100744627 3300005518 Bacteria 896
25 Ga0070679_100085474 3300005530 Bacteria 3142
26 Ga0070697_100656064 3300005536 Bacteria 924
27 Ga0070695_100063606 3300005545 Bacteria 2398
28 Ga0070696_100354320 3300005546 Bacteria 1137
29 Ga0070693_100233163 3300005547 Bacteria 1212
30 Ga0070704_100306038 3300005549 Bacteria 1326
31 Ga0070702_100330924 3300005615 Bacteria 1065
32 Ga0075432_10279535 3300006058 Bacteria 686
33 Ga0070716_100163531 3300006173 Bacteria 1445
34 Ga0075366_10026067 3300006195 Bacteria 3421
35 Ga0075366_10050535 3300006195 Bacteria 2469
36 Ga0075430_100548707 3300006846 Bacteria 953
37 Ga0075434_100036821 3300006871 Bacteria 4840
38 Ga0075434_100194623 3300006871 Bacteria 2048
39 Ga0075436_100164525 3300006914 Bacteria 1565
40 Ga0075436_100591890 3300006914 Bacteria 817
41 Ga0075436_100827656 3300006914 Bacteria 690
42 Ga0099794_10046314 3300007265 Bacteria 2083
43 Ga0099794_10054674 3300007265 Bacteria 1928
44 Ga0099795_10000373 3300007788 Bacteria 8087
45 Ga0111539_10009725 3300009094 Bacteria 12138
46 Ga0111539_10100124 3300009094 Bacteria 3403
47 Ga0105245_10425057 3300009098 Unclassified 1332
48 Ga0105241_10515396 3300009174 Bacteria 1069
49 Ga0105242_11142907 3300009176 Bacteria 795
50 Ga0105246_10296696 3300011119 Bacteria 1303
51 Ga0157378_10214933 3300013297 Bacteria 1825
52 Ga0157378_11446793 3300013297 Bacteria 731
53 Ga0157375_10107311 3300013308 Bacteria 2885
54 Ga0157376_10071360 3300014969 Bacteria 2951
55 Ga0163161_10098330 3300017792 Bacteria 2175
56 Ga0184593_120702 3300019179 Bacteria 2242
57 Ga0213872_10001501 3300021361 Bacteria 15036
58 Ga0213872_10003461 3300021361 Bacteria 8770
59 Ga0213872_10103806 3300021361 Bacteria 1265
60 Ga0207642_10571628 3300025899 Bacteria 700
61 Ga0207688_10174650 3300025901 Bacteria 1279
62 Ga0207684_10088781 3300025910 Bacteria 2634
63 Ga0207707_10015921 3300025912 Bacteria 6559
64 Ga0207652_10265624 3300025921 Bacteria 1548
65 Ga0207646_10027133 3300025922 Bacteria 5222
66 Ga0207687_10587596 3300025927 Bacteria 937
67 Ga0207690_10054974 3300025932 Bacteria 2679
68 Ga0207690_10714133 3300025932 Bacteria 825
69 Ga0207706_10181832 3300025933 Bacteria 1846
70 Ga0207706_10845203 3300025933 Bacteria 775
71 Ga0207704_10680802 3300025938 Bacteria 850
72 Ga0207665_10095566 3300025939 Bacteria 2066
73 Ga0209588_1005292 3300027671 Bacteria 3690
74 Ga0209971_1015553 3300027682 Bacteria 1804
75 Ga0268265_10822238 3300028380 Bacteria 907
76 Ga0265762_1039979 3300030760 Bacteria 915
77 Ga0265763_1016990 3300030763 Bacteria 735
78 Ga0265767_100508 3300030836 Bacteria 1661
79 Ga0265766_1000688 3300030863 Bacteria 1510
80 Ga0265766_1000994 3300030863 Bacteria 1350
81 Ga0265764_100061 3300030882 Bacteria 2903
82 Ga0265769_100158 3300030888 Bacteria 2263
83 Ga0265761_100694 3300030889 Bacteria 1338
84 Ga0265774_100097 3300031011 Bacteria 2209
85 Ga0265330_10014758 3300031235 Bacteria 3623
86 Ga0265331_10000050 3300031250 Bacteria 181286
87 Ga0265331_10045550 3300031250 Bacteria 2117
88 Ga0265327_10000109 3300031251 Bacteria 181275
89 Ga0316575_10000771 3300031665 Bacteria 9685
90 Ga0310111_101033 3300031667 Bacteria 2830
91 Ga0247548_100553 3300031814 Bacteria 1328
92 Ga0316583_10000730 3300032133 Bacteria 10224
93 Ga0316583_10032677 3300032133 Bacteria 1849
