F349683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 151 | 237 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_11509052|Ga0070658_115090521 |
| Length | 126 |
| Sequence | MDLLDTQLYALIGDDGFARLTAAFFRRVPTDPILAPMYQHDLAGAEWRLREFLVGRFGGPTRYIEQRGHPRLRMRHAPFKINTAARNRWIETMTAALEEAALPPEANATLRRFFDDAATFMINHPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 68 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 130 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 133 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 134 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 149 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 151 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.05 |
| Metatranscriptomes | 2.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0 |
| Rhizoplane | 2.11 |
| Rhizosphere | 85.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10904592 | 3300005327 | Bacteria | 767 |
| 2 | Ga0070658_11509052 | 3300005327 | Bacteria | 583 |
| 3 | Ga0070676_10099707 | 3300005328 | Bacteria | 1792 |
| 4 | Ga0070676_10366273 | 3300005328 | Bacteria | 994 |
| 5 | Ga0070683_101150807 | 3300005329 | Bacteria | 745 |
| 6 | Ga0070683_101527654 | 3300005329 | Bacteria | 642 |
| 7 | Ga0070690_100016588 | 3300005330 | Bacteria | 4417 |
| 8 | Ga0070677_10260752 | 3300005333 | Bacteria | 865 |
| 9 | Ga0068869_100002479 | 3300005334 | Bacteria | 11131 |
| 10 | Ga0070680_100027031 | 3300005336 | Bacteria | 4593 |
| 11 | Ga0070680_101286692 | 3300005336 | Bacteria | 633 |
| 12 | Ga0070682_101885154 | 3300005337 | Unclassified | 523 |
| 13 | Ga0068868_101235844 | 3300005338 | Bacteria | 692 |
| 14 | Ga0070660_100026355 | 3300005339 | Bacteria | 4327 |
| 15 | Ga0070660_100038571 | 3300005339 | Bacteria | 3627 |
| 16 | Ga0070689_100120269 | 3300005340 | Bacteria | 2097 |
| 17 | Ga0070689_100154668 | 3300005340 | Bacteria | 1851 |
| 18 | Ga0070691_10030942 | 3300005341 | Bacteria | 2508 |
| 19 | Ga0070669_100264902 | 3300005353 | Bacteria | 1372 |
| 20 | Ga0070675_100001621 | 3300005354 | Bacteria | 16598 |
| 21 | Ga0070671_100362783 | 3300005355 | Bacteria | 1237 |
| 22 | Ga0070673_100020088 | 3300005364 | Bacteria | 4810 |
| 23 | Ga0070688_100136490 | 3300005365 | Bacteria | 1661 |
| 24 | Ga0070667_100029195 | 3300005367 | Bacteria | 4594 |
| 25 | Ga0070667_100640427 | 3300005367 | Bacteria | 981 |
| 26 | Ga0070667_100939030 | 3300005367 | Bacteria | 806 |
| 27 | Ga0070667_101856969 | 3300005367 | Bacteria | 567 |
| 28 | Ga0070713_100013675 | 3300005436 | Bacteria | 5999 |
| 29 | Ga0070713_100043922 | 3300005436 | Bacteria | 3656 |
| 30 | Ga0070701_10009264 | 3300005438 | Bacteria | 4306 |
| 31 | Ga0070700_100082832 | 3300005441 | Bacteria | 2075 |
| 32 | Ga0070678_100329185 | 3300005456 | Bacteria | 1307 |
| 33 | Ga0070681_10196958 | 3300005458 | Bacteria | 1933 |
| 34 | Ga0070681_10787156 | 3300005458 | Bacteria | 868 |
| 35 | Ga0068867_100005747 | 3300005459 | Bacteria | 8800 |
| 36 | Ga0070679_100018221 | 3300005530 | Bacteria | 6809 |
| 37 | Ga0070684_100006622 | 3300005535 | Bacteria | 8973 |
| 38 | Ga0068853_100091014 | 3300005539 | Bacteria | 2682 |
| 39 | Ga0068853_101932794 | 3300005539 | Bacteria | 572 |
| 40 | Ga0070672_100022640 | 3300005543 | Bacteria | 4620 |
| 41 | Ga0070686_100546403 | 3300005544 | Bacteria | 905 |
| 42 | Ga0070665_100367722 | 3300005548 | Bacteria | 1445 |
| 43 | Ga0070665_100783265 | 3300005548 | Bacteria | 967 |
| 44 | Ga0068855_100102606 | 3300005563 | Bacteria | 3292 |
| 45 | Ga0068857_100007886 | 3300005577 | Bacteria | 9185 |
| 46 | Ga0068854_100143045 | 3300005578 | Bacteria | 1837 |
| 47 | Ga0068854_100186865 | 3300005578 | Bacteria | 1622 |
| 48 | Ga0068854_100462005 | 3300005578 | Bacteria | 1062 |
| 49 | Ga0068856_100001598 | 3300005614 | Bacteria | 23676 |
| 50 | Ga0068856_100018153 | 3300005614 | Bacteria | 6821 |
| 51 | Ga0068852_100055546 | 3300005616 | Bacteria | 3418 |
| 52 | Ga0068852_100334061 | 3300005616 | Bacteria | 1475 |
| 53 | Ga0068859_100045205 | 3300005617 | Bacteria | 4425 |
| 54 | Ga0068859_101213977 | 3300005617 | Bacteria | 831 |
| 55 | Ga0068861_100014453 | 3300005719 | Bacteria | 5541 |
| 56 | Ga0068863_100047358 | 3300005841 | Bacteria | 4078 |
