F349433

General Info

Members Datasets Scaffolds Average Seq Length
236 166 212 303

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0000177|Ga0496116_0000177_49426_50466
Length 338
Sequence VINAILWLIFFSRELAVDKKEDITCWLIYKCPEIRFTVPLLTTMSATMDKIHAMQVFVRVAEDSLGLPKGSLSRQIQALENSLGSRLLHRTTRRVQLTQDGQVYFERCRDVLATLEEMDSLFQHDPATLSGRLRVDMPVSLASNYLIPLLPEFLQHYPGIELELSSSDRRVDVIREGFDCVVRVGTLEDSGLIARQLGHLPLINCASPDYLARFGTPNTLEALSQHAMVHYSQQLGGQPEGFEYFDGKTARLIKTGGVITVNSTETYRSACIAGLGIIQVPRVGVTQALKEKKLVEILPYFPARPMPLSLLYPHRRNLARRVQVFIEWLSQVLKRYVA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
3 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
4 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
5 2643221596 Acidovorax sp. Root70 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221688 Rhizobium sp. Root482 Isolate Unclassified
8 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
9 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
10 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
11 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
12 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
13 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
14 2847085930 Erwinia persicina B64 Isolate Bulb
15 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
16 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
17 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
18 2904504865 Serratia marcescens 1822 Isolate Unclassified
19 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
20 2919150387 Rahnella aceris 1817 Isolate Unclassified
21 2927143783 Rahnella sp. 2050 Isolate Unclassified
22 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
23 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
29 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
111 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
112 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
113 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
114 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0.42
Endosphere 17.37
Nodule 0.42
Rhizoplane 1.27
Rhizosphere 54.24
Stem 0
Stem Tuber 0
Unclassified 25.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000017 3300001989 Bacteria 48831
2 JGI25156J39149_1000566 3300002705 Bacteria 21113
3 JGI25154J39366_1001450 3300002738 Bacteria 8399
4 JGI25157J39369_1000289 3300002741 Bacteria 36586
5 JGI25163J39215_1000018 3300002771 Bacteria 77024
6 JGI25164J39214_1000010 3300002772 Bacteria 288863
7 JGI25164J39214_1000013 3300002772 Bacteria 253470
8 JGI25164J39214_1000016 3300002772 Bacteria 202035
9 rootH2_10000800 3300003320 Bacteria 6549
10 rootH2_10252792 3300003320 Bacteria 4570
11 rootH1_10004085 3300003323 Bacteria 9822
12 rootH1_10067114 3300003323 Bacteria 32104
13 rootH1_10094441 3300003323 Bacteria 2289
14 Ga0055538_1000006 3300003751 Bacteria 403947
15 Ga0055539_1000010 3300003752 Bacteria 403947
16 Ga0055539_1000278 3300003752 Bacteria 29564
17 Ga0055539_1001125 3300003752 Bacteria 5536
18 Ga0055533_1000013 3300003756 Bacteria 403947
19 Ga0055533_1000026 3300003756 Bacteria 323407
20 Ga0055525_1000015 3300003759 Bacteria 403947
21 Ga0055525_1001114 3300003759 Bacteria 6595
22 Ga0055536_1003931 3300003781 Bacteria 7792
23 Ga0055536_1004298 3300003781 Bacteria 7334
24 Ga0055541_1000007 3300003841 Bacteria 403947
25 Ga0058692_1005332 3300003856 Bacteria 3677
26 Ga0065165_1000063 3300005262 Bacteria 176477
27 Ga0065704_10000070 3300005289 Bacteria 29746
28 Ga0065704_10095363 3300005289 Bacteria 2488
