F349130

General Info

Members Datasets Scaffolds Average Seq Length
236 174 472 100

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10520293|Ga0224712_105202932
Length 98
Sequence MRPIHIARLDKVRPVLILTRELVRPHLTTVTIAPITTIRGLSTEVPVNAANGLAGPSVVSCDNVTTIPTTALGEQIGVLLGHQEQTLSDAISAAFDLD

Samples

Sample ID Description Type Environment
1 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
171 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
172 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 2.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 5.51
Rhizosphere 87.29
Stem 0
Stem Tuber 0
Unclassified 13.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224712_10520293 3300022467 Bacteria 576
2 JGI25405J52794_10032101 3300003911 Bacteria 1093
3 Ga0068869_100400346 3300005334 Bacteria 1129
4 Ga0070689_100747038 3300005340 Bacteria 857
5 Ga0070661_100518264 3300005344 Unclassified 956
6 Ga0070675_100186526 3300005354 Bacteria 1795
7 Ga0070674_100133692 3300005356 Bacteria 1853
8 Ga0070688_100250927 3300005365 Bacteria 1260
9 Ga0070709_10485443 3300005434 Unclassified 936
10 Ga0070714_100000171 3300005435 Bacteria 52666
11 Ga0070714_100113386 3300005435 Bacteria 2404
12 Ga0070714_100315320 3300005435 Bacteria 1461
13 Ga0070714_100823229 3300005435 Bacteria 900
14 Ga0070713_100447358 3300005436 Bacteria 1213
15 Ga0070710_10000003 3300005437 Bacteria 277772
16 Ga0070710_10062797 3300005437 Bacteria 2120
17 Ga0070711_100067076 3300005439 Bacteria 2516
18 Ga0070708_100008527 3300005445 Bacteria 8235
19 Ga0070708_100111882 3300005445 Bacteria 2510
20 Ga0068867_100456372 3300005459 Bacteria 1090
21 Ga0070685_10373618 3300005466 Bacteria 980
22 Ga0070706_100006823 3300005467 Bacteria 10779
23 Ga0070706_100184429 3300005467 Bacteria 1949
24 Ga0070707_100005629 3300005468 Bacteria 11708
25 Ga0070698_100047387 3300005471 Bacteria 4394
26 Ga0070684_100896337 3300005535 Bacteria 831
27 Ga0070684_100973393 3300005535 Unclassified 796
28 Ga0070704_100823054 3300005549 Bacteria 831
29 Ga0068857_100379379 3300005577 Unclassified 1313
30 Ga0068856_100334640 3300005614 Unclassified 1532
31 Ga0068856_101104696 3300005614 Bacteria 810
32 Ga0068852_102433288 3300005616 Bacteria 544
33 Ga0068859_100027844 3300005617 Bacteria 5668
34 Ga0068859_100577553 3300005617 Bacteria 1218
35 Ga0068864_100032601 3300005618 Bacteria 4427
36 Ga0068864_100890525 3300005618 Bacteria 878
37 Ga0068870_10931970 3300005840 Bacteria 615
38 Ga0068863_100156561 3300005841 Unclassified 2181
39 Ga0068863_101591126 3300005841 Bacteria 662
40 Ga0068860_101529004 3300005843 Bacteria 689
41 Ga0068862_100253947 3300005844 Bacteria 1603
42 Ga0081455_10000126 3300005937 Bacteria 88702
43 Ga0081540_1005923 3300005983 Bacteria 9023
44 Ga0081540_1103659 3300005983 Bacteria 1219
45 Ga0081540_1240923 3300005983 Bacteria 634
46 Ga0070717_10000005 3300006028 Bacteria 357819
47 Ga0075363_100489766 3300006048 Bacteria 729
48 Ga0075428_100005123 3300006844 Bacteria 14564
49 Ga0075428_100026194 3300006844 Bacteria 6457
50 Ga0075430_100001516 3300006846 Bacteria 18950
51 Ga0075430_100001738 3300006846 Bacteria 17797