| 57 | Ga0068858_100062032 | 3300005842 | Bacteria | 3456 |
| 58 | Ga0068860_100068385 | 3300005843 | Bacteria | 3375 |
| 59 | Ga0068860_100285698 | 3300005843 | Bacteria | 1613 |
| 60 | Ga0068860_101426734 | 3300005843 | Unclassified | 714 |
| 61 | Ga0068862_101796277 | 3300005844 | Bacteria | 622 |
| 62 | Ga0068862_102060881 | 3300005844 | Bacteria | 581 |
| 63 | Ga0081455_10022431 | 3300005937 | Bacteria | 5899 |
| 64 | Ga0068871_100157289 | 3300006358 | Bacteria | 1942 |
| 65 | Ga0075430_100004174 | 3300006846 | Bacteria | 12190 |
| 66 | Ga0068865_100006623 | 3300006881 | Bacteria | 7085 |
| 67 | Ga0097620_100045206 | 3300006931 | Bacteria | 4425 |
| 68 | Ga0097620_101213980 | 3300006931 | Bacteria | 831 |
| 69 | Ga0105240_10006444 | 3300009093 | Bacteria | 17256 |
| 70 | Ga0105240_10051948 | 3300009093 | Bacteria | 5155 |
| 71 | Ga0105240_10343082 | 3300009093 | Bacteria | 1696 |
| 72 | Ga0105240_10438203 | 3300009093 | Bacteria | 1465 |
| 73 | Ga0105245_10219011 | 3300009098 | Bacteria | 1836 |
| 74 | Ga0105243_10020195 | 3300009148 | Bacteria | 5051 |
| 75 | Ga0105241_10003203 | 3300009174 | Bacteria | 12180 |
| 76 | Ga0105241_10138775 | 3300009174 | Bacteria | 1977 |
| 77 | Ga0105242_10024408 | 3300009176 | Bacteria | 4775 |
| 78 | Ga0105248_11550029 | 3300009177 | Bacteria | 750 |
| 79 | Ga0105248_11653272 | 3300009177 | Unclassified | 726 |
| 80 | Ga0105248_11663020 | 3300009177 | Bacteria | 724 |
| 81 | Ga0105237_10002468 | 3300009545 | Bacteria | 22939 |
| 82 | Ga0105237_10003436 | 3300009545 | Bacteria | 18797 |
| 83 | Ga0105237_10549339 | 3300009545 | Bacteria | 1162 |
| 84 | Ga0105238_10051490 | 3300009551 | Bacteria | 4142 |
| 85 | Ga0105238_12050965 | 3300009551 | Bacteria | 606 |
| 86 | Ga0105239_10005790 | 3300010375 | Bacteria | 14418 |
| 87 | Ga0105239_13464594 | 3300010375 | Unclassified | 513 |
| 88 | Ga0105246_10244201 | 3300011119 | Bacteria | 1421 |
| 89 | Ga0157371_10489948 | 3300013102 | Bacteria | 907 |
| 90 | Ga0157370_10014827 | 3300013104 | Bacteria | 7955 |
| 91 | Ga0157369_10002355 | 3300013105 | Bacteria | 22728 |
| 92 | Ga0157369_10022199 | 3300013105 | Bacteria | 7089 |
| 93 | Ga0157369_10037998 | 3300013105 | Bacteria | 5266 |
| 94 | Ga0157369_10724045 | 3300013105 | Unclassified | 1024 |
| 95 | Ga0157369_11846207 | 3300013105 | Bacteria | 614 |
| 96 | Ga0157374_10936459 | 3300013296 | Bacteria | 884 |
| 97 | Ga0157374_12609548 | 3300013296 | Bacteria | 533 |
| 98 | Ga0163162_12399536 | 3300013306 | Bacteria | 606 |
| 99 | Ga0157372_10042820 | 3300013307 | Bacteria | 5010 |
| 100 | Ga0157372_10175353 | 3300013307 | Unclassified | 2481 |
| 101 | Ga0157372_10528423 | 3300013307 | Bacteria | 1375 |
| 102 | Ga0157372_11400710 | 3300013307 | Bacteria | 806 |
| 103 | Ga0163163_10028968 | 3300014325 | Bacteria | 5323 |
| 104 | Ga0157380_11616616 | 3300014326 | Unclassified | 704 |
| 105 | Ga0157377_10167123 | 3300014745 | Bacteria | 1373 |
| 106 | Ga0163161_10114579 | 3300017792 | Bacteria | 2019 |
| 107 | Ga0206355_1110139 | 3300020076 | Bacteria | 1225 |
| 108 | Ga0206351_10390314 | 3300020077 | Unclassified | 1101 |
| 109 | Ga0206350_11393626 | 3300020080 | Unclassified | 925 |
| 110 | Ga0206354_11115091 | 3300020081 | Unclassified | 746 |
| 111 | Ga0206353_11127493 | 3300020082 | Bacteria | 952 |
| 112 | Ga0154015_1082207 | 3300020610 | Unclassified | 1076 |
| 113 | Ga0213874_10160976 | 3300021377 | Bacteria | 789 |
| 114 | Ga0213876_10015764 | 3300021384 | Bacteria | 4000 |
| 115 | Ga0213876_10044201 | 3300021384 | Bacteria | 2354 |
| 116 | Ga0213876_10134291 | 3300021384 | Bacteria | 1316 |
| 117 | Ga0213875_10005613 | 3300021388 | Bacteria | 6703 |
| 118 | Ga0213875_10151420 | 3300021388 | Bacteria | 1087 |
| 119 | Ga0213875_10169626 | 3300021388 | Unclassified | 1024 |
| 120 | Ga0224712_10042200 | 3300022467 | Bacteria | 1727 |
| 121 | Ga0207682_10004181 | 3300025893 | Bacteria | 6099 |
| 122 | Ga0207699_11167520 | 3300025906 | Bacteria | 570 |
| 123 | Ga0207645_10026966 | 3300025907 | Bacteria | 3712 |
| 124 | Ga0207705_10010902 | 3300025909 | Bacteria | 6600 |
| 125 | Ga0207705_10711275 | 3300025909 | Bacteria | 781 |
| 126 | Ga0207707_10000698 | 3300025912 | Bacteria | 33306 |
| 127 | Ga0207695_10001613 | 3300025913 | Bacteria | 36581 |