29 Ga0070658_10316644 3300005327 Bacteria 1332
30 Ga0070690_100075913 3300005330 Bacteria 2191
31 Ga0070706_100184851 3300005467 Bacteria 1947
32 Ga0070699_100089768 3300005518 Bacteria 2685
33 Ga0070684_100406748 3300005535 Bacteria 1255
34 Ga0068853_100100428 3300005539 Bacteria 2558
35 Ga0068855_100002188 3300005563 Bacteria 24162
36 Ga0068857_100008779 3300005577 Bacteria 8754
37 Ga0068854_100064768 3300005578 Bacteria 2656
38 Ga0068856_100002948 3300005614 Bacteria 17443
39 Ga0068856_100221848 3300005614 Bacteria 1906
40 Ga0068859_100363155 3300005617 Bacteria 1543
41 Ga0068861_100022949 3300005719 Bacteria 4500
42 Ga0075363_100037790 3300006048 Bacteria 2536
43 Ga0075367_10134984 3300006178 Bacteria 1526
44 Ga0075366_10065633 3300006195 Bacteria 2159
45 Ga0075370_10027847 3300006353 Bacteria 3139
46 Ga0075370_10133795 3300006353 Bacteria 1447
47 Ga0105251_10000744 3300009011 Bacteria 29738
48 Ga0105251_10041600 3300009011 Bacteria 2235
49 Ga0105244_10000107 3300009036 Bacteria 86376
50 Ga0105244_10000379 3300009036 Bacteria 41302
51 Ga0105244_10001102 3300009036 Bacteria 22424
52 Ga0105250_10000841 3300009092 Bacteria 18207
53 Ga0105240_10078236 3300009093 Bacteria 4073
54 Ga0114129_10411266 3300009147 Bacteria 1781
55 Ga0105242_10012172 3300009176 Bacteria 6618
56 Ga0105237_10126809 3300009545 Bacteria 2547
57 Ga0105239_10079269 3300010375 Bacteria 3614
58 Ga0105246_10036364 3300011119 Bacteria 3298
59 Ga0157371_10000044 3300013102 Bacteria 194689
60 Ga0157371_10004213 3300013102 Bacteria 12659
61 Ga0157370_10000789 3300013104 Bacteria 39816
62 Ga0157369_10064695 3300013105 Bacteria 3938
63 Ga0163162_10044277 3300013306 Bacteria 4457
64 Ga0157372_10118030 3300013307 Bacteria 3043
65 Ga0157372_10905429 3300013307 Bacteria 1023
66 Ga0163163_10685664 3300014325 Bacteria 1088
67 Ga0157379_10038025 3300014968 Bacteria 4293
68 Ga0182006_1011547 3300015261 Bacteria 3884
69 Ga0213876_10073699 3300021384 Bacteria 1803
70 Ga0209760_100024 3300025207 Bacteria 158664
71 Ga0209784_100022 3300025224 Bacteria 403999
72 Ga0209566_100021 3300025225 Bacteria 403999
73 Ga0209674_100024 3300025226 Bacteria 535481
74 Ga0209674_100038 3300025226 Bacteria 403999
75 Ga0209563_100042 3300025230 Bacteria 403999
76 Ga0209563_100069 3300025230 Bacteria 253154
77 Ga0207427_100027 3300025231 Bacteria 403999
78 Ga0207427_101006 3300025231 Bacteria 11815
79 Ga0209437_100049 3300025233 Bacteria 403999
80 Ga0209646_1000012 3300025246 Bacteria 573300
81 Ga0209026_1000004 3300025250 Bacteria 949012
82 Ga0209677_100025 3300025253 Bacteria 403999
83 Ga0209677_100048 3300025253 Bacteria 183563
84 Ga0209677_100184 3300025253 Bacteria 51898
85 Ga0209759_1000003 3300025256 Bacteria 792130
86 Ga0209759_1000067 3300025256 Bacteria 183764
87 Ga0209759_1002840 3300025256 Bacteria 7306
88 Ga0209759_1007905 3300025256 Bacteria 3366
89 Ga0209676_1000034 3300025292 Bacteria 460125
90 Ga0209676_1000075 3300025292 Bacteria 303609
91 Ga0209050_1008389 3300025298 Bacteria 5535
92 Ga0207696_1000036 3300025711 Bacteria 337736
93 Ga0207696_1000618 3300025711 Bacteria 26252
94 Ga0207655_1000124 3300025728 Bacteria 153097
95 Ga0207655_1000130 3300025728 Bacteria 148370
96 Ga0207655_1003461 3300025728 Bacteria 11736
97 Ga0207713_1010785 3300025735 Bacteria 5032
98 Ga0207695_10022882 3300025913 Bacteria 7079
99 Ga0207695_10024763 3300025913 Bacteria 6739
100 Ga0207694_10070628 3300025924 Bacteria 2728
101 Ga0207686_10012323 3300025934 Bacteria 4700
102 Ga0207689_10018249 3300025942 Bacteria 5921