94 Ga0316593_10031671 3300032168 Bacteria 1724
95 Ga0316593_10137656 3300032168 Bacteria 883
96 Ga0307510_10249597 3300033180 Unclassified 1263
97 Ga0373934_0000158 3300035086 Bacteria 24585
98 Ga0373951_0119036 3300035091 Bacteria 717
99 Ga0373952_0000366 3300035092 Bacteria 7677
100 Ga0373939_0270702 3300035114 Bacteria 667
101 Ga0373953_0037233 3300035117 Bacteria 1919
102 Ga0373954_0008420 3300035118 Bacteria 4524
103 Ga0373954_0010574 3300035118 Bacteria 4073
104 Ga0373954_0053602 3300035118 Bacteria 1896
105 Ga0373956_0000755 3300035119 Bacteria 13380
106 Ga0373957_0005211 3300035120 Bacteria 4019
107 Ga0373955_0057895 3300035172 Bacteria 2130
108 Ga0373933_0000780 3300035724 Bacteria 19427
109 Ga0373937_0002976 3300036401 Bacteria 14187
110 Ga0373937_0631260 3300036401 Bacteria 1016
111 Ga0310112_010639 3300036458 Bacteria 1313
112 Ga0310109_023986 3300036534 Bacteria 819
113 Ga0373925_0604879 3300037068 Bacteria 903
114 Ga0395905_0000084 3300037471 Bacteria 158046
115 Ga0400484_26615 3300038725 Bacteria 15410
116 Ga0400490_11910 3300038726 Bacteria 15668
117 Ga0400490_15186 3300038726 Bacteria 5470
118 Ga0400490_20465 3300038726 Bacteria 4754
119 Ga0400491_21512 3300038727 Bacteria 1535
120 Ga0400488_01659 3300038741 Bacteria 1788
121 Ga0400486_07648 3300038742 Bacteria 3034
122 Ga0400483_035353 3300039062 Bacteria 8181
123 Ga0400483_073836 3300039062 Bacteria 21552
124 Ga0400483_118921 3300039062 Bacteria 1355
125 Ga0400483_205660 3300039062 Bacteria 9867
126 Ga0400483_291239 3300039062 Bacteria 1134
127 Ga0400489_88546 3300039093 Bacteria 4330
128 Ga0400487_36381 3300039110 Bacteria 2230
129 Ga0400487_57269 3300039110 Bacteria 1123
130 Ga0436361_0042094 3300039447 Bacteria 27359
131 Ga0436361_0402240 3300039447 Bacteria 25910
132 Ga0436361_0607685 3300039447 Bacteria 1476
133 Ga0451800_0811290 3300041459 Bacteria 706
134 Ga0450896_006823 3300042133 Bacteria 1570
135 Ga0439434_0192914 3300042435 Bacteria 685
136 Ga0439435_0155239 3300042436 Bacteria 736
137 Ga0451577_0008554 3300042876 Bacteria 9952
138 Ga0453683_0009125 3300044673 Bacteria 6624
139 Ga0453684_0000014 3300044712 Bacteria 993311
140 Ga0453684_0001268 3300044712 Bacteria 75704
141 Ga0451576_0000013 3300045051 Bacteria 665120
142 Ga0451576_0122787 3300045051 Bacteria 2704
143 Ga0451576_0158639 3300045051 Bacteria 2360
144 Ga0451576_0338738 3300045051 Bacteria 1574
145 Ga0451576_0642138 3300045051 Bacteria 1115
146 Ga0495592_0201832 3300046454 Bacteria 1341
147 Ga0495651_0000262 3300046462 Bacteria 41024
148 Ga0495664_0248745 3300046477 Bacteria 1075
149 Ga0495608_0111260 3300046511 Bacteria 1761
150 Ga0495628_0334219 3300046516 Bacteria 1116
151 Ga0495630_0250146 3300046517 Bacteria 1354
152 Ga0495645_0344192 3300046543 Bacteria 962
153 Ga0495667_0010037 3300046559 Bacteria 6414
154 Ga0495675_0225912 3300047444 Bacteria 1131
155 Ga0495681_0027011 3300047470 Bacteria 2977
156 Ga0495686_0000214 3300047472 Bacteria 106493
157 Ga0496100_0953672 3300048903 Bacteria 674
158 Ga0496104_0279534 3300048907 Bacteria 1582
159 Ga0496108_0102226 3300048911 Bacteria 2445
160 Ga0496108_0436107 3300048911 Bacteria 1144
161 Ga0496109_0961957 3300048912 Bacteria 792
162 Ga0496110_0243715 3300048913 Bacteria 1636