52 Ga0075430_100002259 3300006846 Bacteria 15963
53 Ga0075431_100002814 3300006847 Bacteria 16835
54 Ga0075431_100050313 3300006847 Bacteria 4297
55 Ga0075429_100003015 3300006880 Bacteria 14277
56 Ga0075429_100093586 3300006880 Bacteria 2621
57 Ga0097620_100027844 3300006931 Bacteria 5668
58 Ga0097620_100577481 3300006931 Bacteria 1218
59 Ga0105240_10128459 3300009093 Bacteria 3043
60 Ga0105247_10041315 3300009101 Bacteria 2822
61 Ga0114129_10005409 3300009147 Bacteria 18033
62 Ga0114129_10013849 3300009147 Bacteria 11489
63 Ga0114129_10294762 3300009147 Bacteria 2164
64 Ga0114129_12380967 3300009147 Bacteria 634
65 Ga0105248_10038713 3300009177 Bacteria 5338
66 Ga0105237_10420518 3300009545 Unclassified 1342
67 Ga0105249_10866870 3300009553 Bacteria 969
68 Ga0105239_10092118 3300010375 Bacteria 3345
69 Ga0105239_10303551 3300010375 Bacteria 1798
70 Ga0105239_13040338 3300010375 Bacteria 547
71 Ga0105246_10002524 3300011119 Bacteria 11065
72 Ga0163163_10003396 3300014325 Bacteria 13523
73 Ga0163163_10606191 3300014325 Bacteria 1158
74 Ga0163163_12682402 3300014325 Bacteria 555
75 Ga0157377_11031534 3300014745 Bacteria 625
76 Ga0157377_11469784 3300014745 Bacteria 540
77 Ga0157379_10491725 3300014968 Unclassified 1136
78 Ga0157376_10190226 3300014969 Bacteria 1882
79 Ga0206349_1373827 3300020075 Bacteria 1556
80 Ga0213876_10006054 3300021384 Bacteria 6612
81 Ga0224712_10317710 3300022467 Bacteria 731
82 Ga0207692_10000016 3300025898 Bacteria 86771
83 Ga0207710_10000072 3300025900 Bacteria 150638
84 Ga0207684_10171307 3300025910 Bacteria 1871
85 Ga0207695_10197560 3300025913 Bacteria 1927
86 Ga0207663_10058504 3300025916 Bacteria 2433
87 Ga0207646_10062362 3300025922 Bacteria 3328
88 Ga0207659_10246394 3300025926 Bacteria 1448
89 Ga0207700_10380105 3300025928 Bacteria 1235
90 Ga0207664_10000004 3300025929 Bacteria 493014
91 Ga0207664_10089636 3300025929 Bacteria 2519
92 Ga0207664_11036472 3300025929 Bacteria 735
93 Ga0207670_10054103 3300025936 Bacteria 2707
94 Ga0207711_10642386 3300025941 Unclassified 990
95 Ga0207661_10001766 3300025944 Bacteria 14792
96 Ga0207661_10216321 3300025944 Bacteria 1691
97 Ga0207712_10235024 3300025961 Bacteria 1473
98 Ga0207677_12169696 3300026023 Unclassified 517
99 Ga0207702_10841553 3300026078 Unclassified 908
100 Ga0207702_10898251 3300026078 Bacteria 878
101 Ga0207702_10948262 3300026078 Unclassified 853
102 Ga0207641_10896644 3300026088 Unclassified 880
103 Ga0207641_11515429 3300026088 Unclassified 672
104 Ga0207648_10302181 3300026089 Bacteria 1435
105 Ga0207676_10189540 3300026095 Bacteria 1808
106 Ga0207676_10684770 3300026095 Bacteria 992
107 Ga0207674_10112137 3300026116 Unclassified 2701
108 Ga0207675_101882813 3300026118 Bacteria 617
109 Ga0268265_10087510 3300028380 Bacteria 2479
110 Ga0265326_10000006 3300028558 Bacteria 233392
111 Ga0265326_10017048 3300028558 Bacteria 2098
112 Ga0265319_1000622 3300028563 Bacteria 23344
113 Ga0265334_10330324 3300028573 Bacteria 521
114 Ga0265318_10126234 3300028577 Bacteria 941
115 Ga0265338_10000961 3300028800 Bacteria 48623
116 Ga0265338_10042139 3300028800 Bacteria 4257
117 Ga0265338_10214977 3300028800 Bacteria 1440