103 Ga0207661_10188610 3300025944 Bacteria 1806
104 Ga0207667_10001981 3300025949 Bacteria 25666
105 Ga0207667_10091330 3300025949 Bacteria 3146
106 Ga0207651_10368769 3300025960 Bacteria 1214
107 Ga0207640_10014365 3300025981 Bacteria 4557
108 Ga0207639_10068912 3300026041 Bacteria 2758
109 Ga0207702_10001282 3300026078 Bacteria 25227
110 Ga0207674_10031711 3300026116 Bacteria 5549
111 Ga0207674_10136540 3300026116 Bacteria 2414
112 Ga0207675_100035480 3300026118 Bacteria 4652
113 Ga0209371_1000417 3300027312 Bacteria 43898
114 Ga0209371_1006631 3300027312 Bacteria 4238
115 Ga0268256_1000202 3300030500 Bacteria 67837
116 Ga0268256_1006697 3300030500 Bacteria 4238
117 Ga0307408_100000288 3300031548 Bacteria 49765
118 Ga0307408_100112222 3300031548 Bacteria 2096
119 Ga0307406_10001222 3300031901 Bacteria 14379
120 Ga0237819_03569 3300038705 Bacteria 2729
121 Ga0436365_1871896 3300039437 Bacteria 1845
122 Ga0439438_001995 3300041405 Bacteria 8921
123 Ga0439447_004224 3300041407 Bacteria 4980
124 Ga0439432_000264 3300042006 Bacteria 18796
125 Ga0439452_000026 3300042010 Bacteria 223971
126 Ga0450919_004156 3300042121 Bacteria 1777
127 Ga0450918_000962 3300042531 Bacteria 5998
128 Ga0466965_0031960 3300044683 Bacteria 2570
129 Ga0495650_0000039 3300046471 Bacteria 375501
130 Ga0495650_0001553 3300046471 Bacteria 21682
131 Ga0495605_0015199 3300046474 Bacteria 4193
132 Ga0495584_0002014 3300046491 Bacteria 11684
133 Ga0495607_0003382 3300046501 Bacteria 12235
134 Ga0495607_0139444 3300046501 Bacteria 1252
135 Ga0495583_0000022 3300046506 Bacteria 282544
136 Ga0495606_0022279 3300046507 Bacteria 4618
137 Ga0495606_0058467 3300046507 Bacteria 2477
138 Ga0495616_0005565 3300046513 Bacteria 7731
139 Ga0495632_0002475 3300046519 Bacteria 14038
140 Ga0495643_0005391 3300046522 Bacteria 8657
141 Ga0495648_0044887 3300046524 Bacteria 2755
142 Ga0495609_0001172 3300046538 Bacteria 18081
143 Ga0495661_0011420 3300046665 Bacteria 6028
144 Ga0495588_0000172 3300046674 Bacteria 81934
145 Ga0495649_0000099 3300046694 Bacteria 75713
146 Ga0495589_0003631 3300046794 Bacteria 8330
147 Ga0495660_0000023 3300046810 Bacteria 272605
148 Ga0495660_0003525 3300046810 Bacteria 9645
149 Ga0495660_0034636 3300046810 Bacteria 2824
150 Ga0495672_0001685 3300047320 Bacteria 21405
151 Ga0495683_0178753 3300047323 Bacteria 970
152 Ga0495687_000405 3300047443 Bacteria 53349
153 Ga0495677_0004408 3300047445 Bacteria 5405
154 Ga0495686_0008585 3300047472 Bacteria 7479
155 Ga0495626_0000005 3300048091 Bacteria 337534
156 Ga0495626_0010616 3300048091 Bacteria 4901
157 Ga0496116_0000112 3300048919 Bacteria 181946
158 Ga0496116_0000177 3300048919 Bacteria 128402
159 Ga0496116_0000386 3300048919 Bacteria 64715
160 Ga0496116_0008301 3300048919 Bacteria 9026
161 Ga0496117_0000551 3300048920 Bacteria 61568
162 Ga0496117_0018493 3300048920 Bacteria 5765
163 Ga0496117_0046416 3300048920 Bacteria 3125
164 Ga0496118_0002168 3300048921 Bacteria 27338
165 Ga0496118_0002642 3300048921 Bacteria 23749
166 Ga0496118_0007445 3300048921 Bacteria 11597
167 Ga0496118_0063338 3300048921 Bacteria 2721
168 Ga0496119_0000085 3300048922 Bacteria 137406
169 Ga0496119_0002037 3300048922 Bacteria 22873
170 Ga0496119_0003319 3300048922 Bacteria 16789
171 Ga0496119_0003957 3300048922 Bacteria 15009
172 Ga0496119_0017476 3300048922 Bacteria 5391
173 Ga0496120_0000111 3300048923 Bacteria 137405
174 Ga0496120_0000136 3300048923 Bacteria 124418
175 Ga0496120_0000854 3300048923 Bacteria 43100