163 Ga0496110_0302350 3300048913 Bacteria 1457
164 Ga0496113_0114796 3300048916 Bacteria 2100
165 Ga0496114_0017684 3300048917 Bacteria 5758
166 Ga0501323_000532 3300049539 Bacteria 2861
167 Ga0501031_0003260 3300049568 Bacteria 10431
168 Ga0501031_0009677 3300049568 Bacteria 6275
169 Ga0501032_0000036 3300049569 Bacteria 117044
170 Ga0501032_0003598 3300049569 Bacteria 11803
171 Ga0501032_0090216 3300049569 Bacteria 2034
172 Ga0501033_0001817 3300049570 Bacteria 18639
173 Ga0501033_0003966 3300049570 Bacteria 11998
174 Ga0501033_0004521 3300049570 Bacteria 11131
175 Ga0501034_0003361 3300049571 Bacteria 18264
176 Ga0501036_0001490 3300049572 Bacteria 18035
177 Ga0501036_0002120 3300049572 Bacteria 15493
178 Ga0501036_0010828 3300049572 Bacteria 7534
179 Ga0501036_0222961 3300049572 Bacteria 1583
180 Ga0501037_0001263 3300049573 Bacteria 18639
181 Ga0501037_0033325 3300049573 Bacteria 3805
182 Ga0501037_0153563 3300049573 Bacteria 1644
183 Ga0501037_0668443 3300049573 Bacteria 693
184 Ga0501037_0964839 3300049573 Bacteria 556
185 Ga0501038_0003243 3300049574 Bacteria 15162
186 Ga0501038_0004836 3300049574 Bacteria 12512
187 Ga0501038_0055092 3300049574 Bacteria 3417
188 Ga0501038_0111082 3300049574 Bacteria 2271
189 Ga0501039_0011968 3300049575 Bacteria 6612
190 Ga0501039_0024011 3300049575 Bacteria 4682
191 Ga0501040_0000218 3300049576 Bacteria 33403
192 Ga0501042_0000031 3300049578 Bacteria 46017
193 Ga0501043_0000157 3300049579 Bacteria 62190
194 Ga0501043_0006833 3300049579 Bacteria 9109
195 Ga0501043_0016645 3300049579 Bacteria 5762
196 Ga0501043_0482396 3300049579 Bacteria 928
197 Ga0501046_0002577 3300049580 Bacteria 16965
198 Ga0501046_0004484 3300049580 Bacteria 12660
199 Ga0501047_0002207 3300049581 Bacteria 18639
200 Ga0501047_0138765 3300049581 Bacteria 2310
201 Ga0501048_0002716 3300049582 Bacteria 13496
202 Ga0501068_0001608 3300049584 Bacteria 12025
203 Ga0501069_0158992 3300049585 Bacteria 1301
204 Ga0501069_0415334 3300049585 Bacteria 797
205 Ga0501070_0044881 3300049586 Bacteria 3676
206 Ga0501075_0623160 3300049591 Bacteria 823
207 Ga0501209_000329 3300049656 Bacteria 5742
208 Ga0501238_008550 3300049671 Bacteria 1348
209 Ga0501252_059840 3300049682 Bacteria 593
210 Ga0501035_0000671 3300049822 Bacteria 37548
211 Ga0501035_0008893 3300049822 Bacteria 9344
212 Ga0501035_0015787 3300049822 Bacteria 6971
213 Ga0501035_0138321 3300049822 Bacteria 2118
214 Ga0501044_0000389 3300049823 Bacteria 54483
215 Ga0501044_0000747 3300049823 Bacteria 39287
216 Ga0501044_0161343 3300049823 Bacteria 2218
217 Ga0501044_0182697 3300049823 Bacteria 2063
218 Ga0501044_0496336 3300049823 Bacteria 1122
219 Ga0501045_0283025 3300049824 Bacteria 1234
220 nmdc:mga0k408_109049_c1 3300050493 Bacteria 1636
221 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
222 nmdc:mga08y16_106138_c1 3300050511 Bacteria 2924
223 nmdc:mga08y16_309240_c1 3300050511 Bacteria 1628
224 nmdc:mga0n895_111604_c1 3300050512 Bacteria 2750
225 nmdc:mga08x19_152952_c1 3300050514 Bacteria 1563
226 nmdc:mga08x19_230537_c1 3300050514 Bacteria 1274
227 Ga0495595_0162650 3300053084 Bacteria 1102
228 Ga0500607_065826 3300053121 Bacteria 1882
229 Ga0500559_0018535 3300053136 Bacteria 2941
230 Ga0500600_0076059 3300053149 Bacteria 1828
