F348919

General Info

Members Datasets Scaffolds Average Seq Length
236 145 236 156

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000002|Ga0068855_100000002437
Length 147
Sequence MAKSKAQLELEEKLGELTLDLQRTRADFENYKTMARESGQASAILKLLPVIDNIERAIAYTPEELKDNSWVQSVAGLVKHLEKSLEGLNLARIDAKPGTPFDPELHEAIQFDEDAKGEHEVVAEELQAGYTLGGHVIRHAMVKVTRQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
42 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
43 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
44 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
74 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
75 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
76 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
77 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
78 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
88 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
89 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
97 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
98 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
99 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
142 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
143 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
144 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
145 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.27
Nodule 0
Rhizoplane 2.12
Rhizosphere 67.37
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_978302 2162886012 Bacteria 924
2 JGI24740J21852_10005135 3300001979 Bacteria 5558
3 JGI24740J21852_10011395 3300001979 Bacteria 3386
4 JGI24739J22299_10000411 3300001989 Bacteria 14782
5 JGI24739J22299_10006909 3300001989 Bacteria 4275
6 JGI24743J22301_10003114 3300001991 Bacteria 2587
7 JGI24735J21928_10000023 3300002067 Bacteria 96124
8 rootH1_10035926 3300003316 Bacteria 21238
9 rootH2_10006821 3300003320 Bacteria 94080
10 rootL2_10092282 3300003322 Bacteria 8627
11 rootH1_10153185 3300003323 Bacteria 13830
12 rootH1_10211370 3300003323 Bacteria 1304
13 Ga0070658_10000009 3300005327 Bacteria 319868
14 Ga0070683_100004861 3300005329 Bacteria 11129
15 Ga0070660_100000088 3300005339 Bacteria 55610
16 Ga0070660_100002266 3300005339 Bacteria 13213
17 Ga0070661_100024780 3300005344 Unclassified 4306
18 Ga0070661_100028736 3300005344 Bacteria 4012
19 Ga0070661_100532177 3300005344 Bacteria 944
20 Ga0070659_100009417 3300005366 Bacteria 7172
21 Ga0070659_100033508 3300005366 Bacteria 3990
22 Ga0070701_10492247 3300005438 Unclassified 794
23 Ga0070662_100099206 3300005457 Bacteria 2201
24 Ga0070662_100428305 3300005457 Bacteria 1096
25 Ga0070684_100040472 3300005535 Bacteria 4013
26 Ga0070684_100400127 3300005535 Bacteria 1266
27 Ga0068855_100000002 3300005563 Bacteria 616881
28 Ga0068855_100267250 3300005563 Bacteria 1903
29 Ga0070664_101064538 3300005564 Unclassified 761
30 Ga0068857_100122912 3300005577 Bacteria 2338
31 Ga0068854_100009450 3300005578 Bacteria 6296
32 Ga0068856_100000029 3300005614 Bacteria 130205
33 Ga0068856_100000122 3300005614 Bacteria 78134
34 Ga0068856_101192490 3300005614 Unclassified 778
35 Ga0068852_100000001 3300005616 Bacteria 716526
36 Ga0068852_100000011 3300005616 Bacteria 141147
37 Ga0068852_100313773 3300005616 Unclassified 1521
38 Ga0081455_10000001 3300005937 Bacteria 603871
39 Ga0075365_10000018 3300006038 Bacteria 66628
40 Ga0075365_10000209 3300006038 Bacteria 19648
41 Ga0075365_10083943 3300006038 Bacteria 2161
42 Ga0075365_10318701 3300006038 Unclassified 1095
43 Ga0075368_10000100 3300006042 Bacteria 21941
44 Ga0075363_100041498 3300006048 Bacteria 2427
45 Ga0075364_10000268 3300006051 Bacteria 25311