176 Ga0496120_0002609 3300048923 Bacteria 17866
177 Ga0496122_0000067 3300048925 Bacteria 231365
178 Ga0496122_0049796 3300048925 Bacteria 3202
179 Ga0496123_0000056 3300048926 Bacteria 231365
180 Ga0496123_0005671 3300048926 Bacteria 12463
181 Ga0496123_0059023 3300048926 Bacteria 2484
182 Ga0496124_0000362 3300048927 Bacteria 82902
183 Ga0496124_0016457 3300048927 Bacteria 7027
184 Ga0496124_0048079 3300048927 Bacteria 3647
185 Ga0496124_0169181 3300048927 Bacteria 1695
186 Ga0496125_0000183 3300048928 Bacteria 137652
187 Ga0496125_0000376 3300048928 Bacteria 83515
188 Ga0496126_0001135 3300048929 Bacteria 44310
189 Ga0496126_0328719 3300048929 Bacteria 1255
190 Ga0501031_0009482 3300049568 Bacteria 6331
191 Ga0501032_0016360 3300049569 Bacteria 5218
192 Ga0501033_0000919 3300049570 Bacteria 26915
193 Ga0501034_0007183 3300049571 Bacteria 11887
194 Ga0501034_0075621 3300049571 Bacteria 3374
195 Ga0501034_0352061 3300049571 Bacteria 1401
196 Ga0501036_0000418 3300049572 Bacteria 29982
197 Ga0501037_0058892 3300049573 Bacteria 2802
198 Ga0501037_0128261 3300049573 Bacteria 1820
199 Ga0501038_0001437 3300049574 Bacteria 21855
200 Ga0501043_0000727 3300049579 Bacteria 29186
201 Ga0501043_0022766 3300049579 Bacteria 4913
202 Ga0501046_0001582 3300049580 Bacteria 21776
203 Ga0501047_0013775 3300049581 Bacteria 7680
204 Ga0501209_000025 3300049656 Bacteria 14691
205 Ga0501223_025680 3300049663 Bacteria 1147
206 Ga0501035_0005492 3300049822 Bacteria 11975
207 Ga0501035_0189439 3300049822 Bacteria 1768
208 Ga0501044_0011187 3300049823 Bacteria 9731
209 nmdc:mga07m45_25841_c1 3300050496 Bacteria 3224
210 Ga0500635_0000110 3300053080 Bacteria 49377
211 Ga0500568_0028370 3300053139 Bacteria 2334
212 Ga0500622_0000019 3300053156 Bacteria 275028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10252792 rootH2_102527924 261
2 3300003323 rootH1_10067114 rootH1_1006711431 261
3 3300005289 Ga0065704_10095363 Ga0065704_100953632 262
4 3300053156 Ga0500622_0000019 Ga0500622_0000019_185745_186650 263
5 3300005617 Ga0068859_100363155 Ga0068859_1003631552 264
6 3300053139 Ga0500568_0028370 Ga0500568_0028370_453_1346 264
7 3300048922 Ga0496119_0000085 Ga0496119_0000085_86435_87427 269
8 3300048923 Ga0496120_0000111 Ga0496120_0000111_86434_87426 269
9 3300031548 Ga0307408_100000288 Ga0307408_10000028824 270
10 3300031548 Ga0307408_100112222 Ga0307408_1001122222 270
11 3300031901 Ga0307406_10001222 Ga0307406_100012225 270
12 3300049663 Ga0501223_025680 Ga0501223_025680_145_1080 270
13 3300003781 Ga0055536_1003931 Ga0055536_10039314 271
14 3300025292 Ga0209676_1000034 Ga0209676_100003486 271
15 3300048919 Ga0496116_0000177 Ga0496116_0000177_49426_50466 276
16 3300048922 Ga0496119_0002037 Ga0496119_0002037_7459_8499 276
17 3300048923 Ga0496120_0000136 Ga0496120_0000136_75326_76366 276
18 3300048929 Ga0496126_0328719 Ga0496126_0328719_167_1138 276
19 3300021384 Ga0213876_10073699 Ga0213876_100736992 280
20 3300039437 Ga0436365_1871896 Ga0436365_1871896_786_1679 280
21 3300048925 Ga0496122_0049796 Ga0496122_0049796_796_1686 280
22 3300048926 Ga0496123_0059023 Ga0496123_0059023_1550_2440 280
23 3300048928 Ga0496125_0000376 Ga0496125_0000376_43234_44124 280
24 iso_pu_bacteria 2508501050 2508730140 280
25 iso_pu_bacteria 2643221688 2644495160 280
26 3300049568 Ga0501031_0009482 Ga0501031_0009482_602_1498 282
27 3300049569 Ga0501032_0016360 Ga0501032_0016360_174_1070 282
28 3300049570 Ga0501033_0000919 Ga0501033_0000919_20781_21677 282
29 3300049571 Ga0501034_0007183 Ga0501034_0007183_4588_5484 282