231 Ga0500636_0000546 3300053177 Bacteria 20487
232 Ga0500637_0015290 3300053178 Bacteria 4066
233 Ga0500625_155138 3300053729 Bacteria 852
234 Ga0500613_001534 3300053738 Bacteria 1645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_0811290 Ga0451800_0811290_258_692 144
2 3300038727 Ga0400491_21512 Ga0400491_21512_361_798 145
3 3300049585 Ga0501069_0415334 Ga0501069_0415334_18_455 145
4 3300049579 Ga0501043_0482396 Ga0501043_0482396_455_895 146
5 3300005456 Ga0070678_100775188 Ga0070678_1007751882 148
6 3300045051 Ga0451576_0158639 Ga0451576_0158639_1400_1933 150
7 3300049573 Ga0501037_0964839 Ga0501037_0964839_85_543 152
8 3300053121 Ga0500607_065826 Ga0500607_065826_25_558 156
9 3300053136 Ga0500559_0018535 Ga0500559_0018535_1350_1883 156
10 3300053177 Ga0500636_0000546 Ga0500636_0000546_761_1342 156
11 3300053178 Ga0500637_0015290 Ga0500637_0015290_3396_3977 156
12 3300053729 Ga0500625_155138 Ga0500625_155138_176_757 156
13 3300031011 Ga0265774_100097 Ga0265774_1000975 161
14 3300050493 nmdc:mga0k408_109049_c1 nmdc:mga0k408_109049_c1_626_1141 161
15 3300006195 Ga0075366_10050535 Ga0075366_100505353 163
16 3300038725 Ga0400484_26615 Ga0400484_26615_7267_7758 163
17 3300038726 Ga0400490_11910 Ga0400490_11910_11353_11844 163
18 3300038726 Ga0400490_15186 Ga0400490_15186_974_1465 163
19 3300038742 Ga0400486_07648 Ga0400486_07648_1700_2191 163
20 3300039062 Ga0400483_291239 Ga0400483_291239_334_825 163
21 3300039093 Ga0400489_88546 Ga0400489_88546_1022_1513 163
22 3300039110 Ga0400487_57269 Ga0400487_57269_186_677 163
23 3300045051 Ga0451576_0642138 Ga0451576_0642138_603_1094 163
24 3300049573 Ga0501037_0668443 Ga0501037_0668443_187_678 163
25 3300050493 nmdc:mga0k408_712_c1 nmdc:mga0k408_712_c1_4171_4749 163
26 3300045051 Ga0451576_0122787 Ga0451576_0122787_1422_1955 164
27 3300037471 Ga0395905_0000084 Ga0395905_0000084_116772_117287 171
28 3300042133 Ga0450896_006823 Ga0450896_006823_585_1100 171
29 3300048911 Ga0496108_0436107 Ga0496108_0436107_282_797 171
30 3300048913 Ga0496110_0302350 Ga0496110_0302350_428_943 171
31 iso_pu_bacteria 2891633521 2891635730 173
32 iso_pu_bacteria 639633007 639788564 173
33 3300049569 Ga0501032_0003598 Ga0501032_0003598_1133_1657 174
34 3300049570 Ga0501033_0003966 Ga0501033_0003966_2730_3254 174
35 3300049572 Ga0501036_0002120 Ga0501036_0002120_7928_8452 174
36 3300049573 Ga0501037_0033325 Ga0501037_0033325_2214_2738 174
37 3300049574 Ga0501038_0055092 Ga0501038_0055092_1779_2303 174
38 3300049575 Ga0501039_0024011 Ga0501039_0024011_3014_3538 174
39 3300049579 Ga0501043_0016645 Ga0501043_0016645_2874_3398 174
40 3300049580 Ga0501046_0004484 Ga0501046_0004484_4341_4865 174
41 3300049822 Ga0501035_0000671 Ga0501035_0000671_10269_10793 174
42 3300049823 Ga0501044_0161343 Ga0501044_0161343_1247_1771 174
43 3300049824 Ga0501045_0283025 Ga0501045_0283025_114_638 174
44 3300006173 Ga0070716_100163531 Ga0070716_1001635313 176
45 3300025939 Ga0207665_10095566 Ga0207665_100955662 176
46 3300035091 Ga0373951_0119036 Ga0373951_0119036_130_660 176
47 3300035092 Ga0373952_0000366 Ga0373952_0000366_800_1330 176
48 3300035114 Ga0373939_0270702 Ga0373939_0270702_31_561 176
49 3300042876 Ga0451577_0008554 Ga0451577_0008554_431_961 176