| 128 | Ga0207695_10012910 | 3300025913 | Bacteria | 9997 |
| 129 | Ga0207695_10061211 | 3300025913 | Bacteria | 3892 |
| 130 | Ga0207671_10013535 | 3300025914 | Bacteria | 6496 |
| 131 | Ga0207660_10108207 | 3300025917 | Bacteria | 2087 |
| 132 | Ga0207660_10499007 | 3300025917 | Bacteria | 987 |
| 133 | Ga0207657_10003237 | 3300025919 | Bacteria | 17428 |
| 134 | Ga0207657_10046526 | 3300025919 | Unclassified | 3799 |
| 135 | Ga0207649_10165969 | 3300025920 | Bacteria | 1534 |
| 136 | Ga0207652_10004401 | 3300025921 | Bacteria | 11477 |
| 137 | Ga0207652_11784205 | 3300025921 | Bacteria | 520 |
| 138 | Ga0207681_10031798 | 3300025923 | Bacteria | 3449 |
| 139 | Ga0207694_10002147 | 3300025924 | Bacteria | 16201 |
| 140 | Ga0207694_10064683 | 3300025924 | Bacteria | 2851 |
| 141 | Ga0207659_10022140 | 3300025926 | Bacteria | 4229 |
| 142 | Ga0207700_10089180 | 3300025928 | Bacteria | 2430 |
| 143 | Ga0207700_10122209 | 3300025928 | Bacteria | 2113 |
| 144 | Ga0207664_10360522 | 3300025929 | Bacteria | 1288 |
| 145 | Ga0207644_10435318 | 3300025931 | Bacteria | 1076 |
| 146 | Ga0207644_11865494 | 3300025931 | Bacteria | 503 |
| 147 | Ga0207686_10014165 | 3300025934 | Bacteria | 4432 |
| 148 | Ga0207686_10210619 | 3300025934 | Bacteria | 1397 |
| 149 | Ga0207709_10134963 | 3300025935 | Bacteria | 1688 |
| 150 | Ga0207670_10075710 | 3300025936 | Bacteria | 2340 |
| 151 | Ga0207670_10143592 | 3300025936 | Bacteria | 1762 |
| 152 | Ga0207669_10722485 | 3300025937 | Bacteria | 820 |
| 153 | Ga0207704_10007256 | 3300025938 | Bacteria | 5222 |
| 154 | Ga0207691_10031093 | 3300025940 | Bacteria | 4986 |
| 155 | Ga0207689_10005346 | 3300025942 | Bacteria | 11500 |
| 156 | Ga0207661_10000376 | 3300025944 | Bacteria | 28667 |
| 157 | Ga0207679_11422417 | 3300025945 | Bacteria | 636 |
| 158 | Ga0207667_10000253 | 3300025949 | Bacteria | 75314 |
| 159 | Ga0207667_10062980 | 3300025949 | Bacteria | 3876 |
| 160 | Ga0207651_10057093 | 3300025960 | Bacteria | 2690 |
| 161 | Ga0207640_10035521 | 3300025981 | Bacteria | 3120 |
| 162 | Ga0207658_10038827 | 3300025986 | Bacteria | 3433 |
| 163 | Ga0207658_10544746 | 3300025986 | Bacteria | 1038 |
| 164 | Ga0207677_10413373 | 3300026023 | Bacteria | 1147 |
| 165 | Ga0207703_10011461 | 3300026035 | Bacteria | 6895 |
| 166 | Ga0207703_10086449 | 3300026035 | Bacteria | 2627 |
| 167 | Ga0207639_10162073 | 3300026041 | Bacteria | 1885 |
| 168 | Ga0207708_10029918 | 3300026075 | Bacteria | 4129 |
| 169 | Ga0207702_10028827 | 3300026078 | Bacteria | 4617 |
| 170 | Ga0207702_11841718 | 3300026078 | Bacteria | 597 |
| 171 | Ga0207641_10038686 | 3300026088 | Bacteria | 3988 |
| 172 | Ga0207648_10001137 | 3300026089 | Bacteria | 29904 |
| 173 | Ga0207674_10000097 | 3300026116 | Bacteria | 98549 |
| 174 | Ga0207675_100017057 | 3300026118 | Bacteria | 6785 |
| 175 | Ga0207683_10248467 | 3300026121 | Bacteria | 1623 |
| 176 | Ga0207698_10040912 | 3300026142 | Bacteria | 3449 |
| 177 | Ga0207698_10389956 | 3300026142 | Bacteria | 1328 |
| 178 | Ga0268266_10105299 | 3300028379 | Bacteria | 2492 |
| 179 | Ga0268265_10804036 | 3300028380 | Bacteria | 917 |
| 180 | Ga0268265_11810140 | 3300028380 | Bacteria | 617 |
| 181 | Ga0268264_10057854 | 3300028381 | Bacteria | 3244 |
| 182 | Ga0268264_10136743 | 3300028381 | Bacteria | 2180 |
| 183 | Ga0268264_11071414 | 3300028381 | Bacteria | 814 |
| 184 | Ga0307414_11804585 | 3300032004 | Bacteria | 571 |
| 185 | Ga0373955_0372606 | 3300035172 | Unclassified | 866 |
| 186 | Ga0395899_0938650 | 3300037312 | Bacteria | 525 |
| 187 | Ga0395900_0708591 | 3300037418 | Bacteria | 940 |
| 188 | Ga0395900_1032173 | 3300037418 | Bacteria | 741 |
| 189 | Ga0436364_0013516 | 3300037853 | Bacteria | 1374 |
| 190 | Ga0436364_0062641 | 3300037853 | Bacteria | 4691 |
| 191 | Ga0436364_0142057 | 3300037853 | Bacteria | 3777 |
| 192 | Ga0436364_0204841 | 3300037853 | Unclassified | 594 |
| 193 | Ga0436364_0337644 | 3300037853 | Unclassified | 1030 |
| 194 | Ga0436364_0428015 | 3300037853 | Bacteria | 1483 |
| 195 | Ga0436364_1099042 | 3300037853 | Bacteria | 1140 |
| 196 | Ga0436364_1343295 | 3300037853 | Bacteria | 10293 |
| 197 | Ga0436364_1454828 | 3300037853 | Unclassified | 3755 |