46 Ga0075364_10007334 3300006051 Bacteria 6545
47 Ga0075362_10057185 3300006177 Bacteria 1757
48 Ga0075367_10000237 3300006178 Bacteria 18753
49 Ga0075367_10635997 3300006178 Bacteria 678
50 Ga0075369_10005010 3300006186 Bacteria 4932
51 Ga0075369_10145707 3300006186 Unclassified 1081
52 Ga0075366_10059250 3300006195 Bacteria 2274
53 Ga0097621_100083688 3300006237 Bacteria 2659
54 Ga0075370_10015264 3300006353 Bacteria 4108
55 Ga0075370_10149017 3300006353 Bacteria 1371
56 Ga0075370_10171544 3300006353 Unclassified 1275
57 Ga0075370_10278841 3300006353 Bacteria 993
58 Ga0075370_10738695 3300006353 Unclassified 599
59 Ga0068871_100010629 3300006358 Bacteria 6727
60 Ga0075428_100001648 3300006844 Bacteria 23755
61 Ga0105240_10000030 3300009093 Bacteria 321312
62 Ga0105240_10505467 3300009093 Bacteria 1343
63 Ga0105241_10008645 3300009174 Bacteria 7485
64 Ga0105241_10040160 3300009174 Bacteria 3532
65 Ga0105241_10226517 3300009174 Bacteria 1574
66 Ga0105237_10000001 3300009545 Bacteria 1009213
67 Ga0105237_10000002 3300009545 Bacteria 702357
68 Ga0105238_10012106 3300009551 Bacteria 8695
69 Ga0105238_10126666 3300009551 Bacteria 2532
70 Ga0105238_10236491 3300009551 Bacteria 1804
71 Ga0105032_100002 3300009979 Bacteria 303884
72 Ga0105032_100013 3300009979 Bacteria 60280
73 Ga0105032_100826 3300009979 Bacteria 2922
74 Ga0105029_100335 3300009984 Bacteria 2463
75 Ga0105030_104224 3300009987 Unclassified 1226
76 Ga0105028_100032 3300009993 Bacteria 15715
77 Ga0105028_100189 3300009993 Bacteria 6669
78 Ga0105239_10001870 3300010375 Bacteria 27551
79 Ga0105239_10024756 3300010375 Bacteria 6611
80 Ga0105239_11383310 3300010375 Bacteria 812
81 Ga0105246_10001002 3300011119 Bacteria 16233
82 Ga0157373_10014415 3300013100 Bacteria 5794
83 Ga0157371_10006351 3300013102 Bacteria 9774
84 Ga0157371_10208816 3300013102 Bacteria 1401
85 Ga0157371_10274643 3300013102 Bacteria 1217
86 Ga0157370_10001378 3300013104 Bacteria 30046
87 Ga0157370_10001976 3300013104 Bacteria 25220
88 Ga0157370_10394589 3300013104 Bacteria 1274
89 Ga0157369_10000003 3300013105 Bacteria 507337
90 Ga0157369_10000026 3300013105 Bacteria 216023
91 Ga0157369_10000055 3300013105 Bacteria 161739
92 Ga0157369_10013283 3300013105 Bacteria 9319
93 Ga0157369_10050740 3300013105 Bacteria 4491
94 Ga0157374_10963852 3300013296 Bacteria 872
95 Ga0157372_10000007 3300013307 Bacteria 340690
96 Ga0157372_10000106 3300013307 Bacteria 87935
97 Ga0157372_10348361 3300013307 Bacteria 1726
98 Ga0157514_111118 3300013874 Unclassified 1226
99 Ga0163163_10911620 3300014325 Bacteria 942
100 Ga0157376_10000085 3300014969 Bacteria 70910
101 Ga0207654_10020630 3300025911 Bacteria 3496
102 Ga0207654_10475385 3300025911 Unclassified 879
103 Ga0207695_10000009 3300025913 Bacteria 1034276
104 Ga0207695_10355724 3300025913 Bacteria 1351
105 Ga0207671_10000003 3300025914 Bacteria 1065461
106 Ga0207671_10000008 3300025914 Bacteria 798229
107 Ga0207657_10001595 3300025919 Bacteria 24372
108 Ga0207649_10064364 3300025920 Bacteria 2318
109 Ga0207649_10469048 3300025920 Bacteria 953
110 Ga0207694_10007438 3300025924 Bacteria 8296
111 Ga0207694_10320504 3300025924 Bacteria 1279
112 Ga0207687_10271159 3300025927 Bacteria 1357
113 Ga0207690_10016819 3300025932 Bacteria 4457
114 Ga0207661_10082413 3300025944 Bacteria 2659
115 Ga0207679_10987866 3300025945 Unclassified 771
116 Ga0207667_10000005 3300025949 Bacteria 715503
117 Ga0207667_10020403 3300025949 Bacteria 7371
118 Ga0207640_10022352 3300025981 Bacteria 3783
119 Ga0207658_11926875 3300025986 Unclassified 538
120 Ga0207702_10000051 3300026078 Bacteria 139040
121 Ga0207702_10000431 3300026078 Bacteria 47962