118 Ga0265324_10002560 3300029957 Bacteria 9186
119 Ga0307511_10393303 3300030521 Bacteria 573
120 Ga0265327_10181770 3300031251 Bacteria 961
121 Ga0307408_102205459 3300031548 Bacteria 532
122 Ga0307508_10077552 3300031616 Bacteria 2902
123 Ga0307412_10696246 3300031911 Bacteria 872
124 Ga0307409_101148870 3300031995 Bacteria 799
125 Ga0307409_102319671 3300031995 Bacteria 566
126 Ga0307416_100835356 3300032002 Bacteria 1019
127 Ga0307416_102351253 3300032002 Bacteria 633
128 Ga0307510_10164958 3300033180 Bacteria 1805
129 Ga0373935_0384985 3300035692 Bacteria 1005
130 Ga0372808_004315 3300036459 Bacteria 1807
131 Ga0395900_0119747 3300037418 Bacteria 2702
132 Ga0436364_1031756 3300037853 Bacteria 1056
133 Ga0395901_0157012 3300038443 Bacteria 2389
134 Ga0436365_1083994 3300039437 Bacteria 225582
135 Ga0436360_1115329 3300039438 Unclassified 785
136 Ga0451797_0180343 3300041453 Bacteria 660
137 Ga0451795_0867361 3300041456 Bacteria 658
138 Ga0451807_0450893 3300041486 Bacteria 612
139 Ga0451843_0871014 3300041509 Unclassified 901
140 Ga0466965_0646252 3300044683 Bacteria 604
141 Ga0466963_0021084 3300044694 Bacteria 4106
142 Ga0466963_1059660 3300044694 Bacteria 570
143 Ga0466963_1305070 3300044694 Bacteria 509
144 Ga0466960_0214997 3300044901 Bacteria 1056
145 Ga0466960_0273924 3300044901 Bacteria 944
146 Ga0466960_1008094 3300044901 Unclassified 512
147 Ga0466967_0013978 3300045976 Bacteria 6231
148 Ga0466967_0021069 3300045976 Bacteria 5282
149 Ga0466967_1960428 3300045976 Bacteria 582
150 Ga0495590_0364226 3300046457 Unclassified 551
151 Ga0495629_0075832 3300046459 Bacteria 2348
152 Ga0495639_0101647 3300046475 Bacteria 1358
153 Ga0495662_0028078 3300046476 Bacteria 2716
154 Ga0495583_0170565 3300046506 Bacteria 894
155 Ga0495608_0068063 3300046511 Bacteria 2329
156 Ga0495630_0200160 3300046517 Bacteria 1524
157 Ga0495665_0402043 3300046531 Bacteria 695
158 Ga0495587_0019811 3300046536 Bacteria 4159
159 Ga0495598_0001716 3300046537 Bacteria 4392
160 Ga0495645_0000159 3300046543 Bacteria 46648
161 Ga0495634_0000729 3300046642 Bacteria 31881
162 Ga0495588_0088945 3300046674 Bacteria 1617
163 Ga0495613_0003304 3300046689 Bacteria 12069
164 Ga0495649_0150266 3300046694 Bacteria 1224
165 Ga0495649_0399518 3300046694 Unclassified 690
166 Ga0495581_0286130 3300047315 Unclassified 964
167 Ga0495676_0392488 3300047321 Bacteria 922
168 Ga0495684_1001172 3300047471 Unclassified 531
169 Ga0495602_0109599 3300048088 Bacteria 2246
170 Ga0495626_0088288 3300048091 Bacteria 1367
171 Ga0496100_0547690 3300048903 Bacteria 895
172 Ga0496104_0071753 3300048907 Bacteria 3292
173 Ga0496105_0084548 3300048908 Unclassified 2621
174 Ga0496108_1128717 3300048911 Bacteria 665
175 Ga0496108_1392031 3300048911 Unclassified 587
176 Ga0496111_0227650 3300048914 Unclassified 1385
177 Ga0496112_0007863 3300048915 Bacteria 9495
178 Ga0496113_0021833 3300048916 Bacteria 4519
179 Ga0496113_0035771 3300048916 Bacteria 3634
180 Ga0496114_0001129 3300048917 Bacteria 20185
181 Ga0496117_0067631 3300048920 Bacteria 2416
182 Ga0496118_0134604 3300048921 Bacteria 1579