50 3300044712 Ga0453684_0000014 Ga0453684_0000014_558891_559421 176
51 3300003161 Ga0006765J45826_106640 Ga0006765J45826_1066406 177
52 3300003163 Ga0006759J45824_1026362 Ga0006759J45824_10263626 177
53 3300003300 Ga0006758J48902_1015967 Ga0006758J48902_10159676 177
54 3300003305 Ga0006770J48903_1021042 Ga0006770J48903_10210426 177
55 3300003322 rootL2_10004257 rootL2_1000425710 177
56 3300003577 Ga0007416J51690_1023149 Ga0007416J51690_10231496 177
57 3300003717 Ga0006766_113576 Ga0006766_1135766 177
58 3300005337 Ga0070682_100566985 Ga0070682_1005669852 177
59 3300005339 Ga0070660_101070402 Ga0070660_1010704022 177
60 3300005340 Ga0070689_100609831 Ga0070689_1006098312 177
61 3300005341 Ga0070691_10071558 Ga0070691_100715583 177
62 3300005366 Ga0070659_100019759 Ga0070659_1000197593 177
63 3300005440 Ga0070705_100078538 Ga0070705_1000785383 177
64 3300005444 Ga0070694_100100245 Ga0070694_1001002453 177
65 3300005444 Ga0070694_100315375 Ga0070694_1003153752 177
66 3300005445 Ga0070708_100066911 Ga0070708_1000669116 177
67 3300005457 Ga0070662_100068585 Ga0070662_1000685852 177
68 3300005458 Ga0070681_10010917 Ga0070681_1001091712 177
69 3300005459 Ga0068867_100373191 Ga0068867_1003731913 177
70 3300005467 Ga0070706_100117928 Ga0070706_1001179284 177
71 3300005468 Ga0070707_100064367 Ga0070707_1000643674 177
72 3300005518 Ga0070699_100043286 Ga0070699_1000432864 177
73 3300005518 Ga0070699_100744627 Ga0070699_1007446272 177
74 3300005530 Ga0070679_100085474 Ga0070679_1000854743 177
75 3300005536 Ga0070697_100656064 Ga0070697_1006560642 177
76 3300005545 Ga0070695_100063606 Ga0070695_1000636062 177
77 3300005546 Ga0070696_100354320 Ga0070696_1003543203 177
78 3300005547 Ga0070693_100233163 Ga0070693_1002331632 177
79 3300005549 Ga0070704_100306038 Ga0070704_1003060382 177
80 3300005615 Ga0070702_100330924 Ga0070702_1003309241 177
81 3300006058 Ga0075432_10279535 Ga0075432_102795351 177
82 3300006195 Ga0075366_10026067 Ga0075366_100260674 177
83 3300006846 Ga0075430_100548707 Ga0075430_1005487072 177
84 3300006871 Ga0075434_100036821 Ga0075434_1000368215 177
85 3300006871 Ga0075434_100194623 Ga0075434_1001946233 177
86 3300006914 Ga0075436_100164525 Ga0075436_1001645254 177
87 3300006914 Ga0075436_100591890 Ga0075436_1005918902 177
88 3300006914 Ga0075436_100827656 Ga0075436_1008276562 177
89 3300007265 Ga0099794_10046314 Ga0099794_100463144 177
90 3300007265 Ga0099794_10054674 Ga0099794_100546742 177
91 3300007788 Ga0099795_10000373 Ga0099795_1000037310 177
92 3300009094 Ga0111539_10009725 Ga0111539_1000972516 177
93 3300009094 Ga0111539_10100124 Ga0111539_101001243 177
94 3300009098 Ga0105245_10425057 Ga0105245_104250572 177
95 3300009174 Ga0105241_10515396 Ga0105241_105153962 177
96 3300009176 Ga0105242_11142907 Ga0105242_111429072 177
97 3300011119 Ga0105246_10296696 Ga0105246_102966963 177
98 3300013297 Ga0157378_10214933 Ga0157378_102149332 177
99 3300013297 Ga0157378_11446793 Ga0157378_114467932 177
100 3300013308 Ga0157375_10107311 Ga0157375_101073115 177
101 3300014969 Ga0157376_10071360 Ga0157376_100713604 177
102 3300017792 Ga0163161_10098330 Ga0163161_100983302 177
103 3300019179 Ga0184593_120702 Ga0184593_1207024 177
104 3300021361 Ga0213872_10001501 Ga0213872_1000150118 177
105 3300021361 Ga0213872_10003461 Ga0213872_100034616 177