122 Ga0207674_10000032 3300026116 Bacteria 142389
123 Ga0207674_10168400 3300026116 Bacteria 2145
124 Ga0207698_10000001 3300026142 Bacteria 625389
125 Ga0207698_10000024 3300026142 Bacteria 123946
126 Ga0207698_10219320 3300026142 Bacteria 1717
127 Ga0209813_10007594 3300027866 Bacteria 2705
128 Ga0316177_1181856 3300030731 Unclassified 740
129 Ga0314311_1008008 3300030733 Bacteria 2286
130 Ga0314311_1189512 3300030733 Bacteria 4324
131 Ga0316179_1002117 3300030734 Bacteria 36853
132 Ga0316183_1074109 3300030742 Bacteria 13986
133 Ga0316183_1080520 3300030742 Bacteria 5252
134 Ga0316183_1195954 3300030742 Bacteria 699
135 Ga0316183_1209931 3300030742 Bacteria 2313
136 Ga0316181_1087109 3300030744 Bacteria 1780
137 Ga0316181_1116978 3300030744 Bacteria 53317
138 Ga0316181_1128173 3300030744 Bacteria 867
139 Ga0316182_1020791 3300030745 Bacteria 37858
140 Ga0316182_1168577 3300030745 Bacteria 16552
141 Ga0316182_1383541 3300030745 Bacteria 2158
142 Ga0307509_10018891 3300031507 Bacteria 7887
143 Ga0307516_10011168 3300031730 Bacteria 9803
144 Ga0307406_10110872 3300031901 Bacteria 1889
145 Ga0307412_10051935 3300031911 Bacteria 2712
146 Ga0395899_0050164 3300037312 Bacteria 3100
147 Ga0395899_0269359 3300037312 Unclassified 1162
148 Ga0395900_0000001 3300037418 Bacteria 931146
149 Ga0395898_0000002 3300037466 Bacteria 931013
150 Ga0395901_0000006 3300038443 Bacteria 514112
151 Ga0395901_0020011 3300038443 Bacteria 6848
152 Ga0395901_0201651 3300038443 Bacteria 2085
153 Ga0395901_0876332 3300038443 Bacteria 881
154 Ga0439438_018227 3300041405 Bacteria 2003
155 Ga0439447_007022 3300041407 Bacteria 3608
156 Ga0439461_0003819 3300041410 Bacteria 2492
157 Ga0439461_0005787 3300041410 Bacteria 2125
158 Ga0439466_0046056 3300041411 Bacteria 1441
159 Ga0439431_0009386 3300041997 Bacteria 2210
160 Ga0439442_067639 3300042002 Bacteria 759
161 Ga0439432_020994 3300042006 Bacteria 2167
162 Ga0439449_0135850 3300042007 Bacteria 915
163 Ga0439452_016365 3300042010 Bacteria 2015
164 Ga0450911_024256 3300042115 Bacteria 788
165 Ga0450920_001004 3300042122 Bacteria 4622
166 Ga0450903_016170 3300042138 Unclassified 1171
167 Ga0450906_004714 3300042145 Bacteria 2842
168 Ga0439446_0000421 3300042156 Bacteria 8279
169 Ga0439446_0003833 3300042156 Bacteria 3767
170 Ga0439446_0091031 3300042156 Unclassified 955
171 Ga0439434_0001626 3300042435 Bacteria 6493
172 Ga0439434_0027477 3300042435 Bacteria 1720
173 Ga0439434_0134568 3300042435 Bacteria 812
174 Ga0450918_016100 3300042531 Bacteria 1298
175 Ga0450918_025507 3300042531 Bacteria 1036
176 Ga0466965_0000311 3300044683 Bacteria 16298
177 Ga0453684_0740538 3300044712 Bacteria 1065
178 Ga0451576_0180773 3300045051 Bacteria 2202
179 Ga0495638_0000061 3300046460 Bacteria 188551
180 Ga0495638_0000167 3300046460 Bacteria 102139
181 Ga0495597_0097833 3300046542 Bacteria 1240
182 Ga0495671_0212909 3300046692 Bacteria 936
183 Ga0495660_0000005 3300046810 Bacteria 574567
184 Ga0495672_0042493 3300047320 Unclassified 2741
185 Ga0495686_0008987 3300047472 Bacteria 7253
186 Ga0496100_0006351 3300048903 Bacteria 6440
187 Ga0496101_0253242 3300048904 Unclassified 1372
188 Ga0496109_0696533 3300048912 Bacteria 953
189 Ga0496110_0114704 3300048913 Bacteria 2424
190 Ga0496115_0000001 3300048918 Bacteria 367230
191 Ga0496124_0030673 3300048927 Bacteria 4768
192 Ga0496124_0077844 3300048927 Bacteria 2734
193 Ga0496125_0574499 3300048928 Unclassified 620
194 Ga0501034_0001066 3300049571 Bacteria 38868
195 nmdc:mga03683_37397_c1 3300050489 Bacteria 1978
196 nmdc:mga00v17_135_c1 3300050491 Bacteria 43281
197 nmdc:mga00v17_23040_c1 3300050491 Bacteria 3299