183 Ga0496119_0018348 3300048922 Bacteria 5215
184 Ga0496122_0001560 3300048925 Bacteria 36253
185 Ga0496125_0000066 3300048928 Bacteria 249043
186 Ga0496126_0111883 3300048929 Bacteria 2378
187 Ga0501032_0097049 3300049569 Bacteria 1953
188 Ga0501033_0214635 3300049570 Bacteria 1371
189 Ga0501034_0146027 3300049571 Bacteria 2342
190 Ga0501036_0169190 3300049572 Bacteria 1841
191 Ga0501037_1055388 3300049573 Bacteria 527
192 Ga0501038_0160922 3300049574 Bacteria 1824
193 Ga0501039_0252694 3300049575 Unclassified 1386
194 Ga0501042_0172241 3300049578 Bacteria 1562
195 Ga0501043_0296905 3300049579 Bacteria 1236
196 Ga0501046_0086574 3300049580 Bacteria 2415
197 Ga0501047_1073149 3300049581 Bacteria 618
198 Ga0501048_0339737 3300049582 Bacteria 1070
199 Ga0501067_0376858 3300049583 Bacteria 791
200 Ga0501068_0156753 3300049584 Bacteria 1434
201 Ga0501069_0210547 3300049585 Bacteria 1128
202 Ga0501069_0627071 3300049585 Unclassified 646
203 Ga0501070_0288942 3300049586 Bacteria 1336
204 Ga0501072_0222923 3300049588 Bacteria 1503
205 Ga0501073_0065276 3300049589 Unclassified 2538
206 Ga0501074_0107185 3300049590 Bacteria 2000
207 Ga0501074_0995122 3300049590 Bacteria 589
208 Ga0501076_0003451 3300049592 Bacteria 11090
209 Ga0501079_0575338 3300049741 Bacteria 886
210 Ga0501080_0112668 3300049742 Bacteria 2522
211 Ga0501080_0539840 3300049742 Bacteria 1039
212 Ga0501080_1807328 3300049742 Unclassified 513
213 Ga0501083_0029112 3300049744 Bacteria 3802
214 Ga0501083_0771527 3300049744 Unclassified 625
215 Ga0501035_0236969 3300049822 Unclassified 1553
216 Ga0501044_0018280 3300049823 Bacteria 7513
217 Ga0501044_0589559 3300049823 Bacteria 1005
218 Ga0501045_0377878 3300049824 Unclassified 1055
219 Ga0501045_0938584 3300049824 Bacteria 635
220 nmdc:mga05p37_109029_c1 3300050507 Bacteria 3406
221 nmdc:mga05p37_5508_c1 3300050507 Bacteria 14870
222 nmdc:mga09592_20965_c1 3300050508 Bacteria 5381
223 nmdc:mga09592_233702_c1 3300050508 Bacteria 1593
224 nmdc:mga09592_38453_c1 3300050508 Bacteria 4017
225 nmdc:mga0qj67_25286_c1 3300050509 Bacteria 4587
226 nmdc:mga0qj67_27191_c1 3300050509 Bacteria 4431
227 nmdc:mga0qj67_797_c1 3300050509 Bacteria 21472
228 nmdc:mga06r32_2991_c1 3300050510 Bacteria 15132
229 nmdc:mga06r32_628100_c1 3300050510 Bacteria 1044
230 Ga0495601_0000028 3300053077 Bacteria 112630
231 Ga0495612_0092355 3300053078 Bacteria 1283
232 Ga0500556_0016725 3300053104 Bacteria 2286
233 Ga0500599_001020 3300053736 Bacteria 3150
234 Ga0587114_093859 3300059655 Bacteria 576
235 Ga0501082_0981647 3300060353 Bacteria 738
236 Ga0466962_0436207 3300061719 Bacteria 659
237 Ga0224712_10520293
238 JGI25405J52794_10032101
239 Ga0068869_100400346
240 Ga0070689_100747038
241 Ga0070661_100518264
242 Ga0070675_100186526
243 Ga0070674_100133692
244 Ga0070688_100250927
245 Ga0070709_10485443
246 Ga0070714_100000171
247 Ga0070714_100113386
248 Ga0070714_100315320
249 Ga0070714_100823229
250 Ga0070713_100447358
251 Ga0070710_10000003
252 Ga0070710_10062797
253 Ga0070711_100067076
254 Ga0070708_100008527
255 Ga0070708_100111882
256 Ga0068867_100456372
257 Ga0070685_10373618
258 Ga0070706_100006823