30 3300049571 Ga0501034_0075621 Ga0501034_0075621_190_1095 282
31 3300049571 Ga0501034_0352061 Ga0501034_0352061_146_1078 282
32 3300049572 Ga0501036_0000418 Ga0501036_0000418_11853_12749 282
33 3300049573 Ga0501037_0058892 Ga0501037_0058892_90_986 282
34 3300049573 Ga0501037_0128261 Ga0501037_0128261_610_1515 282
35 3300049574 Ga0501038_0001437 Ga0501038_0001437_52_948 282
36 3300049579 Ga0501043_0000727 Ga0501043_0000727_5604_6500 282
37 3300049579 Ga0501043_0022766 Ga0501043_0022766_3623_4528 282
38 3300049580 Ga0501046_0001582 Ga0501046_0001582_12853_13749 282
39 3300049581 Ga0501047_0013775 Ga0501047_0013775_199_1095 282
40 3300049656 Ga0501209_000025 Ga0501209_000025_6017_6916 282
41 3300049822 Ga0501035_0005492 Ga0501035_0005492_7178_8074 282
42 3300049822 Ga0501035_0189439 Ga0501035_0189439_753_1658 282
43 3300049823 Ga0501044_0011187 Ga0501044_0011187_4276_5172 282
44 iso_pu_bacteria 2854896431 2854900302 282
45 3300006048 Ga0075363_100037790 Ga0075363_1000377903 283
46 3300006178 Ga0075367_10134984 Ga0075367_101349842 283
47 3300006353 Ga0075370_10133795 Ga0075370_101337952 283
48 3300009147 Ga0114129_10411266 Ga0114129_104112662 283
49 3300001989 JGI24739J22299_10000017 JGI24739J22299_1000001745 284
50 3300002705 JGI25156J39149_1000566 JGI25156J39149_10005666 284
51 3300002738 JGI25154J39366_1001450 JGI25154J39366_10014505 284
52 3300002741 JGI25157J39369_1000289 JGI25157J39369_100028919 284
53 3300002771 JGI25163J39215_1000018 JGI25163J39215_100001838 284
54 3300002772 JGI25164J39214_1000010 JGI25164J39214_1000010205 284
55 3300002772 JGI25164J39214_1000013 JGI25164J39214_100001325 284
56 3300002772 JGI25164J39214_1000016 JGI25164J39214_100001619 284
57 3300003320 rootH2_10000800 rootH2_100008006 284
58 3300003323 rootH1_10004085 rootH1_100040855 284
59 3300003323 rootH1_10094441 rootH1_100944412 284
60 3300003751 Ga0055538_1000006 Ga0055538_1000006171 284
61 3300003752 Ga0055539_1000010 Ga0055539_1000010171 284
62 3300003752 Ga0055539_1000278 Ga0055539_100027814 284
63 3300003752 Ga0055539_1001125 Ga0055539_10011252 284
64 3300003756 Ga0055533_1000013 Ga0055533_1000013171 284
65 3300003756 Ga0055533_1000026 Ga0055533_100002686 284
66 3300003759 Ga0055525_1000015 Ga0055525_1000015171 284
67 3300003759 Ga0055525_1001114 Ga0055525_10011143 284
68 3300003781 Ga0055536_1004298 Ga0055536_10042987 284
69 3300003841 Ga0055541_1000007 Ga0055541_1000007204 284
70 3300003856 Ga0058692_1005332 Ga0058692_10053322 284
71 3300005262 Ga0065165_1000063 Ga0065165_1000063123 284
72 3300005289 Ga0065704_10000070 Ga0065704_100000709 284
73 3300005327 Ga0070658_10316644 Ga0070658_103166442 284
74 3300005330 Ga0070690_100075913 Ga0070690_1000759133 284
75 3300005467 Ga0070706_100184851 Ga0070706_1001848511 284
76 3300005518 Ga0070699_100089768 Ga0070699_1000897683 284
77 3300005535 Ga0070684_100406748 Ga0070684_1004067481 284
78 3300005539 Ga0068853_100100428 Ga0068853_1001004282 284
79 3300005563 Ga0068855_100002188 Ga0068855_1000021883 284
80 3300005577 Ga0068857_100008779 Ga0068857_1000087796 284
81 3300005578 Ga0068854_100064768 Ga0068854_1000647683 284
82 3300005614 Ga0068856_100002948 Ga0068856_10000294811 284
83 3300005614 Ga0068856_100221848 Ga0068856_1002218482 284
84 3300005719 Ga0068861_100022949 Ga0068861_1000229494 284
85 3300006195 Ga0075366_10065633 Ga0075366_100656332 284
86 3300006353 Ga0075370_10027847 Ga0075370_100278473 284
87 3300009011 Ga0105251_10000744 Ga0105251_1000074419 284
88 3300009011 Ga0105251_10041600 Ga0105251_100416002 284
89 3300009036 Ga0105244_10000107 Ga0105244_1000010720 284
90 3300009036 Ga0105244_10000379 Ga0105244_100003794 284
91 3300009036 Ga0105244_10001102 Ga0105244_100011024 284
92 3300009092 Ga0105250_10000841 Ga0105250_1000084111 284
93 3300009093 Ga0105240_10078236 Ga0105240_100782362 284
94 3300009176 Ga0105242_10012172 Ga0105242_100121723 284
95 3300009545 Ga0105237_10126809 Ga0105237_101268092 284
96 3300010375 Ga0105239_10079269 Ga0105239_100792695 284
97 3300011119 Ga0105246_10036364 Ga0105246_100363642 284
98 3300013102 Ga0157371_10000044 Ga0157371_1000004453 284
99 3300013102 Ga0157371_10004213 Ga0157371_1000421311 284
100 3300013104 Ga0157370_10000789 Ga0157370_1000078922 284
101 3300013105 Ga0157369_10064695 Ga0157369_100646955 284
102 3300013306 Ga0163162_10044277 Ga0163162_100442774 284
103 3300013307 Ga0157372_10118030 Ga0157372_101180302 284
104 3300013307 Ga0157372_10905429 Ga0157372_109054291 284
105 3300014325 Ga0163163_10685664 Ga0163163_106856641 284
106 3300014968 Ga0157379_10038025 Ga0157379_100380255 284
107 3300015261 Ga0182006_1011547 Ga0182006_10115473 284
108 3300025207 Ga0209760_100024 Ga0209760_10002423 284
109 3300025224 Ga0209784_100022 Ga0209784_100022201 284
110 3300025225 Ga0209566_100021 Ga0209566_100021201 284
111 3300025226 Ga0209674_100024 Ga0209674_100024211 284
112 3300025226 Ga0209674_100038 Ga0209674_100038201 284
113 3300025230 Ga0209563_100042 Ga0209563_100042201 284
114 3300025230 Ga0209563_100069 Ga0209563_100069211 284
115 3300025231 Ga0207427_100027 Ga0207427_100027201 284
116 3300025231 Ga0207427_101006 Ga0207427_1010066 284
117 3300025233 Ga0209437_100049 Ga0209437_100049201 284
118 3300025246 Ga0209646_1000012 Ga0209646_1000012297 284
119 3300025250 Ga0209026_1000004 Ga0209026_1000004323 284
120 3300025253 Ga0209677_100025 Ga0209677_100025201 284
121 3300025253 Ga0209677_100048 Ga0209677_100048100 284
122 3300025253 Ga0209677_100184 Ga0209677_10018412 284
123 3300025256 Ga0209759_1000003 Ga0209759_1000003405 284
124 3300025256 Ga0209759_1000067 Ga0209759_100006711 284
125 3300025256 Ga0209759_1002840 Ga0209759_10028406 284
126 3300025256 Ga0209759_1007905 Ga0209759_10079053 284
127 3300025292 Ga0209676_1000075 Ga0209676_1000075184 284
128 3300025298 Ga0209050_1008389 Ga0209050_10083896 284
129 3300025711 Ga0207696_1000036 Ga0207696_1000036166 284
130 3300025711 Ga0207696_1000618 Ga0207696_10006187 284
131 3300025728 Ga0207655_1000124 Ga0207655_100012443 284
132 3300025728 Ga0207655_1000130 Ga0207655_100013016 284
133 3300025728 Ga0207655_1003461 Ga0207655_100346111 284
134 3300025735 Ga0207713_1010785 Ga0207713_10107855 284
135 3300025913 Ga0207695_10022882 Ga0207695_100228823 284
136 3300025913 Ga0207695_10024763 Ga0207695_100247635 284
137 3300025924 Ga0207694_10070628 Ga0207694_100706283 284
138 3300025934 Ga0207686_10012323 Ga0207686_100123232 284
139 3300025942 Ga0207689_10018249 Ga0207689_100182493 284
140 3300025944 Ga0207661_10188610 Ga0207661_101886102 284
141 3300025949 Ga0207667_10001981 Ga0207667_100019813 284
142 3300025949 Ga0207667_10091330 Ga0207667_100913302 284
143 3300025960 Ga0207651_10368769 Ga0207651_103687692 284
144 3300025981 Ga0207640_10014365 Ga0207640_100143653 284
145 3300026041 Ga0207639_10068912 Ga0207639_100689123 284
146 3300026078 Ga0207702_10001282 Ga0207702_1000128220 284
147 3300026116 Ga0207674_10031711 Ga0207674_100317115 284
148 3300026116 Ga0207674_10136540 Ga0207674_101365403 284
149 3300026118 Ga0207675_100035480 Ga0207675_1000354804 284
150 3300027312 Ga0209371_1000417 Ga0209371_100041716 284
151 3300027312 Ga0209371_1006631 Ga0209371_10066314 284
152 3300030500 Ga0268256_1000202 Ga0268256_100020246 284
153 3300030500 Ga0268256_1006697 Ga0268256_10066974 284
154 3300038705 Ga0237819_03569 Ga0237819_03569_295_1269 284
155 3300041405 Ga0439438_001995 Ga0439438_001995_5508_6407 284
156 3300041407 Ga0439447_004224 Ga0439447_004224_3652_4551 284
157 3300042006 Ga0439432_000264 Ga0439432_000264_9806_10705 284
158 3300042010 Ga0439452_000026 Ga0439452_000026_22435_23334 284
159 3300042121 Ga0450919_004156 Ga0450919_004156_798_1703 284
160 3300042531 Ga0450918_000962 Ga0450918_000962_3480_4385 284
161 3300044683 Ga0466965_0031960 Ga0466965_0031960_1048_1959 284
162 3300046471 Ga0495650_0000039 Ga0495650_0000039_231968_232909 284
163 3300046471 Ga0495650_0001553 Ga0495650_0001553_15434_16333 284
164 3300046474 Ga0495605_0015199 Ga0495605_0015199_2616_3515 284
165 3300046491 Ga0495584_0002014 Ga0495584_0002014_5146_6045 284
166 3300046501 Ga0495607_0003382 Ga0495607_0003382_6932_7831 284
167 3300046501 Ga0495607_0139444 Ga0495607_0139444_69_968 284
168 3300046506 Ga0495583_0000022 Ga0495583_0000022_100704_101612 284
169 3300046507 Ga0495606_0022279 Ga0495606_0022279_167_1066 284
170 3300046507 Ga0495606_0058467 Ga0495606_0058467_1488_2396 284
171 3300046513 Ga0495616_0005565 Ga0495616_0005565_6098_6997 284
172 3300046519 Ga0495632_0002475 Ga0495632_0002475_6507_7406 284
173 3300046522 Ga0495643_0005391 Ga0495643_0005391_721_1620 284
174 3300046524 Ga0495648_0044887 Ga0495648_0044887_431_1345 284
175 3300046538 Ga0495609_0001172 Ga0495609_0001172_1994_2893 284
176 3300046665 Ga0495661_0011420 Ga0495661_0011420_3153_4052 284
177 3300046674 Ga0495588_0000172 Ga0495588_0000172_65915_66814 284
178 3300046694 Ga0495649_0000099 Ga0495649_0000099_6956_7864 284
179 3300046794 Ga0495589_0003631 Ga0495589_0003631_3431_4339 284
180 3300046810 Ga0495660_0000023 Ga0495660_0000023_85119_86060 284
181 3300046810 Ga0495660_0003525 Ga0495660_0003525_5648_6586 284
182 3300046810 Ga0495660_0034636 Ga0495660_0034636_1816_2742 284
183 3300047320 Ga0495672_0001685 Ga0495672_0001685_15394_16293 284
184 3300047323 Ga0495683_0178753 Ga0495683_0178753_37_936 284
185 3300047443 Ga0495687_000405 Ga0495687_000405_14942_15841 284
186 3300047445 Ga0495677_0004408 Ga0495677_0004408_3490_4389 284
187 3300047472 Ga0495686_0008585 Ga0495686_0008585_692_1639 284
188 3300048091 Ga0495626_0000005 Ga0495626_0000005_321483_322382 284
189 3300048091 Ga0495626_0010616 Ga0495626_0010616_3282_4181 284
190 3300048919 Ga0496116_0000112 Ga0496116_0000112_162058_162999 284
191 3300048919 Ga0496116_0000386 Ga0496116_0000386_41382_42281 284
192 3300048919 Ga0496116_0008301 Ga0496116_0008301_4131_5030 284
193 3300048920 Ga0496117_0000551 Ga0496117_0000551_38021_38920 284
194 3300048920 Ga0496117_0018493 Ga0496117_0018493_3475_4416 284
195 3300048920 Ga0496117_0046416 Ga0496117_0046416_1522_2463 284
196 3300048921 Ga0496118_0002168 Ga0496118_0002168_14654_15595 284
197 3300048921 Ga0496118_0002642 Ga0496118_0002642_5004_5903 284
198 3300048921 Ga0496118_0007445 Ga0496118_0007445_4877_5818 284
199 3300048921 Ga0496118_0063338 Ga0496118_0063338_1652_2593 284
200 3300048922 Ga0496119_0003319 Ga0496119_0003319_1789_2766 284
201 3300048922 Ga0496119_0003957 Ga0496119_0003957_3115_4014 284
202 3300048922 Ga0496119_0017476 Ga0496119_0017476_2216_3157 284
203 3300048923 Ga0496120_0000854 Ga0496120_0000854_26698_27597 284
204 3300048923 Ga0496120_0002609 Ga0496120_0002609_10315_11256 284
205 3300048925 Ga0496122_0000067 Ga0496122_0000067_50789_51730 284
206 3300048926 Ga0496123_0000056 Ga0496123_0000056_179636_180577 284
207 3300048926 Ga0496123_0005671 Ga0496123_0005671_5938_6837 284
208 3300048927 Ga0496124_0000362 Ga0496124_0000362_6571_7512 284
209 3300048927 Ga0496124_0016457 Ga0496124_0016457_3973_4872 284
210 3300048927 Ga0496124_0048079 Ga0496124_0048079_1725_2624 284
211 3300048927 Ga0496124_0169181 Ga0496124_0169181_466_1404 284
212 3300048928 Ga0496125_0000183 Ga0496125_0000183_29212_30153 284
213 3300048929 Ga0496126_0001135 Ga0496126_0001135_36979_37920 284
214 3300050496 nmdc:mga07m45_25841_c1 nmdc:mga07m45_25841_c1_1660_2568 284
215 3300053080 Ga0500635_0000110 Ga0500635_0000110_14117_15025 284
216 iso_pu_bacteria 2585427591 2585826517 284
217 iso_pu_bacteria 2585427592 2585832620 284
218 iso_pu_bacteria 2599185299 2599929364 284
219 iso_pu_bacteria 2643221596 2643990119 284
220 iso_pu_bacteria 2643221644 2644244143 284
221 iso_pu_bacteria 2648501693 2650899747 284
222 iso_pu_bacteria 2667528173 2671109179 284
223 iso_pu_bacteria 2684622997 2686356445 284
224 iso_pu_bacteria 2747842428 2747948524 284
225 iso_pu_bacteria 2765235840 2765579331 284
226 iso_pu_bacteria 2808606414 2809126823 284
227 iso_pu_bacteria 2847085930 2847089709 284
228 iso_pu_bacteria 2847797336 2847797576 284
229 iso_pu_bacteria 2904474040 2904477544 284
230 iso_pu_bacteria 2904504865 2904508191 284
231 iso_pu_bacteria 2908669403 2908674337 284
232 iso_pu_bacteria 2919150387 2919153749 284
233 iso_pu_bacteria 2927143783 2927147235 284
234 iso_pu_bacteria 2984494565 2984499002 284
235 iso_pu_bacteria 2990261002 2990263708 284
236 iso_pu_bacteria 8055693939 8055696960 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03466

LysR_substrate

LysR substrate binding domain

126

334

0.92

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

51

102

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z4z-assembly1.cif.gz_A crystal structure of pacysb ntd domain with space group c2 0.9149 3 69
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.901 3 69
3mz1-assembly2.cif.gz_C the crystal structure of a possible transcription regulator protein from sinorhizobium meliloti 1021 0.8979 75 282
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.8966 3 69
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.8964 2 69
ID Description Score Start End Superfamily
af_P37641_88_293_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9839 73 277 3.40.190.290
af_P37641_88_293_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9745 73 277 3.40.190.290
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9477 2 68 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 2 68 1.10.10.10
af_P05827_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9362 3 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A240B5D6-F1-model_v4 D-malate degradation protein R 0.9336 83 281 GO:0003700
GO:0006351
GO:0043565
AF-A0A4Q5XXI8-F1-model_v4 deleted 0.9298 93 279
AF-A0A242M2C6-F1-model_v4 Putative transcription regulator protein of MDR efflux pump cluster 0.9213 149 251 GO:0003700
GO:0006351
GO:0043565
AF-A0A240B5D6-F1-model_v4 D-malate degradation protein R 0.916 83 281 GO:0003700
GO:0006351
GO:0043565
AF-A0A351P061-F1-model_v4 LysR family transcriptional regulator 0.9093 104 277 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.27 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map