198 nmdc:mga0yw44_14_c1 3300050492 Bacteria 86738
199 nmdc:mga0yw44_16998_c1 3300050492 Unclassified 3946
200 nmdc:mga0yw44_188857_c1 3300050492 Bacteria 1358
201 nmdc:mga0yw44_378211_c1 3300050492 Unclassified 956
202 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
203 nmdc:mga0yw44_50_c1 3300050492 Bacteria 40560
204 nmdc:mga0k408_2936_c1 3300050493 Bacteria 9037
205 nmdc:mga0k408_343430_c1 3300050493 Bacteria 890
206 nmdc:mga06z11_606_c1 3300050494 Bacteria 13086
207 nmdc:mga04h51_95_c1 3300050495 Bacteria 27162
208 nmdc:mga07m45_17685_c1 3300050496 Bacteria 3835
209 nmdc:mga07m45_318913_c1 3300050496 Bacteria 903
210 nmdc:mga0sz30_10433_c1 3300050516 Bacteria 1752
211 nmdc:mga0sz30_4017_c1 3300050516 Bacteria 5298
212 Ga0500643_011508 3300053087 Bacteria 3225
213 Ga0500646_0000005 3300053090 Bacteria 130895
214 Ga0500646_0006881 3300053090 Bacteria 2896
215 Ga0500583_0000434 3300053092 Bacteria 13222
216 Ga0500583_0011645 3300053092 Bacteria 3325
217 Ga0500651_0000220 3300053093 Bacteria 35794
218 Ga0500641_0000001 3300053096 Bacteria 1115973
219 Ga0500650_0096628 3300053098 Bacteria 1383
220 Ga0500555_000009 3300053103 Bacteria 263998
221 Ga0500569_000001 3300053109 Bacteria 137852
222 Ga0500593_007225 3300053117 Bacteria 4505
223 Ga0500652_000001 3300053131 Bacteria 946868
224 Ga0500577_0000723 3300053142 Bacteria 8452
225 Ga0500577_0011834 3300053142 Unclassified 2617
226 Ga0500577_0018549 3300053142 Bacteria 2239
227 Ga0500588_0000026 3300053146 Bacteria 35169
228 Ga0500616_0000012 3300053153 Bacteria 681798
229 Ga0500616_0016646 3300053153 Bacteria 4181
230 Ga0500620_050160 3300053155 Bacteria 1397
231 Ga0500627_0301743 3300053158 Bacteria 699
232 Ga0500570_000590 3300053724 Bacteria 14514
233 Ga0500570_105962 3300053724 Unclassified 1161
234 Ga0500656_001505 3300053732 Unclassified 2017
235 Ga0500656_005983 3300053732 Bacteria 1220
236 Ga0500613_025571 3300053738 Bacteria 816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0301743 Ga0500627_0301743_64_537 129
2 3300013105 Ga0157369_10000055 Ga0157369_10000055125 137
3 3300001989 JGI24739J22299_10000411 JGI24739J22299_1000041114 145
4 3300001979 JGI24740J21852_10005135 JGI24740J21852_100051353 146
5 3300001991 JGI24743J22301_10003114 JGI24743J22301_100031142 146
6 3300002067 JGI24735J21928_10000023 JGI24735J21928_1000002391 146
7 3300005327 Ga0070658_10000009 Ga0070658_1000000966 146
8 3300005329 Ga0070683_100004861 Ga0070683_1000048616 146
9 3300005339 Ga0070660_100002266 Ga0070660_1000022664 146
10 3300005344 Ga0070661_100024780 Ga0070661_1000247801 146
11 3300005344 Ga0070661_100028736 Ga0070661_1000287364 146
12 3300005366 Ga0070659_100009417 Ga0070659_1000094174 146
13 3300005366 Ga0070659_100033508 Ga0070659_1000335082 146
14 3300005457 Ga0070662_100099206 Ga0070662_1000992062 146
15 3300005457 Ga0070662_100428305 Ga0070662_1004283052 146
16 3300005535 Ga0070684_100400127 Ga0070684_1004001272 146
17 3300006178 Ga0075367_10635997 Ga0075367_106359971 146
18 3300006353 Ga0075370_10149017 Ga0075370_101490172 146
19 3300013102 Ga0157371_10274643 Ga0157371_102746432 146
20 3300025920 Ga0207649_10064364 Ga0207649_100643642 146
21 3300025927 Ga0207687_10271159 Ga0207687_102711592 146
22 3300025932 Ga0207690_10016819 Ga0207690_100168192 146
23 3300025944 Ga0207661_10082413 Ga0207661_100824132 146
24 3300038443 Ga0395901_0020011 Ga0395901_0020011_3560_4024 146
25 3300005563 Ga0068855_100000002 Ga0068855_100000002437 147
26 3300009093 Ga0105240_10505467 Ga0105240_105054673 147
27 3300013104 Ga0157370_10394589 Ga0157370_103945893 147
28 3300025913 Ga0207695_10355724 Ga0207695_103557242 147