106 3300021361 Ga0213872_10103806 Ga0213872_101038061 177
107 3300025899 Ga0207642_10571628 Ga0207642_105716281 177
108 3300025901 Ga0207688_10174650 Ga0207688_101746502 177
109 3300025910 Ga0207684_10088781 Ga0207684_100887813 177
110 3300025912 Ga0207707_10015921 Ga0207707_100159215 177
111 3300025921 Ga0207652_10265624 Ga0207652_102656242 177
112 3300025922 Ga0207646_10027133 Ga0207646_100271336 177
113 3300025927 Ga0207687_10587596 Ga0207687_105875962 177
114 3300025932 Ga0207690_10054974 Ga0207690_100549745 177
115 3300025932 Ga0207690_10714133 Ga0207690_107141332 177
116 3300025933 Ga0207706_10181832 Ga0207706_101818323 177
117 3300025933 Ga0207706_10845203 Ga0207706_108452031 177
118 3300025938 Ga0207704_10680802 Ga0207704_106808022 177
119 3300027671 Ga0209588_1005292 Ga0209588_10052929 177
120 3300027682 Ga0209971_1015553 Ga0209971_10155533 177
121 3300028380 Ga0268265_10822238 Ga0268265_108222381 177
122 3300030760 Ga0265762_1039979 Ga0265762_10399792 177
123 3300030763 Ga0265763_1016990 Ga0265763_10169902 177
124 3300030836 Ga0265767_100508 Ga0265767_1005082 177
125 3300030863 Ga0265766_1000688 Ga0265766_10006881 177
126 3300030863 Ga0265766_1000994 Ga0265766_10009942 177
127 3300030882 Ga0265764_100061 Ga0265764_1000612 177
128 3300030888 Ga0265769_100158 Ga0265769_1001582 177
129 3300030889 Ga0265761_100694 Ga0265761_1006943 177
130 3300031235 Ga0265330_10014758 Ga0265330_100147585 177
131 3300031250 Ga0265331_10000050 Ga0265331_10000050125 177
132 3300031250 Ga0265331_10045550 Ga0265331_100455504 177
133 3300031251 Ga0265327_10000109 Ga0265327_10000109100 177
134 3300031665 Ga0316575_10000771 Ga0316575_1000077115 177
135 3300031667 Ga0310111_101033 Ga0310111_1010332 177
136 3300031814 Ga0247548_100553 Ga0247548_1005533 177
137 3300032133 Ga0316583_10000730 Ga0316583_1000073012 177
138 3300032133 Ga0316583_10032677 Ga0316583_100326774 177
139 3300032168 Ga0316593_10031671 Ga0316593_100316712 177
140 3300032168 Ga0316593_10137656 Ga0316593_101376562 177
141 3300033180 Ga0307510_10249597 Ga0307510_102495972 177
142 3300035086 Ga0373934_0000158 Ga0373934_0000158_18864_19397 177
143 3300035117 Ga0373953_0037233 Ga0373953_0037233_957_1490 177
144 3300035118 Ga0373954_0008420 Ga0373954_0008420_1045_1578 177
145 3300035118 Ga0373954_0010574 Ga0373954_0010574_3166_3699 177
146 3300035118 Ga0373954_0053602 Ga0373954_0053602_1066_1599 177
147 3300035119 Ga0373956_0000755 Ga0373956_0000755_6928_7461 177
148 3300035120 Ga0373957_0005211 Ga0373957_0005211_917_1450 177
149 3300035172 Ga0373955_0057895 Ga0373955_0057895_1193_1726 177
150 3300035724 Ga0373933_0000780 Ga0373933_0000780_9974_10507 177
151 3300036401 Ga0373937_0002976 Ga0373937_0002976_4734_5267 177
152 3300036401 Ga0373937_0631260 Ga0373937_0631260_170_703 177
153 3300036458 Ga0310112_010639 Ga0310112_010639_759_1292 177
154 3300036534 Ga0310109_023986 Ga0310109_023986_203_736 177
155 3300037068 Ga0373925_0604879 Ga0373925_0604879_81_614 177
156 3300038726 Ga0400490_20465 Ga0400490_20465_602_1135 177
157 3300038741 Ga0400488_01659 Ga0400488_01659_458_991 177
158 3300039062 Ga0400483_035353 Ga0400483_035353_4528_5061 177
159 3300039062 Ga0400483_073836 Ga0400483_073836_5658_6191 177