259 Ga0070706_100184429
260 Ga0070707_100005629
261 Ga0070698_100047387
262 Ga0070684_100896337
263 Ga0070684_100973393
264 Ga0070704_100823054
265 Ga0068857_100379379
266 Ga0068856_100334640
267 Ga0068856_101104696
268 Ga0068852_102433288
269 Ga0068859_100027844
270 Ga0068859_100577553
271 Ga0068864_100032601
272 Ga0068864_100890525
273 Ga0068870_10931970
274 Ga0068863_100156561
275 Ga0068863_101591126
276 Ga0068860_101529004
277 Ga0068862_100253947
278 Ga0081455_10000126
279 Ga0081540_1005923
280 Ga0081540_1103659
281 Ga0081540_1240923
282 Ga0070717_10000005
283 Ga0075363_100489766
284 Ga0075428_100005123
285 Ga0075428_100026194
286 Ga0075430_100001516
287 Ga0075430_100001738
288 Ga0075430_100002259
289 Ga0075431_100002814
290 Ga0075431_100050313
291 Ga0075429_100003015
292 Ga0075429_100093586
293 Ga0097620_100027844
294 Ga0097620_100577481
295 Ga0105240_10128459
296 Ga0105247_10041315
297 Ga0114129_10005409
298 Ga0114129_10013849
299 Ga0114129_10294762
300 Ga0114129_12380967
301 Ga0105248_10038713
302 Ga0105237_10420518
303 Ga0105249_10866870
304 Ga0105239_10092118
305 Ga0105239_10303551
306 Ga0105239_13040338
307 Ga0105246_10002524
308 Ga0163163_10003396
309 Ga0163163_10606191
310 Ga0163163_12682402
311 Ga0157377_11031534
312 Ga0157377_11469784
313 Ga0157379_10491725
314 Ga0157376_10190226
315 Ga0206349_1373827
316 Ga0213876_10006054
317 Ga0224712_10317710
318 Ga0207692_10000016
319 Ga0207710_10000072
320 Ga0207684_10171307
321 Ga0207695_10197560
322 Ga0207663_10058504
323 Ga0207646_10062362
324 Ga0207659_10246394
325 Ga0207700_10380105
326 Ga0207664_10000004
327 Ga0207664_10089636
328 Ga0207664_11036472
329 Ga0207670_10054103
330 Ga0207711_10642386
331 Ga0207661_10001766
332 Ga0207661_10216321
333 Ga0207712_10235024
334 Ga0207677_12169696
335 Ga0207702_10841553
336 Ga0207702_10898251
337 Ga0207702_10948262
338 Ga0207641_10896644
339 Ga0207641_11515429
340 Ga0207648_10302181
341 Ga0207676_10189540
342 Ga0207676_10684770
343 Ga0207674_10112137
344 Ga0207675_101882813
345 Ga0268265_10087510
346 Ga0265326_10000006
347 Ga0265326_10017048
348 Ga0265319_1000622
349 Ga0265334_10330324
350 Ga0265318_10126234
351 Ga0265338_10000961
352 Ga0265338_10042139
353 Ga0265338_10214977
354 Ga0265324_10002560
355 Ga0307511_10393303
356 Ga0265327_10181770
357 Ga0307408_102205459
358 Ga0307508_10077552
359 Ga0307412_10696246
360 Ga0307409_101148870
361 Ga0307409_102319671
362 Ga0307416_100835356
363 Ga0307416_102351253
364 Ga0307510_10164958
365 Ga0373935_0384985
366 Ga0372808_004315
367 Ga0395900_0119747
368 Ga0436364_1031756
369 Ga0395901_0157012
370 Ga0436365_1083994
371 Ga0436360_1115329
372 Ga0451797_0180343
373 Ga0451795_0867361
374 Ga0451807_0450893
375 Ga0451843_0871014
376 Ga0466965_0646252
377 Ga0466963_0021084
378 Ga0466963_1059660
379 Ga0466963_1305070
380 Ga0466960_0214997
381 Ga0466960_0273924
382 Ga0466960_1008094
383 Ga0466967_0013978
384 Ga0466967_0021069
385 Ga0466967_1960428
386 Ga0495590_0364226
387 Ga0495629_0075832
388 Ga0495639_0101647
389 Ga0495662_0028078
390 Ga0495583_0170565
391 Ga0495608_0068063
392 Ga0495630_0200160
393 Ga0495665_0402043
394 Ga0495587_0019811