29 3300025949 Ga0207667_10000005 Ga0207667_10000005547 147
30 3300044683 Ga0466965_0000311 Ga0466965_0000311_12915_13397 147
31 3300003322 rootL2_10092282 rootL2_1009228210 148
32 3300006051 Ga0075364_10007334 Ga0075364_100073344 148
33 3300042156 Ga0439446_0091031 Ga0439446_0091031_429_899 148
34 3300050491 nmdc:mga00v17_23040_c1 nmdc:mga00v17_23040_c1_1052_1531 148
35 3300005438 Ga0070701_10492247 Ga0070701_104922471 151
36 3300003323 rootH1_10211370 rootH1_102113702 152
37 3300006038 Ga0075365_10083943 Ga0075365_100839432 152
38 3300009987 Ga0105030_104224 Ga0105030_1042242 152
39 3300010375 Ga0105239_10024756 Ga0105239_100247562 152
40 3300013102 Ga0157371_10006351 Ga0157371_100063519 152
41 3300013874 Ga0157514_111118 Ga0157514_1111182 152
42 3300031507 Ga0307509_10018891 Ga0307509_100188916 152
43 3300046692 Ga0495671_0212909 Ga0495671_0212909_120_611 152
44 3300047320 Ga0495672_0042493 Ga0495672_0042493_997_1548 152
45 3300053093 Ga0500651_0000220 Ga0500651_0000220_27472_27963 152
46 3300053142 Ga0500577_0000723 Ga0500577_0000723_5339_5842 152
47 3300053732 Ga0500656_005983 Ga0500656_005983_353_844 152
48 3300005614 Ga0068856_101192490 Ga0068856_1011924901 153
49 3300005616 Ga0068852_100313773 Ga0068852_1003137733 153
50 3300006195 Ga0075366_10059250 Ga0075366_100592502 153
51 3300009174 Ga0105241_10226517 Ga0105241_102265172 153
52 3300009979 Ga0105032_100826 Ga0105032_1008262 153
53 3300009993 Ga0105028_100189 Ga0105028_1001893 153
54 3300026142 Ga0207698_10219320 Ga0207698_102193202 153
55 3300050493 nmdc:mga0k408_2936_c1 nmdc:mga0k408_2936_c1_7686_8147 153
56 3300001979 JGI24740J21852_10011395 JGI24740J21852_100113954 154
57 3300001989 JGI24739J22299_10006909 JGI24739J22299_100069093 154
58 3300003320 rootH2_10006821 rootH2_1000682176 154
59 3300003323 rootH1_10153185 rootH1_1015318515 154
60 3300005339 Ga0070660_100000088 Ga0070660_10000008862 154
61 3300005344 Ga0070661_100532177 Ga0070661_1005321772 154
62 3300005535 Ga0070684_100040472 Ga0070684_1000404722 154
63 3300005563 Ga0068855_100267250 Ga0068855_1002672502 154
64 3300005564 Ga0070664_101064538 Ga0070664_1010645381 154
65 3300005577 Ga0068857_100122912 Ga0068857_1001229123 154
66 3300005578 Ga0068854_100009450 Ga0068854_1000094502 154
67 3300005614 Ga0068856_100000029 Ga0068856_100000029140 154
68 3300005614 Ga0068856_100000122 Ga0068856_10000012297 154
69 3300005616 Ga0068852_100000001 Ga0068852_100000001290 154
70 3300005616 Ga0068852_100000011 Ga0068852_10000001191 154
71 3300005937 Ga0081455_10000001 Ga0081455_10000001567 154
72 3300006038 Ga0075365_10000018 Ga0075365_1000001848 154
73 3300006038 Ga0075365_10000209 Ga0075365_100002096 154
74 3300006038 Ga0075365_10318701 Ga0075365_103187011 154
75 3300006042 Ga0075368_10000100 Ga0075368_100001007 154
76 3300006048 Ga0075363_100041498 Ga0075363_1000414982 154
77 3300006051 Ga0075364_10000268 Ga0075364_100002684 154
78 3300006177 Ga0075362_10057185 Ga0075362_100571852 154
79 3300006178 Ga0075367_10000237 Ga0075367_100002374 154
80 3300006186 Ga0075369_10005010 Ga0075369_100050106 154
81 3300006186 Ga0075369_10145707 Ga0075369_101457072 154
82 3300006237 Ga0097621_100083688 Ga0097621_1000836882 154
83 3300006353 Ga0075370_10015264 Ga0075370_100152643 154
84 3300006353 Ga0075370_10278841 Ga0075370_102788412 154
85 3300006353 Ga0075370_10738695 Ga0075370_107386951 154
86 3300006358 Ga0068871_100010629 Ga0068871_1000106295 154
87 3300006844 Ga0075428_100001648 Ga0075428_10000164817 154
88 3300009093 Ga0105240_10000030 Ga0105240_1000003096 154
89 3300009174 Ga0105241_10008645 Ga0105241_100086451 154
90 3300009174 Ga0105241_10040160 Ga0105241_100401602 154
