F350076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 159 | 233 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300025936|Ga0207670_10004098|Ga0207670_100040985 |
| Length | 293 |
| Sequence | VLTQRRASEILTMPQFAANLHYLFSELPFLERFEAAAAAGFKAVEFQVPYDYPAAELSARLRASALQMVLFDAPMGNWAGGDRGLAAVPGKEKEFSDSLASVIEYGGALGCETVHLMAGVVGPGQDYAAAEHVYLSNLRHAAARLKVHGMTAVIEPINKKMGIVQNGPSYTTEGMHGYFLNHTAHARRVIEAVGSPNLRLHLDFYHMQMLEGHLAETIRQNIGLLKHVQIAGVPGRHEPSVGEINYPYLFNLLDELDYRGWVGCEYRPKSDTWTGLSWAQKYGIESVRPAHRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 2 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 3 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 4 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 78 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 124 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 125 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 126 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 127 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 128 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 129 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 139 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 158 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 159 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.31 |
| Metatranscriptomes | 0 |
| Isolates | 1.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.11 |
| Nodule | 0.84 |
| Rhizoplane | 1.27 |
| Rhizosphere | 91.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000185 | 3300003187 | Bacteria | 77945 |
| 2 | Ga0070676_10242473 | 3300005328 | Bacteria | 1199 |
| 3 | Ga0070690_100000651 | 3300005330 | Bacteria | 17695 |
| 4 | Ga0068869_100000524 | 3300005334 | Bacteria | 21367 |
| 5 | Ga0070680_100581450 | 3300005336 | Bacteria | 961 |
| 6 | Ga0070660_100638820 | 3300005339 | Bacteria | 891 |
| 7 | Ga0070689_100001789 | 3300005340 | Bacteria | 13808 |
| 8 | Ga0070689_100239979 | 3300005340 | Bacteria | 1492 |
| 9 | Ga0070689_100249175 | 3300005340 | Bacteria | 1465 |
| 10 | Ga0070692_10001709 | 3300005345 | Bacteria | 8163 |
| 11 | Ga0070692_10279979 | 3300005345 | Bacteria | 1010 |
| 12 | Ga0070669_100619416 | 3300005353 | Bacteria | 908 |
| 13 | Ga0070675_100507767 | 3300005354 | Bacteria | 1087 |
| 14 | Ga0070671_100030478 | 3300005355 | Bacteria | 4451 |
| 15 | Ga0070674_100130580 | 3300005356 | Bacteria | 1872 |
| 16 | Ga0070674_100171523 | 3300005356 | Bacteria | 1654 |
| 17 | Ga0070673_100226394 | 3300005364 | Bacteria | 1621 |
| 18 | Ga0070659_100044912 | 3300005366 | Bacteria | 3461 |
| 19 | Ga0070667_100486123 | 3300005367 | Bacteria | 1131 |
| 20 | Ga0070709_10456525 | 3300005434 | Bacteria | 963 |
| 21 | Ga0070714_100058458 | 3300005435 | Bacteria | 3303 |
| 22 | Ga0070714_100297139 | 3300005435 | Bacteria | 1504 |
| 23 | Ga0070713_100013944 | 3300005436 | Bacteria | 5950 |
| 24 | Ga0070713_100107869 | 3300005436 | Bacteria | 2423 |
| 25 | Ga0070713_100142767 | 3300005436 | Bacteria | 2122 |
| 26 | Ga0070713_100146302 | 3300005436 | Bacteria | 2098 |
| 27 | Ga0070713_100188637 | 3300005436 | Bacteria | 1857 |
| 28 | Ga0070701_10000275 | 3300005438 | Bacteria | 16779 |
| 29 | Ga0070711_100072528 | 3300005439 | Bacteria | 2429 |
| 30 | Ga0070711_100097034 | 3300005439 | Bacteria | 2136 |
| 31 | Ga0070705_100004608 | 3300005440 | Bacteria | 6709 |
| 32 | Ga0070700_100000379 | 3300005441 | Bacteria | 22793 |
| 33 | Ga0070694_100008076 | 3300005444 | Bacteria | 6428 |
| 34 | Ga0070694_100243093 | 3300005444 | Bacteria | 1358 |
| 35 | Ga0070708_100026573 | 3300005445 | Bacteria | 4956 |
| 36 | Ga0070678_100206337 | 3300005456 | Bacteria | 1625 |
| 37 | Ga0070681_10007435 | 3300005458 | Bacteria | 10706 |
| 38 | Ga0070681_10348666 | 3300005458 | Bacteria | 1391 |
| 39 | Ga0068867_100000191 | 3300005459 | Bacteria | 40494 |
| 40 | Ga0068867_100074889 | 3300005459 | Bacteria | 2538 |
| 41 | Ga0070706_100187637 | 3300005467 | Bacteria | 1932 |
| 42 | Ga0070707_100004092 | 3300005468 | Bacteria | 13688 |
| 43 | Ga0070698_100004893 | 3300005471 | Bacteria | 14702 |
| 44 | Ga0070698_100007059 | 3300005471 | Bacteria | 12163 |
| 45 | Ga0070698_100145385 | 3300005471 | Bacteria | 2321 |
| 46 | Ga0070697_100043479 | 3300005536 | Bacteria | 3638 |
| 47 | Ga0070697_100134224 | 3300005536 | Bacteria | 2078 |
| 48 | Ga0070697_100143337 | 3300005536 | Bacteria | 2010 |
| 49 | Ga0068853_100006426 | 3300005539 | Bacteria | 9340 |
| 50 | Ga0070686_100000103 | 3300005544 | Bacteria | 58400 |
| 51 | Ga0070695_100014526 | 3300005545 | Bacteria | 4748 |
| 52 | Ga0070695_100257560 | 3300005545 | Unclassified | 1273 |
| 53 | Ga0070695_100272456 | 3300005545 | Bacteria | 1240 |
| 54 | Ga0070693_100006578 | 3300005547 | Bacteria | 5638 |
| 55 | Ga0070665_100079326 | 3300005548 | Bacteria | 3289 |
| 56 | Ga0070704_100022650 | 3300005549 | Bacteria | 4090 |
| 57 | Ga0068854_100219007 | 3300005578 | Bacteria | 1505 |
| 58 | Ga0068854_100776734 | 3300005578 | Bacteria | 833 |
| 59 | Ga0068856_100171072 | 3300005614 | Bacteria | 2184 |
| 60 | Ga0070702_100000081 | 3300005615 | Bacteria | 27675 |
| 61 | Ga0068852_100012289 | 3300005616 | Bacteria | 6493 |
| 62 | Ga0068859_100053920 | 3300005617 | Bacteria | 4043 |
| 63 | Ga0068864_100255669 | 3300005618 | Bacteria | 1628 |
| 64 | Ga0068866_10000201 | 3300005718 | Bacteria | 28091 |
| 65 | Ga0068861_100000679 | 3300005719 | Bacteria | 20302 |
| 66 | Ga0068858_100000455 | 3300005842 | Bacteria | 42847 |
| 67 | Ga0068858_100422987 | 3300005842 | Bacteria | 1281 |
| 68 | Ga0068860_100001308 | 3300005843 | Bacteria | 27073 |
| 69 | Ga0068862_100001753 | 3300005844 | Bacteria | 19644 |
| 70 | Ga0068862_100121286 | 3300005844 | Bacteria | 2304 |
| 71 | Ga0081540_1048988 | 3300005983 | Bacteria | 2111 |
| 72 | Ga0070717_10059007 | 3300006028 | Bacteria | 3174 |
| 73 | Ga0070717_10061290 | 3300006028 | Bacteria | 3117 |
| 74 | Ga0070717_10411017 | 3300006028 | Bacteria | 1216 |
| 75 | Ga0070716_100434555 | 3300006173 | Unclassified | 953 |
| 76 | Ga0070712_100022268 | 3300006175 | Bacteria | 4172 |
| 77 | Ga0070712_100138422 | 3300006175 | Bacteria | 1854 |
| 78 | Ga0070712_100306182 | 3300006175 | Bacteria | 1287 |
| 79 | Ga0070712_100320892 | 3300006175 | Bacteria | 1259 |
| 80 | Ga0070712_100710681 | 3300006175 | Bacteria | 857 |
| 81 | Ga0068871_100003664 | 3300006358 | Bacteria | 10561 |
| 82 | Ga0068871_100088206 | 3300006358 | Bacteria | 2581 |
| 83 | Ga0068871_100280577 | 3300006358 | Bacteria | 1457 |
| 84 | Ga0068865_100000113 | 3300006881 | Bacteria | 41428 |
| 85 | Ga0097620_100053920 | 3300006931 | Bacteria | 4043 |
| 86 | Ga0075435_100180371 | 3300007076 | Bacteria | 1784 |
| 87 | Ga0099794_10069311 | 3300007265 | Bacteria | 1725 |
| 88 | Ga0105240_10279141 | 3300009093 | Bacteria | 1920 |
| 89 | Ga0105240_10340158 | 3300009093 | Bacteria | 1705 |
| 90 | Ga0105245_10000681 | 3300009098 | Bacteria | 30711 |
| 91 | Ga0105245_10517979 | 3300009098 | Bacteria | 1211 |
| 92 | Ga0105243_10001082 | 3300009148 | Bacteria | 24928 |
| 93 | Ga0105242_10000201 | 3300009176 | Bacteria | 46357 |
| 94 | Ga0105242_10104952 | 3300009176 | Bacteria | 2399 |
| 95 | Ga0105237_10160015 | 3300009545 | Bacteria | 2250 |
| 96 | Ga0105238_10008348 | 3300009551 | Bacteria | 10362 |
| 97 | Ga0105249_10047962 | 3300009553 | Bacteria | 3894 |
| 98 | Ga0099796_10028467 | 3300010159 | Bacteria | 1794 |
| 99 | Ga0157378_10000357 | 3300013297 | Bacteria | 44996 |
| 100 | Ga0157378_10162384 | 3300013297 | Bacteria | 2090 |
| 101 | Ga0157378_10250249 | 3300013297 | Unclassified | 1696 |
| 102 | Ga0157378_10316370 | 3300013297 | Bacteria | 1515 |
| 103 | Ga0163162_10264908 | 3300013306 | Bacteria | 1850 |
| 104 | Ga0163162_10408160 | 3300013306 | Bacteria | 1491 |
| 105 | Ga0163162_10711341 | 3300013306 | Bacteria | 1126 |
| 106 | Ga0157375_10213450 | 3300013308 | Bacteria | 2088 |
| 107 | Ga0157380_10001221 | 3300014326 | Bacteria | 16662 |
| 108 | Ga0157379_10017094 | 3300014968 | Bacteria | 6385 |
| 109 | Ga0157376_10014792 | 3300014969 | Bacteria | 5873 |
| 110 | Ga0157376_10118112 | 3300014969 | Unclassified | 2346 |
| 111 | Ga0213876_10104778 | 3300021384 | Bacteria | 1500 |
| 112 | Ga0213875_10000254 | 3300021388 | Bacteria | 53556 |
| 113 | Ga0213875_10000988 | 3300021388 | Bacteria | 20330 |
| 114 | Ga0209025_1000064 | 3300025294 | Bacteria | 301309 |
| 115 | Ga0207692_10021055 | 3300025898 | Bacteria | 2977 |
| 116 | Ga0207642_10001948 | 3300025899 | Bacteria | 6368 |
| 117 | Ga0207642_10102004 | 3300025899 | Bacteria | 1442 |
| 118 | Ga0207699_10074280 | 3300025906 | Bacteria | 2088 |
| 119 | Ga0207699_10125545 | 3300025906 | Bacteria | 1666 |
| 120 | Ga0207643_10006431 | 3300025908 | Bacteria | 6292 |
| 121 | Ga0207684_10007033 | 3300025910 | Bacteria | 10177 |
| 122 | Ga0207684_10136966 | 3300025910 | Bacteria | 2103 |
| 123 | Ga0207707_10068268 | 3300025912 | Bacteria | 3097 |
| 124 | Ga0207693_10002952 | 3300025915 | Bacteria | 14722 |
| 125 | Ga0207693_10027830 | 3300025915 | Bacteria | 4468 |
| 126 | Ga0207693_10078593 | 3300025915 | Bacteria | 2582 |
| 127 | Ga0207693_10099795 | 3300025915 | Bacteria | 2276 |
| 128 | Ga0207693_10245391 | 3300025915 | Bacteria | 1406 |
| 129 | Ga0207693_10359489 | 3300025915 | Bacteria | 1139 |
| 130 | Ga0207663_10006016 | 3300025916 | Bacteria | 6169 |
| 131 | Ga0207660_10347279 | 3300025917 | Bacteria | 1189 |
| 132 | Ga0207646_10009859 | 3300025922 | Bacteria | 9403 |
| 133 | Ga0207694_10043329 | 3300025924 | Bacteria | 3473 |
| 134 | Ga0207659_10348662 | 3300025926 | Bacteria | 1228 |
| 135 | Ga0207687_10000430 | 3300025927 | Bacteria | 28463 |
| 136 | Ga0207700_10020818 | 3300025928 | Bacteria | 4464 |
| 137 | Ga0207700_10086338 | 3300025928 | Bacteria | 2465 |
| 138 | Ga0207700_10104851 | 3300025928 | Bacteria | 2263 |
| 139 | Ga0207700_10182963 | 3300025928 | Bacteria | 1756 |
| 140 | Ga0207700_10544587 | 3300025928 | Bacteria | 1030 |
| 141 | Ga0207664_10337393 | 3300025929 | Bacteria | 1332 |
| 142 | Ga0207664_10534569 | 3300025929 | Bacteria | 1051 |
| 143 | Ga0207690_10063692 | 3300025932 | Bacteria | 2515 |
| 144 | Ga0207690_10098724 | 3300025932 | Bacteria | 2081 |
| 145 | Ga0207706_10621676 | 3300025933 | Bacteria | 927 |
| 146 | Ga0207686_10000084 | 3300025934 | Bacteria | 79402 |
| 147 | Ga0207686_10219323 | 3300025934 | Bacteria | 1372 |
| 148 | Ga0207709_10001426 | 3300025935 | Bacteria | 16740 |
| 149 | Ga0207709_10140165 | 3300025935 | Bacteria | 1661 |
| 150 | Ga0207670_10004098 | 3300025936 | Bacteria | 7805 |
| 151 | Ga0207704_10000166 | 3300025938 | Bacteria | 34959 |
| 152 | Ga0207689_10000272 | 3300025942 | Bacteria | 46619 |
| 153 | Ga0207689_10128101 | 3300025942 | Bacteria | 2088 |
| 154 | Ga0207667_10182187 | 3300025949 | Bacteria | 2157 |
| 155 | Ga0207651_10234907 | 3300025960 | Bacteria | 1491 |
| 156 | Ga0207640_10604759 | 3300025981 | Bacteria | 928 |
| 157 | Ga0207677_10091686 | 3300026023 | Bacteria | 2211 |
| 158 | Ga0207703_10005996 | 3300026035 | Bacteria | 9736 |
| 159 | Ga0207703_10155369 | 3300026035 | Bacteria | 1999 |
| 160 | Ga0207639_10023286 | 3300026041 | Bacteria | 4471 |
| 161 | Ga0207708_10000134 | 3300026075 | Bacteria | 58313 |
| 162 | Ga0207708_10016697 | 3300026075 | Bacteria | 5525 |
| 163 | Ga0207702_10009704 | 3300026078 | Bacteria | 8083 |
| 164 | Ga0207648_10000433 | 3300026089 | Bacteria | 46203 |
| 165 | Ga0207648_10025781 | 3300026089 | Bacteria | 5232 |
| 166 | Ga0207675_100000490 | 3300026118 | Bacteria | 38407 |
| 167 | Ga0207683_10015368 | 3300026121 | Bacteria | 6518 |
| 168 | Ga0207683_10113271 | 3300026121 | Bacteria | 2429 |
| 169 | Ga0207698_10018789 | 3300026142 | Bacteria | 4719 |
| 170 | Ga0207698_10028226 | 3300026142 | Bacteria | 3999 |
| 171 | Ga0268265_10005357 | 3300028380 | Bacteria | 8785 |
| 172 | Ga0268264_10004638 | 3300028381 | Bacteria | 11677 |
| 173 | Ga0265313_10093075 | 3300031595 | Bacteria | 1349 |
| 174 | Ga0373934_0052939 | 3300035086 | Bacteria | 1610 |
| 175 | Ga0373945_0120490 | 3300035116 | Bacteria | 1043 |
| 176 | Ga0373954_0014830 | 3300035118 | Bacteria | 3477 |
| 177 | Ga0373943_0044817 | 3300035170 | Bacteria | 2154 |
| 178 | Ga0373943_0409814 | 3300035170 | Bacteria | 783 |
| 179 | Ga0373955_0097044 | 3300035172 | Bacteria | 1687 |
| 180 | Ga0373955_0195510 | 3300035172 | Bacteria | 1203 |
| 181 | Ga0373933_0047906 | 3300035724 | Bacteria | 2543 |
| 182 | Ga0373933_0146459 | 3300035724 | Bacteria | 1494 |
| 183 | Ga0373937_0031903 | 3300036401 | Bacteria | 4775 |
| 184 | Ga0373937_0056945 | 3300036401 | Bacteria | 3590 |
| 185 | Ga0373937_0072555 | 3300036401 | Bacteria | 3175 |
| 186 | Ga0436364_0207585 | 3300037853 | Bacteria | 136246 |
| 187 | Ga0436364_0951399 | 3300037853 | Bacteria | 78546 |
| 188 | Ga0436364_1456120 | 3300037853 | Bacteria | 1234 |
| 189 | Ga0436365_0282953 | 3300039437 | Bacteria | 7295 |
| 190 | Ga0436360_0082575 | 3300039438 | Bacteria | 1863 |
| 191 | Ga0436361_0451583 | 3300039447 | Bacteria | 7913 |
| 192 | Ga0436361_0489638 | 3300039447 | Bacteria | 1144 |
| 193 | Ga0436361_0568821 | 3300039447 | Bacteria | 1274 |
| 194 | Ga0436361_0721948 | 3300039447 | Bacteria | 1569 |
| 195 | Ga0436363_0757691 | 3300039450 | Bacteria | 1966 |
| 196 | Ga0436363_1460380 | 3300039450 | Bacteria | 2373 |
| 197 | Ga0436362_0424694 | 3300039453 | Bacteria | 1234 |
| 198 | Ga0436362_0505191 | 3300039453 | Bacteria | 3251 |
| 199 | Ga0495618_0064683 | 3300046514 | Bacteria | 2324 |
| 200 | Ga0495628_0227701 | 3300046516 | Bacteria | 1398 |
| 201 | Ga0495667_0035834 | 3300046559 | Bacteria | 3314 |
| 202 | Ga0495667_0144754 | 3300046559 | Bacteria | 1531 |
| 203 | Ga0495634_0077696 | 3300046642 | Bacteria | 2176 |
| 204 | Ga0495635_0110319 | 3300046663 | Bacteria | 1879 |
| 205 | Ga0495600_0021183 | 3300046809 | Bacteria | 4162 |
| 206 | Ga0495680_0076221 | 3300047322 | Bacteria | 2543 |
| 207 | Ga0496104_0111888 | 3300048907 | Bacteria | 2618 |
| 208 | Ga0496112_0053790 | 3300048915 | Bacteria | 3954 |
| 209 | Ga0496113_0039963 | 3300048916 | Bacteria | 3455 |
| 210 | Ga0496120_0130397 | 3300048923 | Bacteria | 1288 |
| 211 | Ga0501034_0000390 | 3300049571 | Bacteria | 74693 |
| 212 | Ga0501034_0044275 | 3300049571 | Bacteria | 4502 |
| 213 | Ga0501039_0097985 | 3300049575 | Bacteria | 2287 |
| 214 | Ga0501068_0010429 | 3300049584 | Bacteria | 5221 |
| 215 | Ga0501070_0317317 | 3300049586 | Bacteria | 1268 |
| 216 | Ga0501072_0008369 | 3300049588 | Bacteria | 7853 |
| 217 | Ga0501072_0178441 | 3300049588 | Bacteria | 1694 |
| 218 | Ga0501073_0001899 | 3300049589 | Bacteria | 15583 |
| 219 | Ga0501074_0052289 | 3300049590 | Bacteria | 2949 |
| 220 | Ga0501080_0000290 | 3300049742 | Bacteria | 38083 |
| 221 | Ga0501083_0010361 | 3300049744 | Bacteria | 6563 |
| 222 | Ga0501035_0352632 | 3300049822 | Bacteria | 1231 |
| 223 | nmdc:mga0n895_248198_c1 | 3300050512 | Bacteria | 1806 |
| 224 | nmdc:mga0rr50_83172_c1 | 3300050513 | Bacteria | 2474 |
| 225 | nmdc:mga08x19_171457_c1 | 3300050514 | Bacteria | 1478 |
| 226 | Ga0495601_0046006 | 3300053077 | Bacteria | 2746 |
| 227 | Ga0495595_0018243 | 3300053084 | Bacteria | 3031 |
| 228 | Ga0495619_0003540 | 3300053085 | Bacteria | 10081 |
| 229 | Ga0495619_0066617 | 3300053085 | Bacteria | 2403 |
| 230 | Ga0500566_0152401 | 3300053094 | Bacteria | 1214 |
| 231 | Ga0500650_0127136 | 3300053098 | Bacteria | 1186 |
| 232 | Ga0500616_0006483 | 3300053153 | Bacteria | 7656 |
| 233 | Ga0501084_0210188 | 3300054114 | Bacteria | 1642 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035172 | Ga0373955_0195510 | Ga0373955_0195510_300_1139 | 231 |
| 2 | 3300025929 | Ga0207664_10534569 | Ga0207664_105345691 | 232 |
| 3 | 3300005340 | Ga0070689_100249175 | Ga0070689_1002491752 | 246 |
| 4 | 3300035116 | Ga0373945_0120490 | Ga0373945_0120490_16_771 | 248 |
| 5 | 3300035724 | Ga0373933_0146459 | Ga0373933_0146459_70_822 | 250 |
| 6 | 3300046514 | Ga0495618_0064683 | Ga0495618_0064683_1084_1836 | 250 |
| 7 | 3300046516 | Ga0495628_0227701 | Ga0495628_0227701_225_977 | 250 |
| 8 | 3300046642 | Ga0495634_0077696 | Ga0495634_0077696_502_1254 | 250 |
| 9 | 3300046663 | Ga0495635_0110319 | Ga0495635_0110319_92_844 | 250 |
| 10 | 3300046809 | Ga0495600_0021183 | Ga0495600_0021183_1059_1811 | 250 |
| 11 | 3300053085 | Ga0495619_0003540 | Ga0495619_0003540_3285_4037 | 250 |
| 12 | 3300025928 | Ga0207700_10020818 | Ga0207700_100208185 | 251 |
| 13 | 3300036401 | Ga0373937_0056945 | Ga0373937_0056945_1951_2706 | 251 |
| 14 | 3300046559 | Ga0495667_0035834 | Ga0495667_0035834_1410_2165 | 251 |
| 15 | 3300047322 | Ga0495680_0076221 | Ga0495680_0076221_974_1729 | 251 |
| 16 | 3300048915 | Ga0496112_0053790 | Ga0496112_0053790_522_1277 | 251 |
| 17 | 3300053084 | Ga0495595_0018243 | Ga0495595_0018243_922_1677 | 251 |
| 18 | 3300035170 | Ga0373943_0409814 | Ga0373943_0409814_10_768 | 252 |
| 19 | 3300039437 | Ga0436365_0282953 | Ga0436365_0282953_1016_1774 | 252 |
| 20 | iso_pu_bacteria | 2917554339 | 2917554624 | 252 |
| 21 | 3300005616 | Ga0068852_100012289 | Ga0068852_1000122894 | 253 |
| 22 | 3300025949 | Ga0207667_10182187 | Ga0207667_101821872 | 253 |
| 23 | 3300026142 | Ga0207698_10018789 | Ga0207698_100187892 | 253 |
| 24 | 3300026142 | Ga0207698_10028226 | Ga0207698_100282264 | 253 |
| 25 | 3300053094 | Ga0500566_0152401 | Ga0500566_0152401_117_890 | 253 |
| 26 | 3300053153 | Ga0500616_0006483 | Ga0500616_0006483_3557_4330 | 253 |
| 27 | 3300005436 | Ga0070713_100146302 | Ga0070713_1001463022 | 258 |
| 28 | 3300005536 | Ga0070697_100143337 | Ga0070697_1001433372 | 258 |
| 29 | 3300009093 | Ga0105240_10279141 | Ga0105240_102791412 | 258 |
| 30 | 3300009551 | Ga0105238_10008348 | Ga0105238_1000834810 | 258 |
| 31 | 3300025915 | Ga0207693_10359489 | Ga0207693_103594891 | 258 |
| 32 | 3300025924 | Ga0207694_10043329 | Ga0207694_100433293 | 258 |
| 33 | 3300039447 | Ga0436361_0451583 | Ga0436361_0451583_2016_2792 | 258 |
| 34 | 3300048923 | Ga0496120_0130397 | Ga0496120_0130397_31_807 | 258 |
| 35 | 3300049584 | Ga0501068_0010429 | Ga0501068_0010429_3841_4686 | 259 |
| 36 | 3300049589 | Ga0501073_0001899 | Ga0501073_0001899_6507_7352 | 259 |
| 37 | 3300049590 | Ga0501074_0052289 | Ga0501074_0052289_49_894 | 259 |
| 38 | 3300049742 | Ga0501080_0000290 | Ga0501080_0000290_17144_17989 | 259 |
| 39 | iso_pu_bacteria | 2855730933 | 2855734872 | 259 |
| 40 | iso_pu_bacteria | 2855767633 | 2855770656 | 259 |
| 41 | iso_pu_bacteria | 2881412998 | 2881413198 | 259 |
| 42 | 3300005336 | Ga0070680_100581450 | Ga0070680_1005814501 | 260 |
| 43 | 3300005355 | Ga0070671_100030478 | Ga0070671_1000304785 | 260 |
| 44 | 3300005434 | Ga0070709_10456525 | Ga0070709_104565251 | 260 |
| 45 | 3300005435 | Ga0070714_100297139 | Ga0070714_1002971392 | 260 |
| 46 | 3300005436 | Ga0070713_100107869 | Ga0070713_1001078691 | 260 |
| 47 | 3300005436 | Ga0070713_100142767 | Ga0070713_1001427672 | 260 |
| 48 | 3300005445 | Ga0070708_100026573 | Ga0070708_1000265734 | 260 |
| 49 | 3300005458 | Ga0070681_10348666 | Ga0070681_103486662 | 260 |
| 50 | 3300005468 | Ga0070707_100004092 | Ga0070707_1000040924 | 260 |
| 51 | 3300005471 | Ga0070698_100007059 | Ga0070698_1000070599 | 260 |
| 52 | 3300005536 | Ga0070697_100043479 | Ga0070697_1000434793 | 260 |
| 53 | 3300005614 | Ga0068856_100171072 | Ga0068856_1001710722 | 260 |
| 54 | 3300006028 | Ga0070717_10061290 | Ga0070717_100612903 | 260 |
| 55 | 3300006028 | Ga0070717_10411017 | Ga0070717_104110172 | 260 |
| 56 | 3300006175 | Ga0070712_100138422 | Ga0070712_1001384222 | 260 |
| 57 | 3300006175 | Ga0070712_100710681 | Ga0070712_1007106811 | 260 |
| 58 | 3300007076 | Ga0075435_100180371 | Ga0075435_1001803712 | 260 |
| 59 | 3300013306 | Ga0163162_10264908 | Ga0163162_102649083 | 260 |
| 60 | 3300021388 | Ga0213875_10000254 | Ga0213875_1000025414 | 260 |
| 61 | 3300025910 | Ga0207684_10007033 | Ga0207684_100070339 | 260 |
| 62 | 3300025912 | Ga0207707_10068268 | Ga0207707_100682683 | 260 |
| 63 | 3300025915 | Ga0207693_10078593 | Ga0207693_100785933 | 260 |
| 64 | 3300025915 | Ga0207693_10245391 | Ga0207693_102453912 | 260 |
| 65 | 3300025917 | Ga0207660_10347279 | Ga0207660_103472791 | 260 |
| 66 | 3300025922 | Ga0207646_10009859 | Ga0207646_100098595 | 260 |
| 67 | 3300025928 | Ga0207700_10086338 | Ga0207700_100863383 | 260 |
| 68 | 3300025928 | Ga0207700_10104851 | Ga0207700_101048512 | 260 |
| 69 | 3300025929 | Ga0207664_10337393 | Ga0207664_103373932 | 260 |
| 70 | 3300026078 | Ga0207702_10009704 | Ga0207702_100097045 | 260 |
| 71 | 3300031595 | Ga0265313_10093075 | Ga0265313_100930752 | 260 |
| 72 | 3300035170 | Ga0373943_0044817 | Ga0373943_0044817_605_1387 | 260 |
| 73 | 3300036401 | Ga0373937_0072555 | Ga0373937_0072555_983_1765 | 260 |
| 74 | 3300037853 | Ga0436364_0951399 | Ga0436364_0951399_39453_40238 | 260 |
| 75 | 3300039447 | Ga0436361_0721948 | Ga0436361_0721948_143_925 | 260 |
| 76 | 3300048907 | Ga0496104_0111888 | Ga0496104_0111888_409_1191 | 260 |
| 77 | 3300048916 | Ga0496113_0039963 | Ga0496113_0039963_427_1209 | 260 |
| 78 | 3300049586 | Ga0501070_0317317 | Ga0501070_0317317_41_826 | 260 |
| 79 | 3300050512 | nmdc:mga0n895_248198_c1 | nmdc:mga0n895_248198_c1_883_1665 | 260 |
| 80 | 3300050513 | nmdc:mga0rr50_83172_c1 | nmdc:mga0rr50_83172_c1_1267_2049 | 260 |
| 81 | 3300050514 | nmdc:mga08x19_171457_c1 | nmdc:mga08x19_171457_c1_491_1273 | 260 |
| 82 | 3300005339 | Ga0070660_100638820 | Ga0070660_1006388201 | 261 |
| 83 | 3300005354 | Ga0070675_100507767 | Ga0070675_1005077671 | 261 |
| 84 | 3300005435 | Ga0070714_100058458 | Ga0070714_1000584582 | 261 |
| 85 | 3300005436 | Ga0070713_100013944 | Ga0070713_1000139443 | 261 |
| 86 | 3300005436 | Ga0070713_100188637 | Ga0070713_1001886372 | 261 |
| 87 | 3300005439 | Ga0070711_100072528 | Ga0070711_1000725282 | 261 |
| 88 | 3300005439 | Ga0070711_100097034 | Ga0070711_1000970342 | 261 |
| 89 | 3300005467 | Ga0070706_100187637 | Ga0070706_1001876372 | 261 |
| 90 | 3300005471 | Ga0070698_100004893 | Ga0070698_1000048932 | 261 |
| 91 | 3300005536 | Ga0070697_100134224 | Ga0070697_1001342242 | 261 |
| 92 | 3300005578 | Ga0068854_100776734 | Ga0068854_1007767341 | 261 |
| 93 | 3300005983 | Ga0081540_1048988 | Ga0081540_10489882 | 261 |
| 94 | 3300006028 | Ga0070717_10059007 | Ga0070717_100590073 | 261 |
| 95 | 3300006173 | Ga0070716_100434555 | Ga0070716_1004345552 | 261 |
| 96 | 3300006175 | Ga0070712_100022268 | Ga0070712_1000222685 | 261 |
| 97 | 3300006175 | Ga0070712_100306182 | Ga0070712_1003061822 | 261 |
| 98 | 3300006175 | Ga0070712_100320892 | Ga0070712_1003208922 | 261 |
| 99 | 3300010159 | Ga0099796_10028467 | Ga0099796_100284672 | 261 |
| 100 | 3300013306 | Ga0163162_10408160 | Ga0163162_104081602 | 261 |
| 101 | 3300021384 | Ga0213876_10104778 | Ga0213876_101047782 | 261 |
| 102 | 3300021388 | Ga0213875_10000988 | Ga0213875_100009883 | 261 |
| 103 | 3300025898 | Ga0207692_10021055 | Ga0207692_100210552 | 261 |
| 104 | 3300025906 | Ga0207699_10074280 | Ga0207699_100742802 | 261 |
| 105 | 3300025906 | Ga0207699_10125545 | Ga0207699_101255452 | 261 |
| 106 | 3300025910 | Ga0207684_10136966 | Ga0207684_101369662 | 261 |
| 107 | 3300025915 | Ga0207693_10002952 | Ga0207693_100029527 | 261 |
| 108 | 3300025915 | Ga0207693_10027830 | Ga0207693_100278302 | 261 |
| 109 | 3300025915 | Ga0207693_10099795 | Ga0207693_100997951 | 261 |
| 110 | 3300025916 | Ga0207663_10006016 | Ga0207663_100060165 | 261 |
| 111 | 3300025926 | Ga0207659_10348662 | Ga0207659_103486622 | 261 |
| 112 | 3300025928 | Ga0207700_10182963 | Ga0207700_101829632 | 261 |
| 113 | 3300025928 | Ga0207700_10544587 | Ga0207700_105445871 | 261 |
| 114 | 3300025981 | Ga0207640_10604759 | Ga0207640_106047591 | 261 |
| 115 | 3300035086 | Ga0373934_0052939 | Ga0373934_0052939_594_1379 | 261 |
| 116 | 3300035118 | Ga0373954_0014830 | Ga0373954_0014830_2279_3064 | 261 |
| 117 | 3300035172 | Ga0373955_0097044 | Ga0373955_0097044_718_1503 | 261 |
| 118 | 3300035724 | Ga0373933_0047906 | Ga0373933_0047906_727_1512 | 261 |
| 119 | 3300036401 | Ga0373937_0031903 | Ga0373937_0031903_1491_2276 | 261 |
| 120 | 3300037853 | Ga0436364_0207585 | Ga0436364_0207585_91836_92621 | 261 |
| 121 | 3300037853 | Ga0436364_1456120 | Ga0436364_1456120_105_890 | 261 |
| 122 | 3300039447 | Ga0436361_0489638 | Ga0436361_0489638_161_946 | 261 |
| 123 | 3300039447 | Ga0436361_0568821 | Ga0436361_0568821_85_870 | 261 |
| 124 | 3300039450 | Ga0436363_0757691 | Ga0436363_0757691_572_1357 | 261 |
| 125 | 3300039450 | Ga0436363_1460380 | Ga0436363_1460380_1416_2201 | 261 |
| 126 | 3300039453 | Ga0436362_0424694 | Ga0436362_0424694_13_798 | 261 |
| 127 | 3300046559 | Ga0495667_0144754 | Ga0495667_0144754_243_1028 | 261 |
| 128 | 3300053077 | Ga0495601_0046006 | Ga0495601_0046006_864_1649 | 261 |
| 129 | 3300053085 | Ga0495619_0066617 | Ga0495619_0066617_24_809 | 261 |
| 130 | 3300054114 | Ga0501084_0210188 | Ga0501084_0210188_321_1169 | 262 |
| 131 | 3300003187 | JGI25151J46595_10000185 | JGI25151J46595_1000018553 | 263 |
| 132 | 3300005328 | Ga0070676_10242473 | Ga0070676_102424732 | 263 |
| 133 | 3300005330 | Ga0070690_100000651 | Ga0070690_1000006518 | 263 |
| 134 | 3300005334 | Ga0068869_100000524 | Ga0068869_1000005244 | 263 |
| 135 | 3300005340 | Ga0070689_100001789 | Ga0070689_1000017894 | 263 |
| 136 | 3300005340 | Ga0070689_100239979 | Ga0070689_1002399792 | 263 |
| 137 | 3300005345 | Ga0070692_10001709 | Ga0070692_100017097 | 263 |
| 138 | 3300005345 | Ga0070692_10279979 | Ga0070692_102799791 | 263 |
| 139 | 3300005353 | Ga0070669_100619416 | Ga0070669_1006194161 | 263 |
| 140 | 3300005356 | Ga0070674_100130580 | Ga0070674_1001305803 | 263 |
| 141 | 3300005356 | Ga0070674_100171523 | Ga0070674_1001715232 | 263 |
| 142 | 3300005364 | Ga0070673_100226394 | Ga0070673_1002263941 | 263 |
| 143 | 3300005366 | Ga0070659_100044912 | Ga0070659_1000449123 | 263 |
| 144 | 3300005367 | Ga0070667_100486123 | Ga0070667_1004861231 | 263 |
| 145 | 3300005438 | Ga0070701_10000275 | Ga0070701_100002752 | 263 |
| 146 | 3300005440 | Ga0070705_100004608 | Ga0070705_1000046083 | 263 |
| 147 | 3300005441 | Ga0070700_100000379 | Ga0070700_1000003794 | 263 |
| 148 | 3300005444 | Ga0070694_100008076 | Ga0070694_1000080761 | 263 |
| 149 | 3300005444 | Ga0070694_100243093 | Ga0070694_1002430932 | 263 |
| 150 | 3300005456 | Ga0070678_100206337 | Ga0070678_1002063372 | 263 |
| 151 | 3300005458 | Ga0070681_10007435 | Ga0070681_100074353 | 263 |
| 152 | 3300005459 | Ga0068867_100000191 | Ga0068867_10000019127 | 263 |
| 153 | 3300005459 | Ga0068867_100074889 | Ga0068867_1000748892 | 263 |
| 154 | 3300005471 | Ga0070698_100145385 | Ga0070698_1001453851 | 263 |
| 155 | 3300005539 | Ga0068853_100006426 | Ga0068853_1000064263 | 263 |
| 156 | 3300005544 | Ga0070686_100000103 | Ga0070686_10000010316 | 263 |
| 157 | 3300005545 | Ga0070695_100014526 | Ga0070695_1000145264 | 263 |
| 158 | 3300005545 | Ga0070695_100257560 | Ga0070695_1002575601 | 263 |
| 159 | 3300005545 | Ga0070695_100272456 | Ga0070695_1002724562 | 263 |
| 160 | 3300005547 | Ga0070693_100006578 | Ga0070693_1000065784 | 263 |
| 161 | 3300005548 | Ga0070665_100079326 | Ga0070665_1000793261 | 263 |
| 162 | 3300005549 | Ga0070704_100022650 | Ga0070704_1000226502 | 263 |
| 163 | 3300005578 | Ga0068854_100219007 | Ga0068854_1002190072 | 263 |
| 164 | 3300005615 | Ga0070702_100000081 | Ga0070702_10000008116 | 263 |
| 165 | 3300005617 | Ga0068859_100053920 | Ga0068859_1000539204 | 263 |
| 166 | 3300005618 | Ga0068864_100255669 | Ga0068864_1002556692 | 263 |
| 167 | 3300005718 | Ga0068866_10000201 | Ga0068866_1000020118 | 263 |
| 168 | 3300005719 | Ga0068861_100000679 | Ga0068861_10000067913 | 263 |
| 169 | 3300005842 | Ga0068858_100000455 | Ga0068858_10000045525 | 263 |
| 170 | 3300005842 | Ga0068858_100422987 | Ga0068858_1004229871 | 263 |
| 171 | 3300005843 | Ga0068860_100001308 | Ga0068860_10000130812 | 263 |
| 172 | 3300005844 | Ga0068862_100001753 | Ga0068862_10000175319 | 263 |
| 173 | 3300005844 | Ga0068862_100121286 | Ga0068862_1001212862 | 263 |
| 174 | 3300006358 | Ga0068871_100003664 | Ga0068871_1000036643 | 263 |
| 175 | 3300006358 | Ga0068871_100088206 | Ga0068871_1000882063 | 263 |
| 176 | 3300006358 | Ga0068871_100280577 | Ga0068871_1002805773 | 263 |
| 177 | 3300006881 | Ga0068865_100000113 | Ga0068865_10000011325 | 263 |
| 178 | 3300006931 | Ga0097620_100053920 | Ga0097620_1000539203 | 263 |
| 179 | 3300007265 | Ga0099794_10069311 | Ga0099794_100693111 | 263 |
| 180 | 3300009093 | Ga0105240_10340158 | Ga0105240_103401582 | 263 |
| 181 | 3300009098 | Ga0105245_10000681 | Ga0105245_1000068112 | 263 |
| 182 | 3300009098 | Ga0105245_10517979 | Ga0105245_105179792 | 263 |
| 183 | 3300009148 | Ga0105243_10001082 | Ga0105243_1000108223 | 263 |
| 184 | 3300009176 | Ga0105242_10000201 | Ga0105242_1000020118 | 263 |
| 185 | 3300009176 | Ga0105242_10104952 | Ga0105242_101049522 | 263 |
| 186 | 3300009545 | Ga0105237_10160015 | Ga0105237_101600152 | 263 |
| 187 | 3300009553 | Ga0105249_10047962 | Ga0105249_100479623 | 263 |
| 188 | 3300013297 | Ga0157378_10000357 | Ga0157378_1000035729 | 263 |
| 189 | 3300013297 | Ga0157378_10162384 | Ga0157378_101623842 | 263 |
| 190 | 3300013297 | Ga0157378_10250249 | Ga0157378_102502492 | 263 |
| 191 | 3300013297 | Ga0157378_10316370 | Ga0157378_103163701 | 263 |
| 192 | 3300013306 | Ga0163162_10711341 | Ga0163162_107113411 | 263 |
| 193 | 3300013308 | Ga0157375_10213450 | Ga0157375_102134501 | 263 |
| 194 | 3300014326 | Ga0157380_10001221 | Ga0157380_1000122110 | 263 |
| 195 | 3300014968 | Ga0157379_10017094 | Ga0157379_100170943 | 263 |
| 196 | 3300014969 | Ga0157376_10014792 | Ga0157376_100147922 | 263 |
| 197 | 3300014969 | Ga0157376_10118112 | Ga0157376_101181122 | 263 |
| 198 | 3300025294 | Ga0209025_1000064 | Ga0209025_1000064144 | 263 |
| 199 | 3300025899 | Ga0207642_10001948 | Ga0207642_100019486 | 263 |
| 200 | 3300025899 | Ga0207642_10102004 | Ga0207642_101020042 | 263 |
| 201 | 3300025908 | Ga0207643_10006431 | Ga0207643_100064314 | 263 |
| 202 | 3300025927 | Ga0207687_10000430 | Ga0207687_1000043022 | 263 |
| 203 | 3300025932 | Ga0207690_10063692 | Ga0207690_100636922 | 263 |
| 204 | 3300025932 | Ga0207690_10098724 | Ga0207690_100987242 | 263 |
| 205 | 3300025933 | Ga0207706_10621676 | Ga0207706_106216761 | 263 |
| 206 | 3300025934 | Ga0207686_10000084 | Ga0207686_1000008413 | 263 |
| 207 | 3300025934 | Ga0207686_10219323 | Ga0207686_102193231 | 263 |
| 208 | 3300025935 | Ga0207709_10001426 | Ga0207709_100014262 | 263 |
| 209 | 3300025935 | Ga0207709_10140165 | Ga0207709_101401653 | 263 |
| 210 | 3300025936 | Ga0207670_10004098 | Ga0207670_100040985 | 263 |
| 211 | 3300025938 | Ga0207704_10000166 | Ga0207704_1000016618 | 263 |
| 212 | 3300025942 | Ga0207689_10000272 | Ga0207689_1000027218 | 263 |
| 213 | 3300025942 | Ga0207689_10128101 | Ga0207689_101281011 | 263 |
| 214 | 3300025960 | Ga0207651_10234907 | Ga0207651_102349071 | 263 |
| 215 | 3300026023 | Ga0207677_10091686 | Ga0207677_100916862 | 263 |
| 216 | 3300026035 | Ga0207703_10005996 | Ga0207703_100059964 | 263 |
| 217 | 3300026035 | Ga0207703_10155369 | Ga0207703_101553691 | 263 |
| 218 | 3300026041 | Ga0207639_10023286 | Ga0207639_100232864 | 263 |
| 219 | 3300026075 | Ga0207708_10000134 | Ga0207708_1000013418 | 263 |
| 220 | 3300026075 | Ga0207708_10016697 | Ga0207708_100166974 | 263 |
| 221 | 3300026089 | Ga0207648_10000433 | Ga0207648_1000043328 | 263 |
| 222 | 3300026089 | Ga0207648_10025781 | Ga0207648_100257814 | 263 |
| 223 | 3300026118 | Ga0207675_100000490 | Ga0207675_10000049021 | 263 |
| 224 | 3300026121 | Ga0207683_10015368 | Ga0207683_100153685 | 263 |
| 225 | 3300026121 | Ga0207683_10113271 | Ga0207683_101132712 | 263 |
| 226 | 3300028380 | Ga0268265_10005357 | Ga0268265_100053576 | 263 |
| 227 | 3300028381 | Ga0268264_10004638 | Ga0268264_100046383 | 263 |
| 228 | 3300039438 | Ga0436360_0082575 | Ga0436360_0082575_973_1764 | 263 |
| 229 | 3300039453 | Ga0436362_0505191 | Ga0436362_0505191_1673_2476 | 263 |
| 230 | 3300049571 | Ga0501034_0000390 | Ga0501034_0000390_63270_64115 | 263 |
| 231 | 3300049571 | Ga0501034_0044275 | Ga0501034_0044275_3462_4343 | 263 |
| 232 | 3300049575 | Ga0501039_0097985 | Ga0501039_0097985_744_1589 | 263 |
| 233 | 3300049588 | Ga0501072_0008369 | Ga0501072_0008369_5197_6042 | 263 |
| 234 | 3300049588 | Ga0501072_0178441 | Ga0501072_0178441_660_1505 | 263 |
| 235 | 3300049744 | Ga0501083_0010361 | Ga0501083_0010361_86_931 | 263 |
| 236 | 3300049822 | Ga0501035_0352632 | Ga0501035_0352632_97_903 | 263 |
| 237 | 3300053098 | Ga0500650_0127136 | Ga0500650_0127136_161_1006 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ngf-assembly1.cif.gz_A | crystal structure of ap endonuclease, family 2 from brucella melitensis | 0.9379 | 1 | 258 |
| 1k77-assembly1.cif.gz_A | crystal structure of ec1530, a putative oxygenase from escherichia coli | 0.934 | 1 | 257 |
| 3ngf-assembly1.cif.gz_A | crystal structure of ap endonuclease, family 2 from brucella melitensis | 0.9309 | 1 | 258 |
| 1k77-assembly1.cif.gz_A | crystal structure of ec1530, a putative oxygenase from escherichia coli | 0.9202 | 1 | 257 |
| 6wn6-assembly1.cif.gz_A | crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form | 0.811 | 1 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7T3H9_4_269_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9386 | 2 | 257 | 3.20.20.150 |
| af_P30147_1_258_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9365 | 1 | 257 | 3.20.20.150 |
| 1k77A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9322 | 3 | 257 | 3.20.20.150 |
| af_P30147_1_258_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9295 | 1 | 257 | 3.20.20.150 |
| af_Q11185_2_259_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9257 | 1 | 245 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H4I8V2-F1-model_v4 | Hydroxypyruvate isomerase (EC 5.3.1.22) | 0.9744 | 1 | 207 |
GO:0008903
GO:0046487 |
| AF-A0A382WZG8-F1-model_v4 | Xylose isomerase-like TIM barrel domain-containing protein | 0.9708 | 1 | 107 |
GO:0008903
GO:0046487 |
| AF-A0A4V2A6E6-F1-model_v4 | deleted | 0.9679 | 1 | 203 |
|
| AF-A0A3D1S253-F1-model_v4 | Hydroxypyruvate isomerase | 0.9679 | 1 | 206 |
GO:0008903
GO:0046487 |
| AF-X1GH88-F1-model_v4 | Xylose isomerase-like TIM barrel domain-containing protein | 0.967 | 1 | 158 |
GO:0008903
GO:0046487 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar