F349722

General Info

Members Datasets Scaffolds Average Seq Length
237 165 221 409

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100161151|Ga0070682_1001611512
Length 442
Sequence MFIALLLYLLLVLIRPQDYPALADYATVPLQPVVLLVAAGLWLFAPDKRFEAPQYLLLGAFFMAMLASHVFNGWVGGAIEQAGKFAPIVLAFVVFANGLDRRSRILRVMAMFAACGTVLAVHGIEQATTGRSWTGIELSQGTRIQYVGIFNDPNDLGMLFVACVPMAAYLGSRGGLLGLRRLFWMLALGVLVYGVYLTDSRGALLALLAVMGVFVWQRRGLMTAGALGAMAVGVLLALPSRFSEIDPEEESAQGRVESWFEGLQMFREHPLFGVGPDQYTDYNPLTAHNSFVLVLAETGIVGFTIWLAFVVYGFRMMWAGSRPLGELTWESEAAPAADGDAELALAELDAIEADMAEGRAISMTLLLSLVGFFTASFFLSRSYVIVLYLLSALVVAQYTEQRRGDPALPSFALGDDLLLWPVVGLCSTIGLYILVKILLVMQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221695 Lysobacter sp. Root494 Isolate Unclassified
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
10 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
11 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
12 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
13 2919085039 Luteibacter sp. 1214 Isolate Unclassified
14 2919404418 Luteibacter sp. 3190 Isolate Unclassified
15 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
16 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
103 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
158 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0
Isolates 6.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.03
Nodule 0
Rhizoplane 2.11
Rhizosphere 64.98
Stem 0
Stem Tuber 0
Unclassified 16.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2041178 2162886007 Bacteria 2769
2 JGI25156J39149_1005579 3300002705 Bacteria 3598
3 JGI25162J39368_1001563 3300002737 Bacteria 11697
4 JGI25157J39369_1000619 3300002741 Bacteria 20119
5 JGI25157J39369_1002573 3300002741 Bacteria 4348
6 JGI25164J39214_1000267 3300002772 Bacteria 38724
7 JGI25165J46597_1000481 3300003214 Bacteria 38724
8 rootH2_10000036 3300003320 Bacteria 53611
9 rootH2_10068682 3300003320 Bacteria 5078
10 Ga0055539_1003983 3300003752 Bacteria 2003
11 Ga0055533_1006216 3300003756 Bacteria 1794
12 Ga0055527_1000076 3300003760 Bacteria 79882
13 Ga0055527_1001362 3300003760 Bacteria 5232
14 Ga0055535_1000129 3300003761 Bacteria 79882
15 Ga0055535_1000261 3300003761 Bacteria 55503
16 Ga0055535_1000476 3300003761 Bacteria 36526
17 Ga0055542_1000054 3300003762 Bacteria 171728
18 Ga0055542_1000173 3300003762 Bacteria 79882
19 Ga0055542_1000697 3300003762 Bacteria 26532
20 Ga0055529_1000200 3300003763 Bacteria 79875
21 Ga0055529_1000370 3300003763 Bacteria 48537
22 Ga0055531_10009887 3300003794 Bacteria 4824
23 Ga0065165_1000635 3300005262 Bacteria 50838
24 Ga0065704_10072023 3300005289 Bacteria 9367
25 Ga0070658_10002436 3300005327 Bacteria 15569
26 Ga0070666_10000012 3300005335 Bacteria 244720
27 Ga0070666_10092373 3300005335 Bacteria 2081
28 Ga0070682_100002418 3300005337 Bacteria 10333
29 Ga0070682_100161151 3300005337 Bacteria 1549
30 Ga0070660_100051433 3300005339 Bacteria 3173
31 Ga0070661_100015525 3300005344 Bacteria 5374
32 Ga0070661_100019247 3300005344 Bacteria 4864
33 Ga0070668_100021424 3300005347 Bacteria 4882
34 Ga0070673_100188591 3300005364 Bacteria 1770
35 Ga0070659_100000104 3300005366 Bacteria 62137
36 Ga0070667_100014197 3300005367 Bacteria 6580
37 Ga0070667_100020573 3300005367 Bacteria 5478
38 Ga0070667_100211781 3300005367 Bacteria 1722
39 Ga0070663_100219165 3300005455 Unclassified 1493
40 Ga0070681_10010770 3300005458 Bacteria 9037
41 Ga0070681_10023323 3300005458 Bacteria 6222
42 Ga0070681_10063510 3300005458 Bacteria 3664
43 Ga0070679_100137659 3300005530 Bacteria 2423
44 Ga0068853_100012256 3300005539 Bacteria 6972
45 Ga0070665_100000126 3300005548 Bacteria 146495
46 Ga0070665_100008117 3300005548 Bacteria 10629
47 Ga0070665_100035337 3300005548 Bacteria 5024
48 Ga0070665_100056485 3300005548 Bacteria 3935
49 Ga0070665_100077102 3300005548 Bacteria 3339
50 Ga0070665_100111014 3300005548 Bacteria 2744
51 Ga0070665_100268531 3300005548 Bacteria 1707
52 Ga0068856_100000411 3300005614 Bacteria 47139
53 Ga0068859_100000830 3300005617 Bacteria 31442
54 Ga0068864_100237102 3300005618 Bacteria 1689
55 Ga0068851_10006462 3300005834 Bacteria 5352
56 Ga0068860_100027626 3300005843 Bacteria 5464
57 Ga0068860_100094149 3300005843 Bacteria 2855
58 Ga0068860_100097352 3300005843 Unclassified 2805
59 Ga0068862_100000282 3300005844 Bacteria 56669
60 Ga0068862_100032478 3300005844 Bacteria 4410
61 Ga0081540_1000431 3300005983 Bacteria 41301
62 Ga0068871_100287504 3300006358 Bacteria 1440
63 Ga0097620_100000830 3300006931 Bacteria 31442
64 Ga0105240_10000317 3300009093 Bacteria 91950
65 Ga0105240_10004334 3300009093 Bacteria 21662
66 Ga0105237_10019208 3300009545 Bacteria 7061
67 Ga0105238_10000109 3300009551 Bacteria 90227
68 Ga0105238_10013675 3300009551 Bacteria 8196
69 Ga0105028_101044 3300009993 Bacteria 2925
70 Ga0105239_10000034 3300010375 Bacteria 219430
71 Ga0163162_10000127 3300013306 Bacteria 68205
72 Ga0157372_10077103 3300013307 Bacteria 3764
73 Ga0209674_100026 3300025226 Bacteria 490631
74 Ga0209672_100017 3300025228 Bacteria 514236
75 Ga0209672_100499 3300025228 Bacteria 21778
76 Ga0209672_103035 3300025228 Bacteria 3660
77 Ga0207427_100203 3300025231 Bacteria 54842
78 Ga0209437_100344 3300025233 Bacteria 54936
79 Ga0209258_100038 3300025242 Bacteria 398959
80 Ga0209258_100045 3300025242 Bacteria 369941
81 Ga0209258_100430 3300025242 Bacteria 48595
82 Ga0209646_1000886 3300025246 Bacteria 9880
83 Ga0209026_1000044 3300025250 Bacteria 266550
84 Ga0209026_1002080 3300025250 Bacteria 7877
85 Ga0209677_106284 3300025253 Bacteria 2851
86 Ga0209148_1000009 3300025254 Bacteria 1395625
87 Ga0209148_1000052 3300025254 Bacteria 399449
88 Ga0209148_1000125 3300025254 Bacteria 184380
89 Ga0209759_1000124 3300025256 Bacteria 135714
90 Ga0209759_1002753 3300025256 Bacteria 7462
91 Ga0209233_1000270 3300025261 Bacteria 73977
92 Ga0209455_1000032 3300025272 Bacteria 514243
93 Ga0209455_1000077 3300025272 Bacteria 279165
94 Ga0209676_1000024 3300025292 Bacteria 578839
95 Ga0209758_1025597 3300025297 Bacteria 2583
96 Ga0209256_1005446 3300025299 Bacteria 7325
97 Ga0209257_1000217 3300025304 Bacteria 136049
98 Ga0207680_10000013 3300025903 Bacteria 244716
99 Ga0207680_10079374 3300025903 Bacteria 2058
100 Ga0207645_10009086 3300025907 Bacteria 6894
101 Ga0207705_10022289 3300025909 Bacteria 4517
102 Ga0207707_10011280 3300025912 Bacteria 7777
103 Ga0207695_10000364 3300025913 Bacteria 103483
104 Ga0207695_10003611 3300025913 Bacteria 21639
105 Ga0207649_10042977 3300025920 Bacteria 2760
106 Ga0207694_10000398 3300025924 Bacteria 40446
107 Ga0207694_10040129 3300025924 Bacteria 3603
108 Ga0207690_10020541 3300025932 Bacteria 4082
109 Ga0207691_10018826 3300025940 Bacteria 6540
110 Ga0207668_10055882 3300025972 Bacteria 2746
111 Ga0207658_10009833 3300025986 Bacteria 6495
112 Ga0207658_10060362 3300025986 Bacteria 2829
113 Ga0207639_10010378 3300026041 Bacteria 6449
114 Ga0207678_10001878 3300026067 Bacteria 19175
115 Ga0207702_10005109 3300026078 Bacteria 11539
116 Ga0268266_10000001 3300028379 Bacteria 4040580
117 Ga0268266_10000021 3300028379 Bacteria 522453
118 Ga0268266_10034284 3300028379 Bacteria 4317
119 Ga0268265_10000227 3300028380 Bacteria 65261
120 Ga0268265_10022635 3300028380 Bacteria 4418
121 Ga0268264_10053549 3300028381 Bacteria 3367
122 Ga0307513_10012244 3300031456 Bacteria 10605
123 Ga0307413_10030288 3300031824 Bacteria 3039
124 Ga0307415_100102883 3300032126 Bacteria 2100
125 Ga0307510_10000797 3300033180 Bacteria 32641
126 Ga0395899_0000046 3300037312 Bacteria 242486
127 Ga0395899_0002367 3300037312 Bacteria 15356
128 Ga0395900_0000034 3300037418 Bacteria 258846
129 Ga0395898_0000081 3300037466 Bacteria 242472
130 Ga0395898_0000835 3300037466 Bacteria 51046
131 Ga0439465_0001119 3300041413 Bacteria 8590
132 Ga0439465_0011639 3300041413 Bacteria 2760
133 Ga0451791_0318918 3300041451 Bacteria 3994
134 Ga0451793_0058161 3300041452 Unclassified 1304
135 Ga0451807_1601795 3300041486 Bacteria 1773
136 Ga0451837_1791662 3300041494 Bacteria 3835
137 Ga0439449_0000024 3300042007 Bacteria 44788
138 Ga0439449_0000349 3300042007 Bacteria 16883
139 Ga0450908_000024 3300042184 Bacteria 36628
140 Ga0439434_0031147 3300042435 Bacteria 1621
141 Ga0451577_0004837 3300042876 Bacteria 14052
142 Ga0451577_0011411 3300042876 Bacteria 8406
143 Ga0466969_0015486 3300044656 Bacteria 3996
144 Ga0466982_0000080 3300044672 Bacteria 25095
145 Ga0466966_0051971 3300044684 Bacteria 2604
146 Ga0466961_0002603 3300044693 Bacteria 11205
147 Ga0466961_0003873 3300044693 Bacteria 9348
148 Ga0466961_0008308 3300044693 Bacteria 6610
149 Ga0466963_0032596 3300044694 Bacteria 3376
150 Ga0453684_0000356 3300044712 Bacteria 189329
151 Ga0466970_0001333 3300044765 Bacteria 11935
152 Ga0466970_0035843 3300044765 Bacteria 2627
153 Ga0466957_0001045 3300044842 Bacteria 14277
154 Ga0466959_0117882 3300045049 Bacteria 1889
155 Ga0495638_0000069 3300046460 Bacteria 167503
156 Ga0495638_0000280 3300046460 Bacteria 68240
157 Ga0495638_0002274 3300046460 Bacteria 15878
158 Ga0495650_0000501 3300046471 Bacteria 59165
159 Ga0495650_0002943 3300046471 Bacteria 12897
160 Ga0495606_0000050 3300046507 Bacteria 203375
161 Ga0495606_0007366 3300046507 Bacteria 9877
162 Ga0495663_0004670 3300046525 Bacteria 3837
163 Ga0495625_0008629 3300046660 Bacteria 8669
164 Ga0495671_0015869 3300046692 Bacteria 4032
165 Ga0495649_0001559 3300046694 Bacteria 17191
166 Ga0496101_0002700 3300048904 Bacteria 10886
167 Ga0496115_0000093 3300048918 Bacteria 83222
168 Ga0496117_0016599 3300048920 Bacteria 6202
169 Ga0496117_0072616 3300048920 Bacteria 2299
170 Ga0496118_0000182 3300048921 Bacteria 110967
171 Ga0496118_0001398 3300048921 Bacteria 36389
172 Ga0496118_0001733 3300048921 Bacteria 31716
173 Ga0496119_0000093 3300048922 Bacteria 130450
174 Ga0496120_0000124 3300048923 Bacteria 129191
175 Ga0496121_0000013 3300048924 Bacteria 614976
176 Ga0496122_0045573 3300048925 Bacteria 3407
177 Ga0496125_0016128 3300048928 Bacteria 7186
178 Ga0496126_0000402 3300048929 Bacteria 87911
179 Ga0496126_0002838 3300048929 Bacteria 22687
180 Ga0496126_0035867 3300048929 Bacteria 4642
181 Ga0501031_0010522 3300049568 Bacteria 6023
182 Ga0501031_0042374 3300049568 Bacteria 2972
183 Ga0501033_0005734 3300049570 Bacteria 9787
184 Ga0501034_0000122 3300049571 Bacteria 144085
185 Ga0501034_0021089 3300049571 Bacteria 6648
186 Ga0501034_0030818 3300049571 Bacteria 5451
187 Ga0501036_0023087 3300049572 Bacteria 5235
188 Ga0501037_0020934 3300049573 Bacteria 4830
189 Ga0501038_0032311 3300049574 Unclassified 4618
190 Ga0501039_0009664 3300049575 Bacteria 7352
191 Ga0501043_0020817 3300049579 Bacteria 5144
192 Ga0501046_0022086 3300049580 Bacteria 5245
193 Ga0501047_0019014 3300049581 Bacteria 6589
194 Ga0501047_0044150 3300049581 Unclassified 4305
195 Ga0501047_0298513 3300049581 Bacteria 1454
196 Ga0501048_0001009 3300049582 Bacteria 21018
197 Ga0501067_0008429 3300049583 Bacteria 5719
198 Ga0501070_0000436 3300049586 Bacteria 37942
199 Ga0501070_0094567 3300049586 Bacteria 2473
200 Ga0501071_0014930 3300049587 Bacteria 5322
201 Ga0501073_0004021 3300049589 Bacteria 11048
202 Ga0501073_0017160 3300049589 Bacteria 5243
203 Ga0501074_0008441 3300049590 Bacteria 7466
204 Ga0501074_0191100 3300049590 Bacteria 1460
205 Ga0501076_0152486 3300049592 Unclassified 1880
206 Ga0501225_0002564 3300049705 Bacteria 5594
207 Ga0501079_0007046 3300049741 Bacteria 8481
208 Ga0501083_0011702 3300049744 Bacteria 6150
209 Ga0501265_000260 3300049762 Bacteria 5314
210 Ga0501266_003336 3300049763 Bacteria 1997
211 Ga0501035_0004311 3300049822 Bacteria 13518
212 Ga0501035_0004442 3300049822 Bacteria 13308
213 Ga0501044_0001633 3300049823 Bacteria 26288
214 Ga0501044_0008090 3300049823 Bacteria 11542
215 Ga0501044_0014114 3300049823 Bacteria 8624
216 Ga0501044_0060224 3300049823 Bacteria 3887
217 Ga0501044_0299805 3300049823 Bacteria 1536
218 Ga0495601_0024939 3300053077 Bacteria 3684
219 Ga0500568_0000293 3300053139 Bacteria 40769
220 Ga0501084_0016400 3300054114 Bacteria 6154
221 Ga0501082_0000034 3300060353 Bacteria 97222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0058161 Ga0451793_0058161_110_1198 354
2 3300046460 Ga0495638_0000069 Ga0495638_0000069_121243_122505 369
3 3300046507 Ga0495606_0000050 Ga0495606_0000050_190071_191336 374
4 3300046694 Ga0495649_0001559 Ga0495649_0001559_11634_12899 374
5 3300048918 Ga0496115_0000093 Ga0496115_0000093_29312_30577 374
6 3300048929 Ga0496126_0002838 Ga0496126_0002838_17122_18387 374
7 3300046460 Ga0495638_0002274 Ga0495638_0002274_4008_5273 376
8 3300046471 Ga0495650_0000501 Ga0495650_0000501_25991_27256 376
9 3300046460 Ga0495638_0000280 Ga0495638_0000280_27354_28619 377
10 3300046660 Ga0495625_0008629 Ga0495625_0008629_612_1877 377
11 3300045049 Ga0466959_0117882 Ga0466959_0117882_19_1227 378
12 3300042184 Ga0450908_000024 Ga0450908_000024_25445_26707 381
13 3300044712 Ga0453684_0000356 Ga0453684_0000356_87287_88579 387
14 3300005983 Ga0081540_1000431 Ga0081540_100043129 391
15 3300003761 Ga0055535_1000261 Ga0055535_100026131 395
16 3300003762 Ga0055542_1000054 Ga0055542_100005483 395
17 3300009093 Ga0105240_10000317 Ga0105240_1000031720 395
18 3300010375 Ga0105239_10000034 Ga0105239_10000034116 395
19 3300025228 Ga0209672_103035 Ga0209672_1030353 395
20 3300025242 Ga0209258_100045 Ga0209258_10004572 395
21 3300025254 Ga0209148_1000052 Ga0209148_100005272 395
22 3300025913 Ga0207695_10000364 Ga0207695_1000036427 395
23 3300048920 Ga0496117_0016599 Ga0496117_0016599_3907_5166 395
24 3300048921 Ga0496118_0001733 Ga0496118_0001733_20036_21295 395
25 3300048922 Ga0496119_0000093 Ga0496119_0000093_107680_108939 395
26 3300048923 Ga0496120_0000124 Ga0496120_0000124_119313_120572 395
27 3300009093 Ga0105240_10004334 Ga0105240_100043342 396
28 3300025913 Ga0207695_10003611 Ga0207695_100036111 396
29 3300048904 Ga0496101_0002700 Ga0496101_0002700_3783_5042 396
30 3300048920 Ga0496117_0072616 Ga0496117_0072616_1017_2276 396
31 3300048921 Ga0496118_0001398 Ga0496118_0001398_26854_28113 396
32 3300048924 Ga0496121_0000013 Ga0496121_0000013_562958_564217 396
33 3300048929 Ga0496126_0000402 Ga0496126_0000402_78218_79477 396
34 3300002705 JGI25156J39149_1005579 JGI25156J39149_10055793 397
35 3300002737 JGI25162J39368_1001563 JGI25162J39368_10015633 397
36 3300002741 JGI25157J39369_1000619 JGI25157J39369_10006193 397
37 3300002741 JGI25157J39369_1002573 JGI25157J39369_10025734 397
38 3300002772 JGI25164J39214_1000267 JGI25164J39214_100026712 397
39 3300003214 JGI25165J46597_1000481 JGI25165J46597_100048112 397
40 3300003320 rootH2_10000036 rootH2_1000003632 397
41 3300003752 Ga0055539_1003983 Ga0055539_10039832 397
42 3300003756 Ga0055533_1006216 Ga0055533_10062162 397
43 3300003760 Ga0055527_1000076 Ga0055527_100007623 397
44 3300003760 Ga0055527_1001362 Ga0055527_10013623 397
45 3300003761 Ga0055535_1000129 Ga0055535_100012923 397
46 3300003761 Ga0055535_1000476 Ga0055535_100047613 397
47 3300003762 Ga0055542_1000173 Ga0055542_100017323 397
48 3300003762 Ga0055542_1000697 Ga0055542_10006975 397
49 3300003763 Ga0055529_1000200 Ga0055529_100020023 397
50 3300003763 Ga0055529_1000370 Ga0055529_100037012 397
51 3300005614 Ga0068856_100000411 Ga0068856_10000041124 397
52 3300025226 Ga0209674_100026 Ga0209674_100026296 397
53 3300025228 Ga0209672_100017 Ga0209672_100017150 397
54 3300025228 Ga0209672_100499 Ga0209672_1004994 397
55 3300025231 Ga0207427_100203 Ga0207427_10020312 397
56 3300025233 Ga0209437_100344 Ga0209437_10034412 397
57 3300025242 Ga0209258_100038 Ga0209258_100038163 397
58 3300025242 Ga0209258_100430 Ga0209258_10043012 397
59 3300025246 Ga0209646_1000886 Ga0209646_10008863 397
60 3300025250 Ga0209026_1000044 Ga0209026_10000443 397
61 3300025250 Ga0209026_1002080 Ga0209026_10020803 397
62 3300025253 Ga0209677_106284 Ga0209677_1062842 397
63 3300025254 Ga0209148_1000009 Ga0209148_10000091063 397
64 3300025254 Ga0209148_1000125 Ga0209148_100012579 397
65 3300025256 Ga0209759_1000124 Ga0209759_100012468 397
66 3300025256 Ga0209759_1002753 Ga0209759_10027533 397
67 3300025261 Ga0209233_1000270 Ga0209233_100027037 397
68 3300025272 Ga0209455_1000032 Ga0209455_1000032150 397
69 3300025272 Ga0209455_1000077 Ga0209455_1000077167 397
70 3300026078 Ga0207702_10005109 Ga0207702_100051093 397
71 3300031456 Ga0307513_10012244 Ga0307513_100122445 397
72 3300037312 Ga0395899_0000046 Ga0395899_0000046_124038_125303 397
73 3300037312 Ga0395899_0002367 Ga0395899_0002367_4294_5559 397
74 3300037418 Ga0395900_0000034 Ga0395900_0000034_70672_71937 397
75 3300037466 Ga0395898_0000081 Ga0395898_0000081_124038_125303 397
76 3300037466 Ga0395898_0000835 Ga0395898_0000835_38862_40127 397
77 3300044656 Ga0466969_0015486 Ga0466969_0015486_404_1669 397
78 3300044684 Ga0466966_0051971 Ga0466966_0051971_506_1771 397
79 3300044693 Ga0466961_0002603 Ga0466961_0002603_1597_2862 397
80 3300044693 Ga0466961_0003873 Ga0466961_0003873_4276_5541 397
81 3300044693 Ga0466961_0008308 Ga0466961_0008308_5063_6328 397
82 3300044694 Ga0466963_0032596 Ga0466963_0032596_1627_2892 397
83 3300044765 Ga0466970_0001333 Ga0466970_0001333_6428_7693 397
84 3300044765 Ga0466970_0035843 Ga0466970_0035843_1080_2345 397
85 3300044842 Ga0466957_0001045 Ga0466957_0001045_106_1371 397
86 3300005337 Ga0070682_100002418 Ga0070682_1000024182 400
87 3300005339 Ga0070660_100051433 Ga0070660_1000514332 400
88 3300005366 Ga0070659_100000104 Ga0070659_10000010415 400
89 3300005458 Ga0070681_10010770 Ga0070681_100107704 400
90 3300025912 Ga0207707_10011280 Ga0207707_100112804 400
91 3300025932 Ga0207690_10020541 Ga0207690_100205412 400
92 3300025297 Ga0209758_1025597 Ga0209758_10255972 402
93 3300025299 Ga0209256_1005446 Ga0209256_10054464 402
94 3300049580 Ga0501046_0022086 Ga0501046_0022086_3154_4434 402
95 3300049590 Ga0501074_0191100 Ga0501074_0191100_24_1304 402
96 3300049823 Ga0501044_0299805 Ga0501044_0299805_131_1411 402
97 3300060353 Ga0501082_0000034 Ga0501082_0000034_45316_46596 402
98 3300005327 Ga0070658_10002436 Ga0070658_100024364 406
99 3300005335 Ga0070666_10000012 Ga0070666_1000001268 406
100 3300005344 Ga0070661_100019247 Ga0070661_1000192474 406
101 3300005367 Ga0070667_100020573 Ga0070667_1000205732 406
102 3300005548 Ga0070665_100008117 Ga0070665_1000081174 406
103 3300005843 Ga0068860_100027626 Ga0068860_1000276263 406
104 3300009551 Ga0105238_10000109 Ga0105238_1000010943 406
105 3300013306 Ga0163162_10000127 Ga0163162_1000012714 406
106 3300025903 Ga0207680_10000013 Ga0207680_1000001368 406
107 3300025909 Ga0207705_10022289 Ga0207705_100222892 406
108 3300025924 Ga0207694_10000398 Ga0207694_1000039813 406
109 3300025986 Ga0207658_10060362 Ga0207658_100603622 406
110 3300028379 Ga0268266_10000021 Ga0268266_1000002167 406
111 3300028381 Ga0268264_10053549 Ga0268264_100535493 406
112 3300033180 Ga0307510_10000797 Ga0307510_100007974 406
113 3300042876 Ga0451577_0004837 Ga0451577_0004837_6080_7393 406
114 3300046471 Ga0495650_0002943 Ga0495650_0002943_10240_11499 406
115 3300048925 Ga0496122_0045573 Ga0496122_0045573_624_1919 406
116 3300048928 Ga0496125_0016128 Ga0496125_0016128_4510_5769 406
117 3300048929 Ga0496126_0035867 Ga0496126_0035867_1167_2426 406
118 3300003794 Ga0055531_10009887 Ga0055531_100098872 407
119 3300005455 Ga0070663_100219165 Ga0070663_1002191652 407
120 3300005548 Ga0070665_100268531 Ga0070665_1002685312 407
121 3300025304 Ga0209257_1000217 Ga0209257_1000217107 407
122 3300041486 Ga0451807_1601795 Ga0451807_1601795_145_1440 407
123 3300041494 Ga0451837_1791662 Ga0451837_1791662_2503_3798 407
124 3300042435 Ga0439434_0031147 Ga0439434_0031147_83_1378 407
125 3300046525 Ga0495663_0004670 Ga0495663_0004670_564_1859 407
126 3300046692 Ga0495671_0015869 Ga0495671_0015869_1822_3117 407
127 3300048921 Ga0496118_0000182 Ga0496118_0000182_104032_105288 407
128 3300041413 Ga0439465_0001119 Ga0439465_0001119_1855_3150 408
129 3300032126 Ga0307415_100102883 Ga0307415_1001028832 409
130 3300041413 Ga0439465_0011639 Ga0439465_0011639_1233_2528 410
131 3300041451 Ga0451791_0318918 Ga0451791_0318918_2025_3320 410
132 3300005458 Ga0070681_10063510 Ga0070681_100635102 411
133 3300005530 Ga0070679_100137659 Ga0070679_1001376592 411
134 3300005539 Ga0068853_100012256 Ga0068853_1000122562 411
135 3300026041 Ga0207639_10010378 Ga0207639_100103784 411
136 3300013307 Ga0157372_10077103 Ga0157372_100771032 412
137 3300042007 Ga0439449_0000024 Ga0439449_0000024_19387_20682 413
138 3300049705 Ga0501225_0002564 Ga0501225_0002564_1327_2622 413
139 3300053077 Ga0495601_0024939 Ga0495601_0024939_1019_2278 414
140 3300049571 Ga0501034_0000122 Ga0501034_0000122_57125_58420 415
141 3300049763 Ga0501266_003336 Ga0501266_003336_438_1739 415
142 iso_pu_bacteria 2593339238 2595446039 415
143 iso_pu_bacteria 2593339239 2595452716 415
144 iso_pu_bacteria 2718218334 2721027630 415
145 iso_pu_bacteria 2734482264 2735836810 415
146 iso_pu_bacteria 2738543009 2739226217 415
147 iso_pu_bacteria 2818991440 2819562586 415
148 iso_pu_bacteria 2842914999 2842916344 415
149 iso_pu_bacteria 2842918807 2842918970 415
150 iso_pu_bacteria 2904463128 2904463191 415
151 iso_pu_bacteria 2919085039 2919085519 415
152 iso_pu_bacteria 2919404418 2919405296 415
153 iso_pu_bacteria 2953994433 2953994742 415
154 3300049762 Ga0501265_000260 Ga0501265_000260_650_2014 416
155 3300005347 Ga0070668_100021424 Ga0070668_1000214242 418
156 3300005364 Ga0070673_100188591 Ga0070673_1001885912 418
157 3300005367 Ga0070667_100014197 Ga0070667_1000141972 418
158 3300005548 Ga0070665_100000126 Ga0070665_10000012612 418
159 3300005548 Ga0070665_100035337 Ga0070665_1000353374 418
160 3300005548 Ga0070665_100077102 Ga0070665_1000771023 418
161 3300005617 Ga0068859_100000830 Ga0068859_10000083014 418
162 3300005618 Ga0068864_100237102 Ga0068864_1002371022 418
163 3300005834 Ga0068851_10006462 Ga0068851_100064622 418
164 3300005843 Ga0068860_100094149 Ga0068860_1000941492 418
165 3300005843 Ga0068860_100097352 Ga0068860_1000973522 418
166 3300005844 Ga0068862_100000282 Ga0068862_10000028237 418
167 3300005844 Ga0068862_100032478 Ga0068862_1000324784 418
168 3300006931 Ga0097620_100000830 Ga0097620_10000083014 418
169 3300009545 Ga0105237_10019208 Ga0105237_100192085 418
170 3300025907 Ga0207645_10009086 Ga0207645_100090866 418
171 3300025940 Ga0207691_10018826 Ga0207691_100188264 418
172 3300025972 Ga0207668_10055882 Ga0207668_100558822 418
173 3300025986 Ga0207658_10009833 Ga0207658_100098334 418
174 3300028379 Ga0268266_10000001 Ga0268266_10000001671 418
175 3300028380 Ga0268265_10000227 Ga0268265_1000022712 418
176 3300028380 Ga0268265_10022635 Ga0268265_100226352 418
177 3300042007 Ga0439449_0000349 Ga0439449_0000349_6580_7881 418
178 3300049568 Ga0501031_0010522 Ga0501031_0010522_1364_2626 418
179 3300049571 Ga0501034_0021089 Ga0501034_0021089_4022_5284 418
180 3300049572 Ga0501036_0023087 Ga0501036_0023087_3314_4576 418
181 3300049573 Ga0501037_0020934 Ga0501037_0020934_3539_4801 418
182 3300049574 Ga0501038_0032311 Ga0501038_0032311_2914_4176 418
183 3300049575 Ga0501039_0009664 Ga0501039_0009664_3204_4466 418
184 3300049581 Ga0501047_0044150 Ga0501047_0044150_2818_4080 418
185 3300049582 Ga0501048_0001009 Ga0501048_0001009_4425_5687 418
186 3300049583 Ga0501067_0008429 Ga0501067_0008429_3511_4773 418
187 3300049586 Ga0501070_0000436 Ga0501070_0000436_12021_13277 418
188 3300049586 Ga0501070_0094567 Ga0501070_0094567_422_1747 418
189 3300049587 Ga0501071_0014930 Ga0501071_0014930_658_1920 418
190 3300049589 Ga0501073_0004021 Ga0501073_0004021_5990_7246 418
191 3300049589 Ga0501073_0017160 Ga0501073_0017160_1067_2329 418
192 3300049590 Ga0501074_0008441 Ga0501074_0008441_2456_3718 418
193 3300049592 Ga0501076_0152486 Ga0501076_0152486_42_1304 418
194 3300049741 Ga0501079_0007046 Ga0501079_0007046_4299_5561 418
195 3300049744 Ga0501083_0011702 Ga0501083_0011702_1207_2469 418
196 3300049822 Ga0501035_0004311 Ga0501035_0004311_49_1308 418
197 3300049822 Ga0501035_0004442 Ga0501035_0004442_4001_5257 418
198 3300049823 Ga0501044_0001633 Ga0501044_0001633_15429_16685 418
199 3300049823 Ga0501044_0008090 Ga0501044_0008090_642_1967 418
200 3300049823 Ga0501044_0014114 Ga0501044_0014114_4448_5710 418
201 3300054114 Ga0501084_0016400 Ga0501084_0016400_4336_5598 418
202 3300005262 Ga0065165_1000635 Ga0065165_100063532 419
203 3300005344 Ga0070661_100015525 Ga0070661_1000155252 419
204 3300006358 Ga0068871_100287504 Ga0068871_1002875042 419
205 3300009551 Ga0105238_10013675 Ga0105238_100136753 419
206 3300025920 Ga0207649_10042977 Ga0207649_100429771 419
207 3300025924 Ga0207694_10040129 Ga0207694_100401292 419
208 3300044672 Ga0466982_0000080 Ga0466982_0000080_13786_15048 419
209 3300042876 Ga0451577_0011411 Ga0451577_0011411_3509_4771 420
210 3300003320 rootH2_10068682 rootH2_100686823 422
211 3300005458 Ga0070681_10023323 Ga0070681_100233232 422
212 3300031824 Ga0307413_10030288 Ga0307413_100302882 422
213 3300046507 Ga0495606_0007366 Ga0495606_0007366_1341_2609 422
214 3300049568 Ga0501031_0042374 Ga0501031_0042374_821_2089 422
215 3300049570 Ga0501033_0005734 Ga0501033_0005734_1645_2913 422
216 3300049571 Ga0501034_0030818 Ga0501034_0030818_1332_2600 422
217 3300049579 Ga0501043_0020817 Ga0501043_0020817_1516_2784 422
218 3300049581 Ga0501047_0019014 Ga0501047_0019014_2430_3698 422
219 3300049823 Ga0501044_0060224 Ga0501044_0060224_1640_2908 422
220 3300005335 Ga0070666_10092373 Ga0070666_100923732 423
221 3300005367 Ga0070667_100211781 Ga0070667_1002117812 423
222 3300005548 Ga0070665_100056485 Ga0070665_1000564853 423
223 3300005548 Ga0070665_100111014 Ga0070665_1001110142 423
224 3300025903 Ga0207680_10079374 Ga0207680_100793742 423
225 3300026067 Ga0207678_10001878 Ga0207678_1000187814 423
226 3300028379 Ga0268266_10034284 Ga0268266_100342843 423
227 3300049581 Ga0501047_0298513 Ga0501047_0298513_14_1288 423
228 3300053139 Ga0500568_0000293 Ga0500568_0000293_23291_24565 423
229 iso_pu_bacteria 2643221579 2643908663 427
230 iso_pu_bacteria 2643221695 2644529577 427
231 iso_pu_bacteria 2923516293 2923517880 427
232 iso_pu_bacteria 8002869464 8002872610 427
233 2162886007 SwRhRL2b_contig_2041178 SwRhRL2b_0594.00001660 431
234 3300005289 Ga0065704_10072023 Ga0065704_100720239 431
235 3300005337 Ga0070682_100161151 Ga0070682_1001611512 431
236 3300009993 Ga0105028_101044 Ga0105028_1010442 431
237 3300025292 Ga0209676_1000024 Ga0209676_1000024362 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04932

Wzy_C

O-Antigen ligase

186

307

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tpj-assembly1.cif.gz_B single-particle cryo-em structure of the waal o-antigen ligase in its apo state 0.5684 2 389
7tpj-assembly1.cif.gz_B single-particle cryo-em structure of the waal o-antigen ligase in its apo state 0.5507 2 389
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.5495 53 396
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.5408 53 396
8tj3-assembly1.cif.gz_B structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex 0.4839 51 394
ID Description Score Start End Superfamily
af_F1Q795_1007_1147_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4488 20 197 1.25.40.10
af_F1Q795_1007_1147_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4388 20 197 1.25.40.10
af_P47031_32_423_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3622 61 199 1.20.1740.10
af_Q555D9_220_489_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3436 91 172 1.25.40.10
af_Q9FX66_6_371_1.25.40.280 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;alix/aip1 like domains 0.3327 5 199 1.25.40.280
ID Description Score Start End GO Terms
AF-A0A4R3Z097-F1-model_v4 O-antigen ligase 0.9615 1 429 GO:0016020
GO:0016874
AF-A0A4R3Z097-F1-model_v4 O-antigen ligase 0.9526 1 429 GO:0016020
GO:0016874
AF-A0A328PBF5-F1-model_v4 O-antigen polymerase 0.9369 1 429 GO:0016020
AF-A0A328PBF5-F1-model_v4 O-antigen polymerase 0.9283 1 429 GO:0016020
AF-A0A4V5NUJ0-F1-model_v4 O-antigen ligase-related domain-containing protein 0.9237 2 427 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.03 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map