91 3300009545 Ga0105237_10000001 Ga0105237_10000001281 154
92 3300009545 Ga0105237_10000002 Ga0105237_10000002188 154
93 3300009551 Ga0105238_10012106 Ga0105238_100121067 154
94 3300009551 Ga0105238_10126666 Ga0105238_101266664 154
95 3300009551 Ga0105238_10236491 Ga0105238_102364913 154
96 3300009979 Ga0105032_100013 Ga0105032_1000137 154
97 3300009984 Ga0105029_100335 Ga0105029_1003351 154
98 3300010375 Ga0105239_10001870 Ga0105239_1000187022 154
99 3300011119 Ga0105246_10001002 Ga0105246_1000100222 154
100 3300013100 Ga0157373_10014415 Ga0157373_100144158 154
101 3300013102 Ga0157371_10208816 Ga0157371_102088161 154
102 3300013104 Ga0157370_10001378 Ga0157370_1000137836 154
103 3300013104 Ga0157370_10001976 Ga0157370_1000197622 154
104 3300013105 Ga0157369_10000003 Ga0157369_10000003275 154
105 3300013105 Ga0157369_10000026 Ga0157369_10000026111 154
106 3300013105 Ga0157369_10013283 Ga0157369_100132833 154
107 3300013105 Ga0157369_10050740 Ga0157369_100507403 154
108 3300013296 Ga0157374_10963852 Ga0157374_109638521 154
109 3300013307 Ga0157372_10000007 Ga0157372_10000007280 154
110 3300013307 Ga0157372_10000106 Ga0157372_100001065 154
111 3300013307 Ga0157372_10348361 Ga0157372_103483614 154
112 3300014325 Ga0163163_10911620 Ga0163163_109116201 154
113 3300014969 Ga0157376_10000085 Ga0157376_1000008536 154
114 3300025911 Ga0207654_10020630 Ga0207654_100206302 154
115 3300025911 Ga0207654_10475385 Ga0207654_104753852 154
116 3300025913 Ga0207695_10000009 Ga0207695_10000009283 154
117 3300025914 Ga0207671_10000003 Ga0207671_10000003283 154
118 3300025914 Ga0207671_10000008 Ga0207671_10000008289 154
119 3300025919 Ga0207657_10001595 Ga0207657_1000159519 154
120 3300025920 Ga0207649_10469048 Ga0207649_104690481 154
121 3300025924 Ga0207694_10007438 Ga0207694_100074384 154
122 3300025924 Ga0207694_10320504 Ga0207694_103205041 154
123 3300025945 Ga0207679_10987866 Ga0207679_109878661 154
124 3300025949 Ga0207667_10020403 Ga0207667_100204036 154
125 3300025981 Ga0207640_10022352 Ga0207640_100223522 154
126 3300026078 Ga0207702_10000051 Ga0207702_1000005195 154
127 3300026078 Ga0207702_10000431 Ga0207702_1000043152 154
128 3300026116 Ga0207674_10000032 Ga0207674_1000003294 154
129 3300026116 Ga0207674_10168400 Ga0207674_101684002 154
130 3300026142 Ga0207698_10000001 Ga0207698_10000001242 154
131 3300026142 Ga0207698_10000024 Ga0207698_1000002481 154
132 3300027866 Ga0209813_10007594 Ga0209813_100075942 154
133 3300030731 Ga0316177_1181856 Ga0316177_11818561 154
134 3300030733 Ga0314311_1008008 Ga0314311_10080081 154
135 3300030733 Ga0314311_1189512 Ga0314311_11895124 154
136 3300030734 Ga0316179_1002117 Ga0316179_100211721 154
137 3300030742 Ga0316183_1074109 Ga0316183_10741099 154
138 3300030742 Ga0316183_1080520 Ga0316183_10805203 154
139 3300030742 Ga0316183_1209931 Ga0316183_12099313 154
140 3300030744 Ga0316181_1087109 Ga0316181_10871092 154
141 3300030744 Ga0316181_1116978 Ga0316181_111697850 154
142 3300030744 Ga0316181_1128173 Ga0316181_11281732 154
143 3300030745 Ga0316182_1020791 Ga0316182_102079143 154
144 3300030745 Ga0316182_1168577 Ga0316182_116857719 154
145 3300030745 Ga0316182_1383541 Ga0316182_13835412 154
146 3300031730 Ga0307516_10011168 Ga0307516_100111685 154
147 3300031901 Ga0307406_10110872 Ga0307406_101108722 154
148 3300031911 Ga0307412_10051935 Ga0307412_100519352 154
149 3300037312 Ga0395899_0050164 Ga0395899_0050164_915_1379 154
150 3300037312 Ga0395899_0269359 Ga0395899_0269359_626_1090 154
151 3300037418 Ga0395900_0000001 Ga0395900_0000001_438768_439232 154
152 3300037466 Ga0395898_0000002 Ga0395898_0000002_666774_667238 154
