F350076

General Info

Members Datasets Scaffolds Average Seq Length
237 159 233 269

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10004098|Ga0207670_100040985
Length 293
Sequence VLTQRRASEILTMPQFAANLHYLFSELPFLERFEAAAAAGFKAVEFQVPYDYPAAELSARLRASALQMVLFDAPMGNWAGGDRGLAAVPGKEKEFSDSLASVIEYGGALGCETVHLMAGVVGPGQDYAAAEHVYLSNLRHAAARLKVHGMTAVIEPINKKMGIVQNGPSYTTEGMHGYFLNHTAHARRVIEAVGSPNLRLHLDFYHMQMLEGHLAETIRQNIGLLKHVQIAGVPGRHEPSVGEINYPYLFNLLDELDYRGWVGCEYRPKSDTWTGLSWAQKYGIESVRPAHRK

Samples

Sample ID Description Type Environment
1 2855730933 Achromobacter sp. HZ28 Isolate Nodule
2 2855767633 Achromobacter sp. HZ34 Isolate Nodule
3 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
4 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0.84
Rhizoplane 1.27
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 4.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000185 3300003187 Bacteria 77945
2 Ga0070676_10242473 3300005328 Bacteria 1199
3 Ga0070690_100000651 3300005330 Bacteria 17695
4 Ga0068869_100000524 3300005334 Bacteria 21367
5 Ga0070680_100581450 3300005336 Bacteria 961
6 Ga0070660_100638820 3300005339 Bacteria 891
7 Ga0070689_100001789 3300005340 Bacteria 13808
8 Ga0070689_100239979 3300005340 Bacteria 1492
9 Ga0070689_100249175 3300005340 Bacteria 1465
10 Ga0070692_10001709 3300005345 Bacteria 8163
11 Ga0070692_10279979 3300005345 Bacteria 1010
12 Ga0070669_100619416 3300005353 Bacteria 908
13 Ga0070675_100507767 3300005354 Bacteria 1087
14 Ga0070671_100030478 3300005355 Bacteria 4451
15 Ga0070674_100130580 3300005356 Bacteria 1872
16 Ga0070674_100171523 3300005356 Bacteria 1654
17 Ga0070673_100226394 3300005364 Bacteria 1621
18 Ga0070659_100044912 3300005366 Bacteria 3461
19 Ga0070667_100486123 3300005367 Bacteria 1131
20 Ga0070709_10456525 3300005434 Bacteria 963
21 Ga0070714_100058458 3300005435 Bacteria 3303
22 Ga0070714_100297139 3300005435 Bacteria 1504
23 Ga0070713_100013944 3300005436 Bacteria 5950
24 Ga0070713_100107869 3300005436 Bacteria 2423
25 Ga0070713_100142767 3300005436 Bacteria 2122
26 Ga0070713_100146302 3300005436 Bacteria 2098
27 Ga0070713_100188637 3300005436 Bacteria 1857
28 Ga0070701_10000275 3300005438 Bacteria 16779
29 Ga0070711_100072528 3300005439 Bacteria 2429
30 Ga0070711_100097034 3300005439 Bacteria 2136
31 Ga0070705_100004608 3300005440 Bacteria 6709
32 Ga0070700_100000379 3300005441 Bacteria 22793
33 Ga0070694_100008076 3300005444 Bacteria 6428
34 Ga0070694_100243093 3300005444 Bacteria 1358
35 Ga0070708_100026573 3300005445 Bacteria 4956
36 Ga0070678_100206337 3300005456 Bacteria 1625
37 Ga0070681_10007435 3300005458 Bacteria 10706
38 Ga0070681_10348666 3300005458 Bacteria 1391
39 Ga0068867_100000191 3300005459 Bacteria 40494
40 Ga0068867_100074889 3300005459 Bacteria 2538
41 Ga0070706_100187637 3300005467 Bacteria 1932
42 Ga0070707_100004092 3300005468 Bacteria 13688
43 Ga0070698_100004893 3300005471 Bacteria 14702
44 Ga0070698_100007059 3300005471 Bacteria 12163
45 Ga0070698_100145385 3300005471 Bacteria 2321
46 Ga0070697_100043479 3300005536 Bacteria 3638
47 Ga0070697_100134224 3300005536 Bacteria 2078
48 Ga0070697_100143337 3300005536 Bacteria 2010
49 Ga0068853_100006426 3300005539 Bacteria 9340
50 Ga0070686_100000103 3300005544 Bacteria 58400
51 Ga0070695_100014526 3300005545 Bacteria 4748
52 Ga0070695_100257560 3300005545 Unclassified 1273
53 Ga0070695_100272456 3300005545 Bacteria 1240
54 Ga0070693_100006578 3300005547 Bacteria 5638
55 Ga0070665_100079326 3300005548 Bacteria 3289
56 Ga0070704_100022650 3300005549 Bacteria 4090
57 Ga0068854_100219007 3300005578 Bacteria 1505
58 Ga0068854_100776734 3300005578 Bacteria 833
59 Ga0068856_100171072 3300005614 Bacteria 2184
60 Ga0070702_100000081 3300005615 Bacteria 27675
61 Ga0068852_100012289 3300005616 Bacteria 6493
62 Ga0068859_100053920 3300005617 Bacteria 4043
63 Ga0068864_100255669 3300005618 Bacteria 1628
64 Ga0068866_10000201 3300005718 Bacteria 28091
65 Ga0068861_100000679 3300005719 Bacteria 20302
66 Ga0068858_100000455 3300005842 Bacteria 42847
67 Ga0068858_100422987 3300005842 Bacteria 1281
68 Ga0068860_100001308 3300005843 Bacteria 27073
69 Ga0068862_100001753 3300005844 Bacteria 19644
70 Ga0068862_100121286 3300005844 Bacteria 2304
71 Ga0081540_1048988 3300005983 Bacteria 2111
72 Ga0070717_10059007 3300006028 Bacteria 3174
73 Ga0070717_10061290 3300006028 Bacteria 3117
74 Ga0070717_10411017 3300006028 Bacteria 1216
75 Ga0070716_100434555 3300006173 Unclassified 953
76 Ga0070712_100022268 3300006175 Bacteria 4172
77 Ga0070712_100138422 3300006175 Bacteria 1854
78 Ga0070712_100306182 3300006175 Bacteria 1287
79 Ga0070712_100320892 3300006175 Bacteria 1259
80 Ga0070712_100710681 3300006175 Bacteria 857
81 Ga0068871_100003664 3300006358 Bacteria 10561
82 Ga0068871_100088206 3300006358 Bacteria 2581
83 Ga0068871_100280577 3300006358 Bacteria 1457
84 Ga0068865_100000113 3300006881 Bacteria 41428
85 Ga0097620_100053920 3300006931 Bacteria 4043
86 Ga0075435_100180371 3300007076 Bacteria 1784
87 Ga0099794_10069311 3300007265 Bacteria 1725
88 Ga0105240_10279141 3300009093 Bacteria 1920
89 Ga0105240_10340158 3300009093 Bacteria 1705
90 Ga0105245_10000681 3300009098 Bacteria 30711
91 Ga0105245_10517979 3300009098 Bacteria 1211
92 Ga0105243_10001082 3300009148 Bacteria 24928
93 Ga0105242_10000201 3300009176 Bacteria 46357
94 Ga0105242_10104952 3300009176 Bacteria 2399
95 Ga0105237_10160015 3300009545 Bacteria 2250
96 Ga0105238_10008348 3300009551 Bacteria 10362
97 Ga0105249_10047962 3300009553 Bacteria 3894
98 Ga0099796_10028467 3300010159 Bacteria 1794
99 Ga0157378_10000357 3300013297 Bacteria 44996
100 Ga0157378_10162384 3300013297 Bacteria 2090
101 Ga0157378_10250249 3300013297 Unclassified 1696
102 Ga0157378_10316370 3300013297 Bacteria 1515
103 Ga0163162_10264908 3300013306 Bacteria 1850
104 Ga0163162_10408160 3300013306 Bacteria 1491
105 Ga0163162_10711341 3300013306 Bacteria 1126
106 Ga0157375_10213450 3300013308 Bacteria 2088
107 Ga0157380_10001221 3300014326 Bacteria 16662
108 Ga0157379_10017094 3300014968 Bacteria 6385
109 Ga0157376_10014792 3300014969 Bacteria 5873
110 Ga0157376_10118112 3300014969 Unclassified 2346
111 Ga0213876_10104778 3300021384 Bacteria 1500
112 Ga0213875_10000254 3300021388 Bacteria 53556
113 Ga0213875_10000988 3300021388 Bacteria 20330
114 Ga0209025_1000064 3300025294 Bacteria 301309
115 Ga0207692_10021055 3300025898 Bacteria 2977
116 Ga0207642_10001948 3300025899 Bacteria 6368
117 Ga0207642_10102004 3300025899 Bacteria 1442
118 Ga0207699_10074280 3300025906 Bacteria 2088
119 Ga0207699_10125545 3300025906 Bacteria 1666
120 Ga0207643_10006431 3300025908 Bacteria 6292
121 Ga0207684_10007033 3300025910 Bacteria 10177
122 Ga0207684_10136966 3300025910 Bacteria 2103
123 Ga0207707_10068268 3300025912 Bacteria 3097
124 Ga0207693_10002952 3300025915 Bacteria 14722
125 Ga0207693_10027830 3300025915 Bacteria 4468
126 Ga0207693_10078593 3300025915 Bacteria 2582
127 Ga0207693_10099795 3300025915 Bacteria 2276
128 Ga0207693_10245391 3300025915 Bacteria 1406
129 Ga0207693_10359489 3300025915 Bacteria 1139
130 Ga0207663_10006016 3300025916 Bacteria 6169
131 Ga0207660_10347279 3300025917 Bacteria 1189
132 Ga0207646_10009859 3300025922 Bacteria 9403
133 Ga0207694_10043329 3300025924 Bacteria 3473
134 Ga0207659_10348662 3300025926 Bacteria 1228
135 Ga0207687_10000430 3300025927 Bacteria 28463
136 Ga0207700_10020818 3300025928 Bacteria 4464
137 Ga0207700_10086338 3300025928 Bacteria 2465
138 Ga0207700_10104851 3300025928 Bacteria 2263
139 Ga0207700_10182963 3300025928 Bacteria 1756
140 Ga0207700_10544587 3300025928 Bacteria 1030
141 Ga0207664_10337393 3300025929 Bacteria 1332
142 Ga0207664_10534569 3300025929 Bacteria 1051
143 Ga0207690_10063692 3300025932 Bacteria 2515
144 Ga0207690_10098724 3300025932 Bacteria 2081
145 Ga0207706_10621676 3300025933 Bacteria 927
146 Ga0207686_10000084 3300025934 Bacteria 79402
147 Ga0207686_10219323 3300025934 Bacteria 1372
148 Ga0207709_10001426 3300025935 Bacteria 16740
149 Ga0207709_10140165 3300025935 Bacteria 1661
150 Ga0207670_10004098 3300025936 Bacteria 7805
151 Ga0207704_10000166 3300025938 Bacteria 34959
152 Ga0207689_10000272 3300025942 Bacteria 46619
153 Ga0207689_10128101 3300025942 Bacteria 2088
154 Ga0207667_10182187 3300025949 Bacteria 2157
155 Ga0207651_10234907 3300025960 Bacteria 1491
156 Ga0207640_10604759 3300025981 Bacteria 928
157 Ga0207677_10091686 3300026023 Bacteria 2211
158 Ga0207703_10005996 3300026035 Bacteria 9736
159 Ga0207703_10155369 3300026035 Bacteria 1999
160 Ga0207639_10023286 3300026041 Bacteria 4471
161 Ga0207708_10000134 3300026075 Bacteria 58313
162 Ga0207708_10016697 3300026075 Bacteria 5525
163 Ga0207702_10009704 3300026078 Bacteria 8083
164 Ga0207648_10000433 3300026089 Bacteria 46203
165 Ga0207648_10025781 3300026089 Bacteria 5232
166 Ga0207675_100000490 3300026118 Bacteria 38407
167 Ga0207683_10015368 3300026121 Bacteria 6518
168 Ga0207683_10113271 3300026121 Bacteria 2429
169 Ga0207698_10018789 3300026142 Bacteria 4719
170 Ga0207698_10028226 3300026142 Bacteria 3999
171 Ga0268265_10005357 3300028380 Bacteria 8785
172 Ga0268264_10004638 3300028381 Bacteria 11677
173 Ga0265313_10093075 3300031595 Bacteria 1349
174 Ga0373934_0052939 3300035086 Bacteria 1610
175 Ga0373945_0120490 3300035116 Bacteria 1043
176 Ga0373954_0014830 3300035118 Bacteria 3477
177 Ga0373943_0044817 3300035170 Bacteria 2154
178 Ga0373943_0409814 3300035170 Bacteria 783
179 Ga0373955_0097044 3300035172 Bacteria 1687
180 Ga0373955_0195510 3300035172 Bacteria 1203
181 Ga0373933_0047906 3300035724 Bacteria 2543
182 Ga0373933_0146459 3300035724 Bacteria 1494
183 Ga0373937_0031903 3300036401 Bacteria 4775
184 Ga0373937_0056945 3300036401 Bacteria 3590
185 Ga0373937_0072555 3300036401 Bacteria 3175
186 Ga0436364_0207585 3300037853 Bacteria 136246
187 Ga0436364_0951399 3300037853 Bacteria 78546
188 Ga0436364_1456120 3300037853 Bacteria 1234
189 Ga0436365_0282953 3300039437 Bacteria 7295
190 Ga0436360_0082575 3300039438 Bacteria 1863
191 Ga0436361_0451583 3300039447 Bacteria 7913
192 Ga0436361_0489638 3300039447 Bacteria 1144
193 Ga0436361_0568821 3300039447 Bacteria 1274
194 Ga0436361_0721948 3300039447 Bacteria 1569
195 Ga0436363_0757691 3300039450 Bacteria 1966
196 Ga0436363_1460380 3300039450 Bacteria 2373
197 Ga0436362_0424694 3300039453 Bacteria 1234
198 Ga0436362_0505191 3300039453 Bacteria 3251
199 Ga0495618_0064683 3300046514 Bacteria 2324
200 Ga0495628_0227701 3300046516 Bacteria 1398
201 Ga0495667_0035834 3300046559 Bacteria 3314
202 Ga0495667_0144754 3300046559 Bacteria 1531
203 Ga0495634_0077696 3300046642 Bacteria 2176
204 Ga0495635_0110319 3300046663 Bacteria 1879
205 Ga0495600_0021183 3300046809 Bacteria 4162
206 Ga0495680_0076221 3300047322 Bacteria 2543
207 Ga0496104_0111888 3300048907 Bacteria 2618
208 Ga0496112_0053790 3300048915 Bacteria 3954
209 Ga0496113_0039963 3300048916 Bacteria 3455
210 Ga0496120_0130397 3300048923 Bacteria 1288
211 Ga0501034_0000390 3300049571 Bacteria 74693
212 Ga0501034_0044275 3300049571 Bacteria 4502
213 Ga0501039_0097985 3300049575 Bacteria 2287
214 Ga0501068_0010429 3300049584 Bacteria 5221
215 Ga0501070_0317317 3300049586 Bacteria 1268
216 Ga0501072_0008369 3300049588 Bacteria 7853
217 Ga0501072_0178441 3300049588 Bacteria 1694
218 Ga0501073_0001899 3300049589 Bacteria 15583
219 Ga0501074_0052289 3300049590 Bacteria 2949
220 Ga0501080_0000290 3300049742 Bacteria 38083
221 Ga0501083_0010361 3300049744 Bacteria 6563
222 Ga0501035_0352632 3300049822 Bacteria 1231
223 nmdc:mga0n895_248198_c1 3300050512 Bacteria 1806
224 nmdc:mga0rr50_83172_c1 3300050513 Bacteria 2474
225 nmdc:mga08x19_171457_c1 3300050514 Bacteria 1478
226 Ga0495601_0046006 3300053077 Bacteria 2746
227 Ga0495595_0018243 3300053084 Bacteria 3031
228 Ga0495619_0003540 3300053085 Bacteria 10081
229 Ga0495619_0066617 3300053085 Bacteria 2403
230 Ga0500566_0152401 3300053094 Bacteria 1214
231 Ga0500650_0127136 3300053098 Bacteria 1186
232 Ga0500616_0006483 3300053153 Bacteria 7656
233 Ga0501084_0210188 3300054114 Bacteria 1642

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0195510 Ga0373955_0195510_300_1139 231
2 3300025929 Ga0207664_10534569 Ga0207664_105345691 232
3 3300005340 Ga0070689_100249175 Ga0070689_1002491752 246
4 3300035116 Ga0373945_0120490 Ga0373945_0120490_16_771 248
5 3300035724 Ga0373933_0146459 Ga0373933_0146459_70_822 250
6 3300046514 Ga0495618_0064683 Ga0495618_0064683_1084_1836 250
7 3300046516 Ga0495628_0227701 Ga0495628_0227701_225_977 250
8 3300046642 Ga0495634_0077696 Ga0495634_0077696_502_1254 250
9 3300046663 Ga0495635_0110319 Ga0495635_0110319_92_844 250
10 3300046809 Ga0495600_0021183 Ga0495600_0021183_1059_1811 250
11 3300053085 Ga0495619_0003540 Ga0495619_0003540_3285_4037 250
12 3300025928 Ga0207700_10020818 Ga0207700_100208185 251
13 3300036401 Ga0373937_0056945 Ga0373937_0056945_1951_2706 251
14 3300046559 Ga0495667_0035834 Ga0495667_0035834_1410_2165 251
15 3300047322 Ga0495680_0076221 Ga0495680_0076221_974_1729 251
16 3300048915 Ga0496112_0053790 Ga0496112_0053790_522_1277 251
17 3300053084 Ga0495595_0018243 Ga0495595_0018243_922_1677 251
18 3300035170 Ga0373943_0409814 Ga0373943_0409814_10_768 252
19 3300039437 Ga0436365_0282953 Ga0436365_0282953_1016_1774 252
20 iso_pu_bacteria 2917554339 2917554624 252
21 3300005616 Ga0068852_100012289 Ga0068852_1000122894 253
22 3300025949 Ga0207667_10182187 Ga0207667_101821872 253
23 3300026142 Ga0207698_10018789 Ga0207698_100187892 253
24 3300026142 Ga0207698_10028226 Ga0207698_100282264 253
25 3300053094 Ga0500566_0152401 Ga0500566_0152401_117_890 253
26 3300053153 Ga0500616_0006483 Ga0500616_0006483_3557_4330 253
27 3300005436 Ga0070713_100146302 Ga0070713_1001463022 258
28 3300005536 Ga0070697_100143337 Ga0070697_1001433372 258
29 3300009093 Ga0105240_10279141 Ga0105240_102791412 258
30 3300009551 Ga0105238_10008348 Ga0105238_1000834810 258
31 3300025915 Ga0207693_10359489 Ga0207693_103594891 258
32 3300025924 Ga0207694_10043329 Ga0207694_100433293 258
33 3300039447 Ga0436361_0451583 Ga0436361_0451583_2016_2792 258
34 3300048923 Ga0496120_0130397 Ga0496120_0130397_31_807 258
35 3300049584 Ga0501068_0010429 Ga0501068_0010429_3841_4686 259
36 3300049589 Ga0501073_0001899 Ga0501073_0001899_6507_7352 259
37 3300049590 Ga0501074_0052289 Ga0501074_0052289_49_894 259
38 3300049742 Ga0501080_0000290 Ga0501080_0000290_17144_17989 259
39 iso_pu_bacteria 2855730933 2855734872 259
40 iso_pu_bacteria 2855767633 2855770656 259
41 iso_pu_bacteria 2881412998 2881413198 259
42 3300005336 Ga0070680_100581450 Ga0070680_1005814501 260
43 3300005355 Ga0070671_100030478 Ga0070671_1000304785 260
44 3300005434 Ga0070709_10456525 Ga0070709_104565251 260
45 3300005435 Ga0070714_100297139 Ga0070714_1002971392 260
46 3300005436 Ga0070713_100107869 Ga0070713_1001078691 260
47 3300005436 Ga0070713_100142767 Ga0070713_1001427672 260
48 3300005445 Ga0070708_100026573 Ga0070708_1000265734 260
49 3300005458 Ga0070681_10348666 Ga0070681_103486662 260
50 3300005468 Ga0070707_100004092 Ga0070707_1000040924 260
51 3300005471 Ga0070698_100007059 Ga0070698_1000070599 260
52 3300005536 Ga0070697_100043479 Ga0070697_1000434793 260
53 3300005614 Ga0068856_100171072 Ga0068856_1001710722 260
54 3300006028 Ga0070717_10061290 Ga0070717_100612903 260
55 3300006028 Ga0070717_10411017 Ga0070717_104110172 260
56 3300006175 Ga0070712_100138422 Ga0070712_1001384222 260
57 3300006175 Ga0070712_100710681 Ga0070712_1007106811 260
58 3300007076 Ga0075435_100180371 Ga0075435_1001803712 260
59 3300013306 Ga0163162_10264908 Ga0163162_102649083 260
60 3300021388 Ga0213875_10000254 Ga0213875_1000025414 260
61 3300025910 Ga0207684_10007033 Ga0207684_100070339 260
62 3300025912 Ga0207707_10068268 Ga0207707_100682683 260
63 3300025915 Ga0207693_10078593 Ga0207693_100785933 260
64 3300025915 Ga0207693_10245391 Ga0207693_102453912 260
65 3300025917 Ga0207660_10347279 Ga0207660_103472791 260
66 3300025922 Ga0207646_10009859 Ga0207646_100098595 260
67 3300025928 Ga0207700_10086338 Ga0207700_100863383 260
68 3300025928 Ga0207700_10104851 Ga0207700_101048512 260
69 3300025929 Ga0207664_10337393 Ga0207664_103373932 260
70 3300026078 Ga0207702_10009704 Ga0207702_100097045 260
71 3300031595 Ga0265313_10093075 Ga0265313_100930752 260
72 3300035170 Ga0373943_0044817 Ga0373943_0044817_605_1387 260
73 3300036401 Ga0373937_0072555 Ga0373937_0072555_983_1765 260
74 3300037853 Ga0436364_0951399 Ga0436364_0951399_39453_40238 260
75 3300039447 Ga0436361_0721948 Ga0436361_0721948_143_925 260
76 3300048907 Ga0496104_0111888 Ga0496104_0111888_409_1191 260
77 3300048916 Ga0496113_0039963 Ga0496113_0039963_427_1209 260
78 3300049586 Ga0501070_0317317 Ga0501070_0317317_41_826 260
79 3300050512 nmdc:mga0n895_248198_c1 nmdc:mga0n895_248198_c1_883_1665 260
80 3300050513 nmdc:mga0rr50_83172_c1 nmdc:mga0rr50_83172_c1_1267_2049 260
81 3300050514 nmdc:mga08x19_171457_c1 nmdc:mga08x19_171457_c1_491_1273 260
82 3300005339 Ga0070660_100638820 Ga0070660_1006388201 261
83 3300005354 Ga0070675_100507767 Ga0070675_1005077671 261
84 3300005435 Ga0070714_100058458 Ga0070714_1000584582 261
85 3300005436 Ga0070713_100013944 Ga0070713_1000139443 261
86 3300005436 Ga0070713_100188637 Ga0070713_1001886372 261
87 3300005439 Ga0070711_100072528 Ga0070711_1000725282 261
88 3300005439 Ga0070711_100097034 Ga0070711_1000970342 261
89 3300005467 Ga0070706_100187637 Ga0070706_1001876372 261
90 3300005471 Ga0070698_100004893 Ga0070698_1000048932 261
91 3300005536 Ga0070697_100134224 Ga0070697_1001342242 261
92 3300005578 Ga0068854_100776734 Ga0068854_1007767341 261
93 3300005983 Ga0081540_1048988 Ga0081540_10489882 261
94 3300006028 Ga0070717_10059007 Ga0070717_100590073 261
95 3300006173 Ga0070716_100434555 Ga0070716_1004345552 261
96 3300006175 Ga0070712_100022268 Ga0070712_1000222685 261
97 3300006175 Ga0070712_100306182 Ga0070712_1003061822 261
98 3300006175 Ga0070712_100320892 Ga0070712_1003208922 261
99 3300010159 Ga0099796_10028467 Ga0099796_100284672 261
100 3300013306 Ga0163162_10408160 Ga0163162_104081602 261
101 3300021384 Ga0213876_10104778 Ga0213876_101047782 261
102 3300021388 Ga0213875_10000988 Ga0213875_100009883 261
103 3300025898 Ga0207692_10021055 Ga0207692_100210552 261
104 3300025906 Ga0207699_10074280 Ga0207699_100742802 261
105 3300025906 Ga0207699_10125545 Ga0207699_101255452 261
106 3300025910 Ga0207684_10136966 Ga0207684_101369662 261
107 3300025915 Ga0207693_10002952 Ga0207693_100029527 261
108 3300025915 Ga0207693_10027830 Ga0207693_100278302 261
109 3300025915 Ga0207693_10099795 Ga0207693_100997951 261
110 3300025916 Ga0207663_10006016 Ga0207663_100060165 261
111 3300025926 Ga0207659_10348662 Ga0207659_103486622 261
112 3300025928 Ga0207700_10182963 Ga0207700_101829632 261
113 3300025928 Ga0207700_10544587 Ga0207700_105445871 261
114 3300025981 Ga0207640_10604759 Ga0207640_106047591 261
115 3300035086 Ga0373934_0052939 Ga0373934_0052939_594_1379 261
116 3300035118 Ga0373954_0014830 Ga0373954_0014830_2279_3064 261
117 3300035172 Ga0373955_0097044 Ga0373955_0097044_718_1503 261
118 3300035724 Ga0373933_0047906 Ga0373933_0047906_727_1512 261
119 3300036401 Ga0373937_0031903 Ga0373937_0031903_1491_2276 261
120 3300037853 Ga0436364_0207585 Ga0436364_0207585_91836_92621 261
121 3300037853 Ga0436364_1456120 Ga0436364_1456120_105_890 261
122 3300039447 Ga0436361_0489638 Ga0436361_0489638_161_946 261
123 3300039447 Ga0436361_0568821 Ga0436361_0568821_85_870 261
124 3300039450 Ga0436363_0757691 Ga0436363_0757691_572_1357 261
125 3300039450 Ga0436363_1460380 Ga0436363_1460380_1416_2201 261
126 3300039453 Ga0436362_0424694 Ga0436362_0424694_13_798 261
127 3300046559 Ga0495667_0144754 Ga0495667_0144754_243_1028 261
128 3300053077 Ga0495601_0046006 Ga0495601_0046006_864_1649 261
129 3300053085 Ga0495619_0066617 Ga0495619_0066617_24_809 261
130 3300054114 Ga0501084_0210188 Ga0501084_0210188_321_1169 262
131 3300003187 JGI25151J46595_10000185 JGI25151J46595_1000018553 263
132 3300005328 Ga0070676_10242473 Ga0070676_102424732 263
133 3300005330 Ga0070690_100000651 Ga0070690_1000006518 263
134 3300005334 Ga0068869_100000524 Ga0068869_1000005244 263
135 3300005340 Ga0070689_100001789 Ga0070689_1000017894 263
136 3300005340 Ga0070689_100239979 Ga0070689_1002399792 263
137 3300005345 Ga0070692_10001709 Ga0070692_100017097 263
138 3300005345 Ga0070692_10279979 Ga0070692_102799791 263
139 3300005353 Ga0070669_100619416 Ga0070669_1006194161 263
140 3300005356 Ga0070674_100130580 Ga0070674_1001305803 263
141 3300005356 Ga0070674_100171523 Ga0070674_1001715232 263
142 3300005364 Ga0070673_100226394 Ga0070673_1002263941 263
143 3300005366 Ga0070659_100044912 Ga0070659_1000449123 263
144 3300005367 Ga0070667_100486123 Ga0070667_1004861231 263
145 3300005438 Ga0070701_10000275 Ga0070701_100002752 263
146 3300005440 Ga0070705_100004608 Ga0070705_1000046083 263
147 3300005441 Ga0070700_100000379 Ga0070700_1000003794 263
148 3300005444 Ga0070694_100008076 Ga0070694_1000080761 263
149 3300005444 Ga0070694_100243093 Ga0070694_1002430932 263
150 3300005456 Ga0070678_100206337 Ga0070678_1002063372 263
151 3300005458 Ga0070681_10007435 Ga0070681_100074353 263
152 3300005459 Ga0068867_100000191 Ga0068867_10000019127 263
153 3300005459 Ga0068867_100074889 Ga0068867_1000748892 263
154 3300005471 Ga0070698_100145385 Ga0070698_1001453851 263
155 3300005539 Ga0068853_100006426 Ga0068853_1000064263 263
156 3300005544 Ga0070686_100000103 Ga0070686_10000010316 263
157 3300005545 Ga0070695_100014526 Ga0070695_1000145264 263
158 3300005545 Ga0070695_100257560 Ga0070695_1002575601 263
159 3300005545 Ga0070695_100272456 Ga0070695_1002724562 263
160 3300005547 Ga0070693_100006578 Ga0070693_1000065784 263
161 3300005548 Ga0070665_100079326 Ga0070665_1000793261 263
162 3300005549 Ga0070704_100022650 Ga0070704_1000226502 263
163 3300005578 Ga0068854_100219007 Ga0068854_1002190072 263
164 3300005615 Ga0070702_100000081 Ga0070702_10000008116 263
165 3300005617 Ga0068859_100053920 Ga0068859_1000539204 263
166 3300005618 Ga0068864_100255669 Ga0068864_1002556692 263
167 3300005718 Ga0068866_10000201 Ga0068866_1000020118 263
168 3300005719 Ga0068861_100000679 Ga0068861_10000067913 263
169 3300005842 Ga0068858_100000455 Ga0068858_10000045525 263
170 3300005842 Ga0068858_100422987 Ga0068858_1004229871 263
171 3300005843 Ga0068860_100001308 Ga0068860_10000130812 263
172 3300005844 Ga0068862_100001753 Ga0068862_10000175319 263
173 3300005844 Ga0068862_100121286 Ga0068862_1001212862 263
174 3300006358 Ga0068871_100003664 Ga0068871_1000036643 263
175 3300006358 Ga0068871_100088206 Ga0068871_1000882063 263
176 3300006358 Ga0068871_100280577 Ga0068871_1002805773 263
177 3300006881 Ga0068865_100000113 Ga0068865_10000011325 263
178 3300006931 Ga0097620_100053920 Ga0097620_1000539203 263
179 3300007265 Ga0099794_10069311 Ga0099794_100693111 263
180 3300009093 Ga0105240_10340158 Ga0105240_103401582 263
181 3300009098 Ga0105245_10000681 Ga0105245_1000068112 263
182 3300009098 Ga0105245_10517979 Ga0105245_105179792 263
183 3300009148 Ga0105243_10001082 Ga0105243_1000108223 263
184 3300009176 Ga0105242_10000201 Ga0105242_1000020118 263
185 3300009176 Ga0105242_10104952 Ga0105242_101049522 263
186 3300009545 Ga0105237_10160015 Ga0105237_101600152 263
187 3300009553 Ga0105249_10047962 Ga0105249_100479623 263
188 3300013297 Ga0157378_10000357 Ga0157378_1000035729 263
189 3300013297 Ga0157378_10162384 Ga0157378_101623842 263
190 3300013297 Ga0157378_10250249 Ga0157378_102502492 263
191 3300013297 Ga0157378_10316370 Ga0157378_103163701 263
192 3300013306 Ga0163162_10711341 Ga0163162_107113411 263
193 3300013308 Ga0157375_10213450 Ga0157375_102134501 263
194 3300014326 Ga0157380_10001221 Ga0157380_1000122110 263
195 3300014968 Ga0157379_10017094 Ga0157379_100170943 263
196 3300014969 Ga0157376_10014792 Ga0157376_100147922 263
197 3300014969 Ga0157376_10118112 Ga0157376_101181122 263
198 3300025294 Ga0209025_1000064 Ga0209025_1000064144 263
199 3300025899 Ga0207642_10001948 Ga0207642_100019486 263
200 3300025899 Ga0207642_10102004 Ga0207642_101020042 263
201 3300025908 Ga0207643_10006431 Ga0207643_100064314 263
202 3300025927 Ga0207687_10000430 Ga0207687_1000043022 263
203 3300025932 Ga0207690_10063692 Ga0207690_100636922 263
204 3300025932 Ga0207690_10098724 Ga0207690_100987242 263
205 3300025933 Ga0207706_10621676 Ga0207706_106216761 263
206 3300025934 Ga0207686_10000084 Ga0207686_1000008413 263
207 3300025934 Ga0207686_10219323 Ga0207686_102193231 263
208 3300025935 Ga0207709_10001426 Ga0207709_100014262 263
209 3300025935 Ga0207709_10140165 Ga0207709_101401653 263
210 3300025936 Ga0207670_10004098 Ga0207670_100040985 263
211 3300025938 Ga0207704_10000166 Ga0207704_1000016618 263
212 3300025942 Ga0207689_10000272 Ga0207689_1000027218 263
213 3300025942 Ga0207689_10128101 Ga0207689_101281011 263
214 3300025960 Ga0207651_10234907 Ga0207651_102349071 263
215 3300026023 Ga0207677_10091686 Ga0207677_100916862 263
216 3300026035 Ga0207703_10005996 Ga0207703_100059964 263
217 3300026035 Ga0207703_10155369 Ga0207703_101553691 263
218 3300026041 Ga0207639_10023286 Ga0207639_100232864 263
219 3300026075 Ga0207708_10000134 Ga0207708_1000013418 263
220 3300026075 Ga0207708_10016697 Ga0207708_100166974 263
221 3300026089 Ga0207648_10000433 Ga0207648_1000043328 263
222 3300026089 Ga0207648_10025781 Ga0207648_100257814 263
223 3300026118 Ga0207675_100000490 Ga0207675_10000049021 263
224 3300026121 Ga0207683_10015368 Ga0207683_100153685 263
225 3300026121 Ga0207683_10113271 Ga0207683_101132712 263
226 3300028380 Ga0268265_10005357 Ga0268265_100053576 263
227 3300028381 Ga0268264_10004638 Ga0268264_100046383 263
228 3300039438 Ga0436360_0082575 Ga0436360_0082575_973_1764 263
229 3300039453 Ga0436362_0505191 Ga0436362_0505191_1673_2476 263
230 3300049571 Ga0501034_0000390 Ga0501034_0000390_63270_64115 263
231 3300049571 Ga0501034_0044275 Ga0501034_0044275_3462_4343 263
232 3300049575 Ga0501039_0097985 Ga0501039_0097985_744_1589 263
233 3300049588 Ga0501072_0008369 Ga0501072_0008369_5197_6042 263
234 3300049588 Ga0501072_0178441 Ga0501072_0178441_660_1505 263
235 3300049744 Ga0501083_0010361 Ga0501083_0010361_86_931 263
236 3300049822 Ga0501035_0352632 Ga0501035_0352632_97_903 263
237 3300053098 Ga0500650_0127136 Ga0500650_0127136_161_1006 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

33

282

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9379 1 258
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.934 1 257
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9309 1 258
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9202 1 257
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.811 1 256
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9386 2 257 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9365 1 257 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9322 3 257 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9295 1 257 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9257 1 245 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2H4I8V2-F1-model_v4 Hydroxypyruvate isomerase (EC 5.3.1.22) 0.9744 1 207 GO:0008903
GO:0046487
AF-A0A382WZG8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9708 1 107 GO:0008903
GO:0046487
AF-A0A4V2A6E6-F1-model_v4 deleted 0.9679 1 203
AF-A0A3D1S253-F1-model_v4 Hydroxypyruvate isomerase 0.9679 1 206 GO:0008903
GO:0046487
AF-X1GH88-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.967 1 158 GO:0008903
GO:0046487

Feature Viewer

pLDDT pTM Quality
92.37 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map