395 Ga0495598_0001716
396 Ga0495645_0000159
397 Ga0495634_0000729
398 Ga0495588_0088945
399 Ga0495613_0003304
400 Ga0495649_0150266
401 Ga0495649_0399518
402 Ga0495581_0286130
403 Ga0495676_0392488
404 Ga0495684_1001172
405 Ga0495602_0109599
406 Ga0495626_0088288
407 Ga0496100_0547690
408 Ga0496104_0071753
409 Ga0496105_0084548
410 Ga0496108_1128717
411 Ga0496108_1392031
412 Ga0496111_0227650
413 Ga0496112_0007863
414 Ga0496113_0021833
415 Ga0496113_0035771
416 Ga0496114_0001129
417 Ga0496117_0067631
418 Ga0496118_0134604
419 Ga0496119_0018348
420 Ga0496122_0001560
421 Ga0496125_0000066
422 Ga0496126_0111883
423 Ga0501032_0097049
424 Ga0501033_0214635
425 Ga0501034_0146027
426 Ga0501036_0169190
427 Ga0501037_1055388
428 Ga0501038_0160922
429 Ga0501039_0252694
430 Ga0501042_0172241
431 Ga0501043_0296905
432 Ga0501046_0086574
433 Ga0501047_1073149
434 Ga0501048_0339737
435 Ga0501067_0376858
436 Ga0501068_0156753
437 Ga0501069_0210547
438 Ga0501069_0627071
439 Ga0501070_0288942
440 Ga0501072_0222923
441 Ga0501073_0065276
442 Ga0501074_0107185
443 Ga0501074_0995122
444 Ga0501076_0003451
445 Ga0501079_0575338
446 Ga0501080_0112668
447 Ga0501080_0539840
448 Ga0501080_1807328
449 Ga0501083_0029112
450 Ga0501083_0771527
451 Ga0501035_0236969
452 Ga0501044_0018280
453 Ga0501044_0589559
454 Ga0501045_0377878
455 Ga0501045_0938584
456 nmdc:mga05p37_109029_c1
457 nmdc:mga05p37_5508_c1
458 nmdc:mga09592_20965_c1
459 nmdc:mga09592_233702_c1
460 nmdc:mga09592_38453_c1
461 nmdc:mga0qj67_25286_c1
462 nmdc:mga0qj67_27191_c1
463 nmdc:mga0qj67_797_c1
464 nmdc:mga06r32_2991_c1
465 nmdc:mga06r32_628100_c1
466 Ga0495601_0000028
467 Ga0495612_0092355
468 Ga0500556_0016725
469 Ga0500599_001020
470 Ga0587114_093859
471 Ga0501082_0981647
472 Ga0466962_0436207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

5

95

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uct-assembly1.cif.gz_A-2 mycobacterium tuberculosis toxin mazf-mt6 0.9642 2 99
6l29-assembly1.cif.gz_B the structure of the mazf-mt1 mutant 0.93 3 99
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.9279 2 96
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.9182 2 96
5hjz-assembly1.cif.gz_A structure of m. tuberculosis mazf-mt1 (rv2801c) in complex with rna 0.9151 3 98
ID Description Score Start End Superfamily
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.9279 2 96 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.9182 2 96 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9177 3 99 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.9121 3 99 2.30.30.110
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9105 3 98 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A0A0JHH2-F1-model_v4 mRNA interferase MazF3 1.006 27 99 GO:0003677
AF-A0A5C4M684-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 1.004 31 99 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A3S4VDA3-F1-model_v4 mRNA interferase MazF3 (EC 3.1.-.-) 0.9861 27 99 GO:0003677
GO:0016787
AF-A0A1F2WCU9-F1-model_v4 Uncharacterized protein 0.9832 31 99
AF-A0A1F4DUI1-F1-model_v4 MazF family transcriptional regulator 0.9816 33 99 GO:0003677

Map