153 3300038443 Ga0395901_0000006 Ga0395901_0000006_312450_312914 154
154 3300038443 Ga0395901_0201651 Ga0395901_0201651_344_808 154
155 3300038443 Ga0395901_0876332 Ga0395901_0876332_206_673 154
156 3300041405 Ga0439438_018227 Ga0439438_018227_310_777 154
157 3300041407 Ga0439447_007022 Ga0439447_007022_2171_2638 154
158 3300041410 Ga0439461_0003819 Ga0439461_0003819_505_972 154
159 3300041410 Ga0439461_0005787 Ga0439461_0005787_565_1032 154
160 3300041411 Ga0439466_0046056 Ga0439466_0046056_722_1189 154
161 3300041997 Ga0439431_0009386 Ga0439431_0009386_647_1114 154
162 3300042002 Ga0439442_067639 Ga0439442_067639_31_498 154
163 3300042006 Ga0439432_020994 Ga0439432_020994_769_1233 154
164 3300042007 Ga0439449_0135850 Ga0439449_0135850_88_555 154
165 3300042010 Ga0439452_016365 Ga0439452_016365_1055_1522 154
166 3300042115 Ga0450911_024256 Ga0450911_024256_156_620 154
167 3300042122 Ga0450920_001004 Ga0450920_001004_4102_4566 154
168 3300042145 Ga0450906_004714 Ga0450906_004714_1353_1817 154
169 3300042156 Ga0439446_0000421 Ga0439446_0000421_7412_7876 154
170 3300042156 Ga0439446_0003833 Ga0439446_0003833_1201_1668 154
171 3300042435 Ga0439434_0001626 Ga0439434_0001626_3983_4450 154
172 3300042435 Ga0439434_0027477 Ga0439434_0027477_114_578 154
173 3300042435 Ga0439434_0134568 Ga0439434_0134568_87_551 154
174 3300042531 Ga0450918_016100 Ga0450918_016100_783_1247 154
175 3300042531 Ga0450918_025507 Ga0450918_025507_302_769 154
176 3300044712 Ga0453684_0740538 Ga0453684_0740538_107_574 154
177 3300045051 Ga0451576_0180773 Ga0451576_0180773_383_850 154
178 3300046460 Ga0495638_0000061 Ga0495638_0000061_21425_21889 154
179 3300046460 Ga0495638_0000167 Ga0495638_0000167_18822_19301 154
180 3300046542 Ga0495597_0097833 Ga0495597_0097833_435_899 154
181 3300048927 Ga0496124_0030673 Ga0496124_0030673_3517_3981 154
182 3300048928 Ga0496125_0574499 Ga0496125_0574499_138_602 154
183 3300049571 Ga0501034_0001066 Ga0501034_0001066_11866_12366 154
184 3300050489 nmdc:mga03683_37397_c1 nmdc:mga03683_37397_c1_1195_1662 154
185 3300050491 nmdc:mga00v17_135_c1 nmdc:mga00v17_135_c1_32565_33032 154
186 3300050492 nmdc:mga0yw44_14_c1 nmdc:mga0yw44_14_c1_29306_29770 154
187 3300050492 nmdc:mga0yw44_188857_c1 nmdc:mga0yw44_188857_c1_625_1092 154
188 3300050492 nmdc:mga0yw44_378211_c1 nmdc:mga0yw44_378211_c1_382_852 154
189 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_88878_89345 154
190 3300050492 nmdc:mga0yw44_50_c1 nmdc:mga0yw44_50_c1_17066_17533 154
191 3300050493 nmdc:mga0k408_343430_c1 nmdc:mga0k408_343430_c1_86_553 154
192 3300050494 nmdc:mga06z11_606_c1 nmdc:mga06z11_606_c1_7899_8366 154
193 3300050495 nmdc:mga04h51_95_c1 nmdc:mga04h51_95_c1_17936_18403 154
194 3300050496 nmdc:mga07m45_17685_c1 nmdc:mga07m45_17685_c1_1446_1913 154
195 3300050496 nmdc:mga07m45_318913_c1 nmdc:mga07m45_318913_c1_211_678 154
196 3300050516 nmdc:mga0sz30_10433_c1 nmdc:mga0sz30_10433_c1_498_965 154
197 3300050516 nmdc:mga0sz30_4017_c1 nmdc:mga0sz30_4017_c1_3017_3484 154
198 3300053090 Ga0500646_0006881 Ga0500646_0006881_1750_2217 154
199 3300053092 Ga0500583_0011645 Ga0500583_0011645_2700_3167 154
200 3300053103 Ga0500555_000009 Ga0500555_000009_19024_19488 154
201 3300053109 Ga0500569_000001 Ga0500569_000001_21426_21890 154
202 3300053117 Ga0500593_007225 Ga0500593_007225_2686_3153 154
203 3300053142 Ga0500577_0011834 Ga0500577_0011834_1462_1926 154
204 3300053142 Ga0500577_0018549 Ga0500577_0018549_1249_1713 154
205 3300053146 Ga0500588_0000026 Ga0500588_0000026_30646_31110 154
206 3300053153 Ga0500616_0000012 Ga0500616_0000012_172028_172492 154
207 3300053153 Ga0500616_0016646 Ga0500616_0016646_1353_1820 154
208 3300053155 Ga0500620_050160 Ga0500620_050160_691_1155 154
209 3300053724 Ga0500570_105962 Ga0500570_105962_226_690 154
210 3300053732 Ga0500656_001505 Ga0500656_001505_891_1355 154
211 3300053738 Ga0500613_025571 Ga0500613_025571_255_722 154
212 3300003316 rootH1_10035926 rootH1_1003592620 155
213 3300009979 Ga0105032_100002 Ga0105032_10000264 155
214 3300009993 Ga0105028_100032 Ga0105028_1000329 155
215 3300053087 Ga0500643_011508 Ga0500643_011508_1535_2002 155
216 3300053724 Ga0500570_000590 Ga0500570_000590_2320_2787 155
217 3300006353 Ga0075370_10171544 Ga0075370_101715442 156
218 3300047472 Ga0495686_0008987 Ga0495686_0008987_1144_1632 156
219 3300048912 Ga0496109_0696533 Ga0496109_0696533_37_555 156
220 3300050492 nmdc:mga0yw44_16998_c1 nmdc:mga0yw44_16998_c1_601_1071 156
221 3300010375 Ga0105239_11383310 Ga0105239_113833102 157
222 3300042138 Ga0450903_016170 Ga0450903_016170_522_995 157
223 3300046810 Ga0495660_0000005 Ga0495660_0000005_380034_380528 157
224 3300048903 Ga0496100_0006351 Ga0496100_0006351_4516_4995 157
225 3300048918 Ga0496115_0000001 Ga0496115_0000001_105318_105803 157
226 3300053090 Ga0500646_0000005 Ga0500646_0000005_20646_21140 157
227 3300053092 Ga0500583_0000434 Ga0500583_0000434_6447_6941 157
228 3300053096 Ga0500641_0000001 Ga0500641_0000001_962047_962541 157
229 3300053098 Ga0500650_0096628 Ga0500650_0096628_669_1163 157
230 3300053131 Ga0500652_000001 Ga0500652_000001_532025_532519 157
231 3300048904 Ga0496101_0253242 Ga0496101_0253242_141_659 158
232 3300048913 Ga0496110_0114704 Ga0496110_0114704_344_862 158
233 3300048927 Ga0496124_0077844 Ga0496124_0077844_2189_2707 158
234 2162886012 MBSR1b_contig_978302 MBSR1b_0023.00002650 159
235 3300025986 Ga0207658_11926875 Ga0207658_119268751 159
236 3300030742 Ga0316183_1195954 Ga0316183_11959542 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

1

146

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zrw-assembly1.cif.gz_B the structure of the dimeric hamp-dhp fusion a291v mutant 0.7532 39 99
1dkg-assembly1.cif.gz_A crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak 0.689 4 156
4biz-assembly2.cif.gz_D crystal structure of cpxahdc (orthorhombic form 2) 0.6872 47 107
4biu-assembly2.cif.gz_B crystal structure of cpxahdc (orthorhombic form 1) 0.6844 46 107
1dkg-assembly1.cif.gz_B crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak 0.6701 9 159
ID Description Score Start End Superfamily
af_A0A2R8Q947_132_311_1.20.1050.20 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain 0.8618 50 99 1.20.1050.20
af_Q14765_135_314_1.20.1050.20 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain 0.8562 50 99 1.20.1050.20
af_P9WMT5_133_191_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.8531 103 156 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.8466 102 157 2.30.22.10
af_A0A1D6EAQ0_210_272_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.8452 102 156 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A1M3BS55-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9927 9 159 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A6M5FBU4-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9866 12 159 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A660M966-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9859 9 159 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A4Q3MGY2-F1-model_v4 deleted 0.9837 9 159
AF-A0A857V9Z4-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9812 12 159 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Feature Viewer

pLDDT pTM Quality
88.71 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map