160 3300039062 Ga0400483_118921 Ga0400483_118921_376_909 177
161 3300039062 Ga0400483_205660 Ga0400483_205660_7362_7895 177
162 3300039110 Ga0400487_36381 Ga0400487_36381_446_979 177
163 3300039447 Ga0436361_0042094 Ga0436361_0042094_19095_19628 177
164 3300039447 Ga0436361_0402240 Ga0436361_0402240_17934_18467 177
165 3300039447 Ga0436361_0607685 Ga0436361_0607685_130_663 177
166 3300042435 Ga0439434_0192914 Ga0439434_0192914_123_656 177
167 3300042436 Ga0439435_0155239 Ga0439435_0155239_120_653 177
168 3300044673 Ga0453683_0009125 Ga0453683_0009125_6078_6611 177
169 3300044712 Ga0453684_0001268 Ga0453684_0001268_67565_68098 177
170 3300045051 Ga0451576_0000013 Ga0451576_0000013_541410_541943 177
171 3300045051 Ga0451576_0338738 Ga0451576_0338738_368_901 177
172 3300046454 Ga0495592_0201832 Ga0495592_0201832_356_889 177
173 3300046462 Ga0495651_0000262 Ga0495651_0000262_14087_14620 177
174 3300046477 Ga0495664_0248745 Ga0495664_0248745_64_597 177
175 3300046511 Ga0495608_0111260 Ga0495608_0111260_41_574 177
176 3300046516 Ga0495628_0334219 Ga0495628_0334219_298_831 177
177 3300046517 Ga0495630_0250146 Ga0495630_0250146_490_1023 177
178 3300046543 Ga0495645_0344192 Ga0495645_0344192_246_779 177
179 3300046559 Ga0495667_0010037 Ga0495667_0010037_262_795 177
180 3300047444 Ga0495675_0225912 Ga0495675_0225912_458_991 177
181 3300047470 Ga0495681_0027011 Ga0495681_0027011_1798_2331 177
182 3300047472 Ga0495686_0000214 Ga0495686_0000214_26985_27518 177
183 3300048903 Ga0496100_0953672 Ga0496100_0953672_61_594 177
184 3300048907 Ga0496104_0279534 Ga0496104_0279534_718_1251 177
185 3300048911 Ga0496108_0102226 Ga0496108_0102226_810_1343 177
186 3300048912 Ga0496109_0961957 Ga0496109_0961957_248_781 177
187 3300048913 Ga0496110_0243715 Ga0496110_0243715_774_1307 177
188 3300048916 Ga0496113_0114796 Ga0496113_0114796_1060_1593 177
189 3300048917 Ga0496114_0017684 Ga0496114_0017684_1504_2037 177
190 3300049539 Ga0501323_000532 Ga0501323_000532_899_1432 177
191 3300049568 Ga0501031_0003260 Ga0501031_0003260_1976_2509 177
192 3300049568 Ga0501031_0009677 Ga0501031_0009677_2789_3322 177
193 3300049569 Ga0501032_0000036 Ga0501032_0000036_106328_106861 177
194 3300049569 Ga0501032_0090216 Ga0501032_0090216_742_1275 177
195 3300049570 Ga0501033_0001817 Ga0501033_0001817_7923_8456 177
196 3300049570 Ga0501033_0004521 Ga0501033_0004521_433_966 177
197 3300049571 Ga0501034_0003361 Ga0501034_0003361_7923_8456 177
198 3300049572 Ga0501036_0001490 Ga0501036_0001490_10433_10966 177
199 3300049572 Ga0501036_0010828 Ga0501036_0010828_6569_7102 177
200 3300049572 Ga0501036_0222961 Ga0501036_0222961_618_1151 177
201 3300049573 Ga0501037_0001263 Ga0501037_0001263_10184_10717 177
202 3300049573 Ga0501037_0153563 Ga0501037_0153563_432_965 177
203 3300049574 Ga0501038_0003243 Ga0501038_0003243_10184_10717 177
204 3300049574 Ga0501038_0004836 Ga0501038_0004836_9917_10450 177
205 3300049574 Ga0501038_0111082 Ga0501038_0111082_1447_1980 177
206 3300049575 Ga0501039_0011968 Ga0501039_0011968_520_1053 177
207 3300049576 Ga0501040_0000218 Ga0501040_0000218_26734_27267 177
208 3300049578 Ga0501042_0000031 Ga0501042_0000031_10472_11005 177
209 3300049579 Ga0501043_0000157 Ga0501043_0000157_51474_52007 177
210 3300049579 Ga0501043_0006833 Ga0501043_0006833_7925_8458 177
211 3300049580 Ga0501046_0002577 Ga0501046_0002577_7902_8435 177
212 3300049581 Ga0501047_0002207 Ga0501047_0002207_10184_10717 177
213 3300049581 Ga0501047_0138765 Ga0501047_0138765_1345_1878 177
214 3300049582 Ga0501048_0002716 Ga0501048_0002716_10155_10688 177
215 3300049584 Ga0501068_0001608 Ga0501068_0001608_5530_6063 177
216 3300049585 Ga0501069_0158992 Ga0501069_0158992_356_889 177
217 3300049586 Ga0501070_0044881 Ga0501070_0044881_3089_3622 177
218 3300049591 Ga0501075_0623160 Ga0501075_0623160_149_682 177
219 3300049656 Ga0501209_000329 Ga0501209_000329_5051_5584 177
220 3300049671 Ga0501238_008550 Ga0501238_008550_545_1078 177
221 3300049682 Ga0501252_059840 Ga0501252_059840_43_579 177
222 3300049822 Ga0501035_0008893 Ga0501035_0008893_7923_8456 177
223 3300049822 Ga0501035_0015787 Ga0501035_0015787_4253_4786 177
224 3300049822 Ga0501035_0138321 Ga0501035_0138321_539_1072 177
225 3300049823 Ga0501044_0000389 Ga0501044_0000389_4186_4719 177
226 3300049823 Ga0501044_0000747 Ga0501044_0000747_30106_30639 177
227 3300049823 Ga0501044_0182697 Ga0501044_0182697_37_570 177
228 3300049823 Ga0501044_0496336 Ga0501044_0496336_482_1015 177
229 3300050511 nmdc:mga08y16_106138_c1 nmdc:mga08y16_106138_c1_950_1483 177
230 3300050511 nmdc:mga08y16_309240_c1 nmdc:mga08y16_309240_c1_169_702 177
231 3300050512 nmdc:mga0n895_111604_c1 nmdc:mga0n895_111604_c1_951_1484 177
232 3300050514 nmdc:mga08x19_152952_c1 nmdc:mga08x19_152952_c1_995_1528 177
233 3300050514 nmdc:mga08x19_230537_c1 nmdc:mga08x19_230537_c1_585_1118 177
234 3300053084 Ga0495595_0162650 Ga0495595_0162650_498_1031 177
235 3300053149 Ga0500600_0076059 Ga0500600_0076059_600_1133 177
236 3300053738 Ga0500613_001534 Ga0500613_001534_924_1457 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

90

165

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

11

82

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9624 1 169
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9595 2 169
5o60-assembly1.cif.gz_G structure of the 50s large ribosomal subunit from mycobacterium smegmatis 0.9564 2 169
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9545 2 169
5x8t-assembly1.cif.gz_G structure of the 50s large subunit of chloroplast ribosome from spinach 0.9492 3 173
ID Description Score Start End Superfamily
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9582 3 82 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9468 83 169 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9434 1 82 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9401 2 82 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9379 83 168 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A257GTA8-F1-model_v4 50S ribosomal protein L6 0.994 1 83 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2G4DSX9-F1-model_v4 50S ribosomal protein L6 0.9856 1 148 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A352Q4J4-F1-model_v4 50S ribosomal protein L6 0.9853 1 149 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1V4GKA1-F1-model_v4 deleted 0.9843 76 146
AF-A0A7C3CFM4-F1-model_v4 50S ribosomal protein L6 0.9838 1 79 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
89.73 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map