| 198 | Ga0395901_0149080 | 3300038443 | Bacteria | 2458 |
| 199 | Ga0395901_1881769 | 3300038443 | Bacteria | 546 |
| 200 | Ga0436365_0051105 | 3300039437 | Bacteria | 1940 |
| 201 | Ga0436365_0461944 | 3300039437 | Unclassified | 519 |
| 202 | Ga0436365_0567334 | 3300039437 | Bacteria | 668 |
| 203 | Ga0436365_0726286 | 3300039437 | Unclassified | 3143 |
| 204 | Ga0436365_1320300 | 3300039437 | Unclassified | 554 |
| 205 | Ga0436365_1780951 | 3300039437 | Unclassified | 801 |
| 206 | Ga0436365_1794116 | 3300039437 | Bacteria | 5908 |
| 207 | Ga0436360_0018833 | 3300039438 | Bacteria | 916 |
| 208 | Ga0436360_0587790 | 3300039438 | Bacteria | 10791 |
| 209 | Ga0436363_0634885 | 3300039450 | Bacteria | 2045 |
| 210 | Ga0436363_0876153 | 3300039450 | Unclassified | 934 |
| 211 | Ga0436363_1071062 | 3300039450 | Bacteria | 840 |
| 212 | Ga0436363_1660764 | 3300039450 | Unclassified | 598 |
| 213 | Ga0436362_0396570 | 3300039453 | Bacteria | 1511 |
| 214 | Ga0436362_1108818 | 3300039453 | Bacteria | 3155 |
| 215 | Ga0451853_3788330 | 3300041512 | Bacteria | 574 |
| 216 | Ga0466966_0387360 | 3300044684 | Unclassified | 840 |
| 217 | Ga0466963_0149434 | 3300044694 | Bacteria | 1622 |
| 218 | Ga0466960_1029624 | 3300044901 | Bacteria | 507 |
| 219 | Ga0466967_0869192 | 3300045976 | Unclassified | 896 |
| 220 | Ga0495594_0050859 | 3300046499 | Bacteria | 2280 |
| 221 | Ga0495630_0169272 | 3300046517 | Bacteria | 1664 |
| 222 | Ga0495630_1095565 | 3300046517 | Unclassified | 604 |
| 223 | Ga0495652_0020257 | 3300046529 | Bacteria | 5913 |
| 224 | Ga0495587_0149247 | 3300046536 | Unclassified | 1332 |
| 225 | Ga0495667_0324454 | 3300046559 | Unclassified | 974 |
| 226 | Ga0495599_0010634 | 3300046678 | Bacteria | 5632 |
| 227 | Ga0495636_0077069 | 3300047318 | Unclassified | 1430 |
| 228 | Ga0495680_0100788 | 3300047322 | Bacteria | 2151 |
| 229 | Ga0495684_0093150 | 3300047471 | Bacteria | 2282 |
| 230 | Ga0496102_1332176 | 3300048905 | Unclassified | 637 |
| 231 | Ga0496104_0815032 | 3300048907 | Bacteria | 839 |
| 232 | Ga0496112_1683305 | 3300048915 | Unclassified | 547 |
| 233 | Ga0496112_1785378 | 3300048915 | Unclassified | 527 |
| 234 | Ga0496114_0379246 | 3300048917 | Bacteria | 1252 |
| 235 | Ga0501034_0413290 | 3300049571 | Bacteria | 1271 |
| 236 | nmdc:mga00v17_177881_c1 | 3300050491 | Bacteria | 1372 |
| 237 | nmdc:mga0yw44_467931_c1 | 3300050492 | Archaea | 855 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_11509052 | Ga0070658_115090521 | 123 |
| 2 | 3300005328 | Ga0070676_10366273 | Ga0070676_103662731 | 123 |
| 3 | 3300005337 | Ga0070682_101885154 | Ga0070682_1018851542 | 123 |
| 4 | 3300005367 | Ga0070667_100029195 | Ga0070667_1000291953 | 123 |
| 5 | 3300005367 | Ga0070667_101856969 | Ga0070667_1018569692 | 123 |
| 6 | 3300005841 | Ga0068863_100047358 | Ga0068863_1000473584 | 123 |
| 7 | 3300005843 | Ga0068860_100285698 | Ga0068860_1002856981 | 123 |
| 8 | 3300005844 | Ga0068862_102060881 | Ga0068862_1020608811 | 123 |
| 9 | 3300009177 | Ga0105248_11550029 | Ga0105248_115500292 | 123 |
| 10 | 3300009551 | Ga0105238_12050965 | Ga0105238_120509651 | 123 |
| 11 | 3300010375 | Ga0105239_13464594 | Ga0105239_134645942 | 123 |
| 12 | 3300013102 | Ga0157371_10489948 | Ga0157371_104899482 | 123 |
| 13 | 3300013105 | Ga0157369_11846207 | Ga0157369_118462071 | 123 |
| 14 | 3300013307 | Ga0157372_10528423 | Ga0157372_105284232 | 123 |
| 15 | 3300013307 | Ga0157372_11400710 | Ga0157372_114007101 | 123 |
| 16 | 3300025931 | Ga0207644_11865494 | Ga0207644_118654941 | 123 |
| 17 | 3300025945 | Ga0207679_11422417 | Ga0207679_114224171 | 123 |
| 18 | 3300025986 | Ga0207658_10038827 | Ga0207658_100388272 | 123 |
| 19 | 3300026088 | Ga0207641_10038686 | Ga0207641_100386863 | 123 |
| 20 | 3300028380 | Ga0268265_10804036 | Ga0268265_108040361 | 123 |
| 21 | 3300028381 | Ga0268264_10136743 | Ga0268264_101367432 | 123 |
| 22 | 3300032004 | Ga0307414_11804585 | Ga0307414_118045851 | 123 |
| 23 | 3300037312 | Ga0395899_0938650 | Ga0395899_0938650_99_479 | 123 |
| 24 | 3300037418 | Ga0395900_1032173 | Ga0395900_1032173_28_408 | 123 |
| 25 | 3300038443 | Ga0395901_0149080 | Ga0395901_0149080_1936_2316 | 123 |
| 26 | 3300038443 | Ga0395901_1881769 | Ga0395901_1881769_140_520 | 123 |
| 27 | 3300039438 | Ga0436360_0018833 | Ga0436360_0018833_346_717 | 123 |
| 28 | 3300044901 | Ga0466960_1029624 | Ga0466960_1029624_43_423 | 123 |
| 29 | 3300048915 | Ga0496112_1785378 | Ga0496112_1785378_14_385 | 123 |
| 30 | 3300048917 | Ga0496114_0379246 | Ga0496114_0379246_389_769 | 123 |
| 31 | 3300005327 | Ga0070658_10904592 | Ga0070658_109045921 | 124 |
| 32 | 3300005328 | Ga0070676_10099707 | Ga0070676_100997072 | 124 |
| 33 | 3300005329 | Ga0070683_101150807 | Ga0070683_1011508073 | 124 |
| 34 | 3300005329 | Ga0070683_101527654 | Ga0070683_1015276542 | 124 |
| 35 | 3300005330 | Ga0070690_100016588 | Ga0070690_1000165884 | 124 |
| 36 | 3300005333 | Ga0070677_10260752 | Ga0070677_102607522 | 124 |
| 37 | 3300005334 | Ga0068869_100002479 | Ga0068869_10000247911 | 124 |
| 38 | 3300005336 | Ga0070680_100027031 | Ga0070680_1000270313 | 124 |
| 39 | 3300005336 | Ga0070680_101286692 | Ga0070680_1012866921 | 124 |
| 40 | 3300005338 | Ga0068868_101235844 | Ga0068868_1012358442 | 124 |
| 41 | 3300005339 | Ga0070660_100026355 | Ga0070660_1000263554 | 124 |
| 42 | 3300005339 | Ga0070660_100038571 | Ga0070660_1000385713 | 124 |
| 43 | 3300005340 | Ga0070689_100120269 | Ga0070689_1001202692 | 124 |
| 44 | 3300005340 | Ga0070689_100154668 | Ga0070689_1001546682 | 124 |
| 45 | 3300005341 | Ga0070691_10030942 | Ga0070691_100309424 | 124 |
| 46 | 3300005353 | Ga0070669_100264902 | Ga0070669_1002649022 | 124 |
| 47 | 3300005354 | Ga0070675_100001621 | Ga0070675_1000016218 | 124 |
| 48 | 3300005355 | Ga0070671_100362783 | Ga0070671_1003627832 | 124 |
| 49 | 3300005364 | Ga0070673_100020088 | Ga0070673_1000200883 | 124 |
| 50 | 3300005365 | Ga0070688_100136490 | Ga0070688_1001364902 | 124 |
| 51 | 3300005367 | Ga0070667_100640427 | Ga0070667_1006404272 | 124 |
| 52 | 3300005367 | Ga0070667_100939030 | Ga0070667_1009390302 | 124 |
| 53 | 3300005436 | Ga0070713_100013675 | Ga0070713_1000136754 | 124 |
| 54 | 3300005436 | Ga0070713_100043922 | Ga0070713_1000439226 | 124 |
| 55 | 3300005438 | Ga0070701_10009264 | Ga0070701_100092642 | 124 |
| 56 | 3300005441 | Ga0070700_100082832 | Ga0070700_1000828322 | 124 |
| 57 | 3300005456 | Ga0070678_100329185 | Ga0070678_1003291852 | 124 |
| 58 | 3300005458 | Ga0070681_10196958 | Ga0070681_101969583 | 124 |
| 59 | 3300005458 | Ga0070681_10787156 | Ga0070681_107871561 | 124 |
| 60 | 3300005459 | Ga0068867_100005747 | Ga0068867_1000057474 | 124 |
| 61 | 3300005530 | Ga0070679_100018221 | Ga0070679_1000182213 | 124 |
| 62 | 3300005535 | Ga0070684_100006622 | Ga0070684_10000662210 | 124 |
| 63 | 3300005539 | Ga0068853_100091014 | Ga0068853_1000910144 | 124 |
| 64 | 3300005539 | Ga0068853_101932794 | Ga0068853_1019327942 | 124 |
| 65 | 3300005543 | Ga0070672_100022640 | Ga0070672_1000226405 | 124 |
| 66 | 3300005544 | Ga0070686_100546403 | Ga0070686_1005464032 | 124 |
| 67 | 3300005548 | Ga0070665_100367722 | Ga0070665_1003677222 | 124 |
| 68 | 3300005548 | Ga0070665_100783265 | Ga0070665_1007832652 | 124 |
| 69 | 3300005563 | Ga0068855_100102606 | Ga0068855_1001026063 | 124 |
| 70 | 3300005577 | Ga0068857_100007886 | Ga0068857_10000788611 | 124 |
| 71 | 3300005578 | Ga0068854_100143045 | Ga0068854_1001430452 | 124 |
| 72 | 3300005578 | Ga0068854_100186865 | Ga0068854_1001868651 | 124 |
| 73 | 3300005578 | Ga0068854_100462005 | Ga0068854_1004620051 | 124 |
| 74 | 3300005614 | Ga0068856_100001598 | Ga0068856_10000159817 | 124 |
| 75 | 3300005614 | Ga0068856_100018153 | Ga0068856_1000181536 | 124 |
| 76 | 3300005616 | Ga0068852_100055546 | Ga0068852_1000555462 | 124 |
| 77 | 3300005616 | Ga0068852_100334061 | Ga0068852_1003340612 | 124 |
| 78 | 3300005617 | Ga0068859_100045205 | Ga0068859_1000452052 | 124 |
| 79 | 3300005617 | Ga0068859_101213977 | Ga0068859_1012139772 | 124 |
| 80 | 3300005719 | Ga0068861_100014453 | Ga0068861_1000144534 | 124 |
| 81 | 3300005842 | Ga0068858_100062032 | Ga0068858_1000620322 | 124 |
| 82 | 3300005843 | Ga0068860_100068385 | Ga0068860_1000683852 | 124 |
| 83 | 3300005843 | Ga0068860_101426734 | Ga0068860_1014267341 | 124 |
| 84 | 3300005844 | Ga0068862_101796277 | Ga0068862_1017962772 | 124 |
| 85 | 3300005937 | Ga0081455_10022431 | Ga0081455_100224315 | 124 |
| 86 | 3300006358 | Ga0068871_100157289 | Ga0068871_1001572892 | 124 |
| 87 | 3300006846 | Ga0075430_100004174 | Ga0075430_1000041749 | 124 |
| 88 | 3300006881 | Ga0068865_100006623 | Ga0068865_1000066236 | 124 |
| 89 | 3300006931 | Ga0097620_100045206 | Ga0097620_1000452062 | 124 |
| 90 | 3300006931 | Ga0097620_101213980 | Ga0097620_1012139802 | 124 |
| 91 | 3300009093 | Ga0105240_10006444 | Ga0105240_100064445 | 124 |
| 92 | 3300009093 | Ga0105240_10051948 | Ga0105240_100519485 | 124 |
| 93 | 3300009093 | Ga0105240_10343082 | Ga0105240_103430822 | 124 |
| 94 | 3300009093 | Ga0105240_10438203 | Ga0105240_104382033 | 124 |
| 95 | 3300009098 | Ga0105245_10219011 | Ga0105245_102190113 | 124 |
| 96 | 3300009148 | Ga0105243_10020195 | Ga0105243_100201954 | 124 |
| 97 | 3300009174 | Ga0105241_10003203 | Ga0105241_1000320310 | 124 |
| 98 | 3300009174 | Ga0105241_10138775 | Ga0105241_101387752 | 124 |
| 99 | 3300009176 | Ga0105242_10024408 | Ga0105242_100244084 | 124 |
| 100 | 3300009177 | Ga0105248_11653272 | Ga0105248_116532721 | 124 |
| 101 | 3300009177 | Ga0105248_11663020 | Ga0105248_116630201 | 124 |
| 102 | 3300009545 | Ga0105237_10002468 | Ga0105237_100024684 | 124 |
| 103 | 3300009545 | Ga0105237_10003436 | Ga0105237_100034369 | 124 |
| 104 | 3300009545 | Ga0105237_10549339 | Ga0105237_105493391 | 124 |
| 105 | 3300009551 | Ga0105238_10051490 | Ga0105238_100514903 | 124 |
| 106 | 3300010375 | Ga0105239_10005790 | Ga0105239_1000579013 | 124 |
| 107 | 3300011119 | Ga0105246_10244201 | Ga0105246_102442013 | 124 |
| 108 | 3300013104 | Ga0157370_10014827 | Ga0157370_100148277 | 124 |
| 109 | 3300013105 | Ga0157369_10002355 | Ga0157369_100023559 | 124 |
| 110 | 3300013105 | Ga0157369_10022199 | Ga0157369_100221993 | 124 |
| 111 | 3300013105 | Ga0157369_10037998 | Ga0157369_100379984 | 124 |
| 112 | 3300013105 | Ga0157369_10724045 | Ga0157369_107240452 | 124 |
| 113 | 3300013296 | Ga0157374_10936459 | Ga0157374_109364592 | 124 |
| 114 | 3300013296 | Ga0157374_12609548 | Ga0157374_126095482 | 124 |
| 115 | 3300013306 | Ga0163162_12399536 | Ga0163162_123995361 | 124 |
| 116 | 3300013307 | Ga0157372_10042820 | Ga0157372_100428203 | 124 |
| 117 | 3300013307 | Ga0157372_10175353 | Ga0157372_101753533 | 124 |
| 118 | 3300014325 | Ga0163163_10028968 | Ga0163163_100289682 | 124 |
| 119 | 3300014326 | Ga0157380_11616616 | Ga0157380_116166161 | 124 |
| 120 | 3300014745 | Ga0157377_10167123 | Ga0157377_101671232 | 124 |
| 121 | 3300017792 | Ga0163161_10114579 | Ga0163161_101145793 | 124 |
| 122 | 3300020076 | Ga0206355_1110139 | Ga0206355_11101393 | 124 |
| 123 | 3300020077 | Ga0206351_10390314 | Ga0206351_103903142 | 124 |
| 124 | 3300020080 | Ga0206350_11393626 | Ga0206350_113936262 | 124 |
| 125 | 3300020081 | Ga0206354_11115091 | Ga0206354_111150912 | 124 |
| 126 | 3300020082 | Ga0206353_11127493 | Ga0206353_111274932 | 124 |
| 127 | 3300020610 | Ga0154015_1082207 | Ga0154015_10822072 | 124 |
| 128 | 3300021377 | Ga0213874_10160976 | Ga0213874_101609761 | 124 |
| 129 | 3300021384 | Ga0213876_10015764 | Ga0213876_100157642 | 124 |
| 130 | 3300021384 | Ga0213876_10044201 | Ga0213876_100442012 | 124 |
| 131 | 3300021384 | Ga0213876_10134291 | Ga0213876_101342912 | 124 |
| 132 | 3300021388 | Ga0213875_10005613 | Ga0213875_100056137 | 124 |
| 133 | 3300021388 | Ga0213875_10151420 | Ga0213875_101514202 | 124 |
| 134 | 3300021388 | Ga0213875_10169626 | Ga0213875_101696261 | 124 |
| 135 | 3300022467 | Ga0224712_10042200 | Ga0224712_100422003 | 124 |
| 136 | 3300025893 | Ga0207682_10004181 | Ga0207682_100041814 | 124 |
| 137 | 3300025906 | Ga0207699_11167520 | Ga0207699_111675201 | 124 |
| 138 | 3300025907 | Ga0207645_10026966 | Ga0207645_100269663 | 124 |
| 139 | 3300025909 | Ga0207705_10010902 | Ga0207705_100109023 | 124 |
| 140 | 3300025909 | Ga0207705_10711275 | Ga0207705_107112752 | 124 |
| 141 | 3300025912 | Ga0207707_10000698 | Ga0207707_1000069829 | 124 |
| 142 | 3300025913 | Ga0207695_10001613 | Ga0207695_1000161328 | 124 |
| 143 | 3300025913 | Ga0207695_10012910 | Ga0207695_100129103 | 124 |
| 144 | 3300025913 | Ga0207695_10061211 | Ga0207695_100612113 | 124 |
| 145 | 3300025914 | Ga0207671_10013535 | Ga0207671_100135352 | 124 |
| 146 | 3300025917 | Ga0207660_10108207 | Ga0207660_101082073 | 124 |
| 147 | 3300025917 | Ga0207660_10499007 | Ga0207660_104990072 | 124 |
| 148 | 3300025919 | Ga0207657_10003237 | Ga0207657_100032372 | 124 |
| 149 | 3300025919 | Ga0207657_10046526 | Ga0207657_100465264 | 124 |
| 150 | 3300025920 | Ga0207649_10165969 | Ga0207649_101659691 | 124 |
| 151 | 3300025921 | Ga0207652_10004401 | Ga0207652_1000440110 | 124 |
| 152 | 3300025921 | Ga0207652_11784205 | Ga0207652_117842052 | 124 |
| 153 | 3300025923 | Ga0207681_10031798 | Ga0207681_100317984 | 124 |
| 154 | 3300025924 | Ga0207694_10002147 | Ga0207694_1000214716 | 124 |
| 155 | 3300025924 | Ga0207694_10064683 | Ga0207694_100646832 | 124 |
| 156 | 3300025926 | Ga0207659_10022140 | Ga0207659_100221402 | 124 |
| 157 | 3300025928 | Ga0207700_10089180 | Ga0207700_100891803 | 124 |
| 158 | 3300025928 | Ga0207700_10122209 | Ga0207700_101222092 | 124 |
| 159 | 3300025929 | Ga0207664_10360522 | Ga0207664_103605221 | 124 |
| 160 | 3300025931 | Ga0207644_10435318 | Ga0207644_104353182 | 124 |
| 161 | 3300025934 | Ga0207686_10014165 | Ga0207686_100141654 | 124 |
| 162 | 3300025934 | Ga0207686_10210619 | Ga0207686_102106191 | 124 |
| 163 | 3300025935 | Ga0207709_10134963 | Ga0207709_101349632 | 124 |
| 164 | 3300025936 | Ga0207670_10075710 | Ga0207670_100757102 | 124 |
| 165 | 3300025936 | Ga0207670_10143592 | Ga0207670_101435923 | 124 |
| 166 | 3300025937 | Ga0207669_10722485 | Ga0207669_107224851 | 124 |
| 167 | 3300025938 | Ga0207704_10007256 | Ga0207704_100072565 | 124 |
| 168 | 3300025940 | Ga0207691_10031093 | Ga0207691_100310932 | 124 |
| 169 | 3300025942 | Ga0207689_10005346 | Ga0207689_1000534610 | 124 |
| 170 | 3300025944 | Ga0207661_10000376 | Ga0207661_1000037632 | 124 |
| 171 | 3300025949 | Ga0207667_10000253 | Ga0207667_1000025352 | 124 |
| 172 | 3300025949 | Ga0207667_10062980 | Ga0207667_100629803 | 124 |
| 173 | 3300025960 | Ga0207651_10057093 | Ga0207651_100570933 | 124 |
| 174 | 3300025981 | Ga0207640_10035521 | Ga0207640_100355213 | 124 |
| 175 | 3300025986 | Ga0207658_10544746 | Ga0207658_105447462 | 124 |
| 176 | 3300026023 | Ga0207677_10413373 | Ga0207677_104133732 | 124 |
| 177 | 3300026035 | Ga0207703_10011461 | Ga0207703_100114611 | 124 |
| 178 | 3300026035 | Ga0207703_10086449 | Ga0207703_100864492 | 124 |
| 179 | 3300026041 | Ga0207639_10162073 | Ga0207639_101620734 | 124 |
| 180 | 3300026075 | Ga0207708_10029918 | Ga0207708_100299184 | 124 |
| 181 | 3300026078 | Ga0207702_10028827 | Ga0207702_100288274 | 124 |
| 182 | 3300026078 | Ga0207702_11841718 | Ga0207702_118417181 | 124 |
| 183 | 3300026089 | Ga0207648_10001137 | Ga0207648_1000113725 | 124 |
| 184 | 3300026116 | Ga0207674_10000097 | Ga0207674_1000009774 | 124 |
| 185 | 3300026118 | Ga0207675_100017057 | Ga0207675_1000170574 | 124 |
| 186 | 3300026121 | Ga0207683_10248467 | Ga0207683_102484672 | 124 |
| 187 | 3300026142 | Ga0207698_10040912 | Ga0207698_100409123 | 124 |
| 188 | 3300026142 | Ga0207698_10389956 | Ga0207698_103899562 | 124 |
| 189 | 3300028379 | Ga0268266_10105299 | Ga0268266_101052994 | 124 |
| 190 | 3300028380 | Ga0268265_11810140 | Ga0268265_118101401 | 124 |
| 191 | 3300028381 | Ga0268264_10057854 | Ga0268264_100578542 | 124 |
| 192 | 3300028381 | Ga0268264_11071414 | Ga0268264_110714141 | 124 |
| 193 | 3300035172 | Ga0373955_0372606 | Ga0373955_0372606_280_663 | 124 |
| 194 | 3300037418 | Ga0395900_0708591 | Ga0395900_0708591_399_776 | 124 |
| 195 | 3300037853 | Ga0436364_0013516 | Ga0436364_0013516_14_391 | 124 |
| 196 | 3300037853 | Ga0436364_0062641 | Ga0436364_0062641_3702_4076 | 124 |
| 197 | 3300037853 | Ga0436364_0142057 | Ga0436364_0142057_389_820 | 124 |
| 198 | 3300037853 | Ga0436364_0204841 | Ga0436364_0204841_61_435 | 124 |
| 199 | 3300037853 | Ga0436364_0337644 | Ga0436364_0337644_34_408 | 124 |
| 200 | 3300037853 | Ga0436364_0428015 | Ga0436364_0428015_270_644 | 124 |
| 201 | 3300037853 | Ga0436364_1099042 | Ga0436364_1099042_716_1090 | 124 |
| 202 | 3300037853 | Ga0436364_1343295 | Ga0436364_1343295_6703_7083 | 124 |
| 203 | 3300037853 | Ga0436364_1454828 | Ga0436364_1454828_3303_3680 | 124 |
| 204 | 3300039437 | Ga0436365_0051105 | Ga0436365_0051105_431_823 | 124 |
| 205 | 3300039437 | Ga0436365_0461944 | Ga0436365_0461944_28_444 | 124 |
| 206 | 3300039437 | Ga0436365_0567334 | Ga0436365_0567334_43_417 | 124 |
| 207 | 3300039437 | Ga0436365_0726286 | Ga0436365_0726286_2620_2997 | 124 |
| 208 | 3300039437 | Ga0436365_1320300 | Ga0436365_1320300_128_502 | 124 |
| 209 | 3300039437 | Ga0436365_1780951 | Ga0436365_1780951_64_441 | 124 |
| 210 | 3300039437 | Ga0436365_1794116 | Ga0436365_1794116_600_1031 | 124 |
| 211 | 3300039438 | Ga0436360_0587790 | Ga0436360_0587790_204_581 | 124 |
| 212 | 3300039450 | Ga0436363_0634885 | Ga0436363_0634885_1585_2001 | 124 |
| 213 | 3300039450 | Ga0436363_0876153 | Ga0436363_0876153_214_588 | 124 |
| 214 | 3300039450 | Ga0436363_1071062 | Ga0436363_1071062_397_771 | 124 |
| 215 | 3300039450 | Ga0436363_1660764 | Ga0436363_1660764_169_543 | 124 |
| 216 | 3300039453 | Ga0436362_0396570 | Ga0436362_0396570_519_893 | 124 |
| 217 | 3300039453 | Ga0436362_1108818 | Ga0436362_1108818_1334_1864 | 124 |
| 218 | 3300041512 | Ga0451853_3788330 | Ga0451853_3788330_47_424 | 124 |
| 219 | 3300044684 | Ga0466966_0387360 | Ga0466966_0387360_256_630 | 124 |
| 220 | 3300044694 | Ga0466963_0149434 | Ga0466963_0149434_967_1353 | 124 |
| 221 | 3300045976 | Ga0466967_0869192 | Ga0466967_0869192_340_714 | 124 |
| 222 | 3300046499 | Ga0495594_0050859 | Ga0495594_0050859_697_1074 | 124 |
| 223 | 3300046517 | Ga0495630_0169272 | Ga0495630_0169272_99_482 | 124 |
| 224 | 3300046517 | Ga0495630_1095565 | Ga0495630_1095565_10_387 | 124 |
| 225 | 3300046529 | Ga0495652_0020257 | Ga0495652_0020257_1327_1704 | 124 |
| 226 | 3300046536 | Ga0495587_0149247 | Ga0495587_0149247_185_562 | 124 |
| 227 | 3300046559 | Ga0495667_0324454 | Ga0495667_0324454_461_838 | 124 |
| 228 | 3300046678 | Ga0495599_0010634 | Ga0495599_0010634_2300_2677 | 124 |
| 229 | 3300047318 | Ga0495636_0077069 | Ga0495636_0077069_215_589 | 124 |
| 230 | 3300047322 | Ga0495680_0100788 | Ga0495680_0100788_966_1343 | 124 |
| 231 | 3300047471 | Ga0495684_0093150 | Ga0495684_0093150_40_417 | 124 |
| 232 | 3300048905 | Ga0496102_1332176 | Ga0496102_1332176_204_584 | 124 |
| 233 | 3300048907 | Ga0496104_0815032 | Ga0496104_0815032_290_676 | 124 |
| 234 | 3300048915 | Ga0496112_1683305 | Ga0496112_1683305_82_462 | 124 |
| 235 | 3300049571 | Ga0501034_0413290 | Ga0501034_0413290_273_647 | 124 |
| 236 | 3300050491 | nmdc:mga00v17_177881_c1 | nmdc:mga00v17_177881_c1_473_850 | 124 |
| 237 | 3300050492 | nmdc:mga0yw44_467931_c1 | nmdc:mga0yw44_467931_c1_304_681 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qrw-assembly1.cif.gz_H | crystal structure of mycobacterium tuberculosis trhbo wg8f mutant | 0.9453 | 6 | 122 |
| 2qrw-assembly7.cif.gz_J | crystal structure of mycobacterium tuberculosis trhbo wg8f mutant | 0.9451 | 5 | 122 |
| 2bmm-assembly1.cif.gz_A | x-ray structure of a novel thermostable hemoglobin from the actinobacterium thermobifida fusca | 0.9327 | 6 | 122 |
| 1ux8-assembly1.cif.gz_A | x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis | 0.9324 | 6 | 122 |
| 5d1v-assembly1.cif.gz_B | crystal structure and thermal stability of hemoglobin from thermophilic phototrophic bacterium chloroflexus aurantiacus | 0.9323 | 6 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G202_1_105_1.10.490.10 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9403 | 19 | 123 | 1.10.490.10 |
| 2bmmA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9327 | 6 | 122 | 1.10.490.10 |
| 5d1vB00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9323 | 6 | 123 | 1.10.490.10 |
| af_Q69XE4_1_153_1.10.490.10 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9305 | 5 | 121 | 1.10.490.10 |
| 1ux8A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9248 | 6 | 123 | 1.10.490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C9CHQ5-F1-model_v4 | Hemoglobin | 0.9629 | 4 | 123 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A3L7PR80-F1-model_v4 | Globin | 0.9607 | 6 | 124 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A6J6ILS9-F1-model_v4 | Unannotated protein | 0.9603 | 6 | 123 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A6L6AVE5-F1-model_v4 | Globin | 0.9595 | 6 | 123 |
GO:0005344
GO:0019825 GO:0020037 |
| AF-A0A7J5BH39-F1-model_v4 | Globin | 0.9589 | 6 | 123 |
GO:0005344
GO:0019825 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar