F350143

General Info

Members Datasets Scaffolds Average Seq Length
237 137 237 154

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10027081|Ga0307410_100270816
Length 170
Sequence VLNDGDGAYPSTSDDLFIPPASPAELDALEAAVDGWLRRALAENPMLVAVDRGEPGERRWYVRLAGEDKDFTTIWFTLRQRALHFESYVMPAPEENEAEFYAHLLRRNLTFHGMAFAVGAEEAIFLVGALPLSAVSEAQLDRVIGSAWAYVERTFRAALRIGFASRFGGG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
4 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
54 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
55 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
57 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
58 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
59 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.66
Nodule 0
Rhizoplane 2.11
Rhizosphere 83.12
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100412588 3300005331 Unclassified 1193
2 Ga0070661_100158154 3300005344 Bacteria 1715
3 Ga0070678_100937858 3300005456 Unclassified 793
4 Ga0070678_101085764 3300005456 Bacteria 738
5 Ga0070706_100706349 3300005467 Bacteria 935
6 Ga0068853_101522681 3300005539 Bacteria 648
7 Ga0068860_100008677 3300005843 Bacteria 10125
8 Ga0081455_10001515 3300005937 Bacteria 28639
9 Ga0081455_10012914 3300005937 Bacteria 8286
10 Ga0081455_10018912 3300005937 Bacteria 6536
11 Ga0081538_10000033 3300005981 Bacteria 121023
12 Ga0081538_10000913 3300005981 Bacteria 31836
13 Ga0081538_10051779 3300005981 Bacteria 2461
14 Ga0075365_10040684 3300006038 Bacteria 3032
15 Ga0075365_10286767 3300006038 Bacteria 1158
16 Ga0075365_10377024 3300006038 Bacteria 1001
17 Ga0075365_10991625 3300006038 Bacteria 592
18 Ga0075365_10995782 3300006038 Bacteria 591
19 Ga0075363_100257924 3300006048 Unclassified 1005
20 Ga0075363_100378496 3300006048 Bacteria 830
21 Ga0075362_10300599 3300006177 Bacteria 796
22 Ga0075367_10173977 3300006178 Bacteria 1341
23 Ga0075367_10520586 3300006178 Bacteria 755
24 Ga0075367_10597917 3300006178 Bacteria 701
25 Ga0075367_10647334 3300006178 Bacteria 672
26 Ga0075367_10790695 3300006178 Bacteria 604
27 Ga0075427_10023590 3300006194 Unclassified 986
28 Ga0075428_100028954 3300006844 Bacteria 6129
29 Ga0075428_100307521 3300006844 Bacteria 1704
30 Ga0075428_100688788 3300006844 Bacteria 1089
31 Ga0075428_100784467 3300006844 Bacteria 1013
32 Ga0075430_100001405 3300006846 Bacteria 19575
33 Ga0075430_100010200 3300006846 Bacteria 7955
34 Ga0075430_100035599 3300006846 Bacteria 4223
35 Ga0075431_100001012 3300006847 Bacteria 25009
36 Ga0075431_100012975 3300006847 Bacteria 8414
37 Ga0075431_100347042 3300006847 Bacteria 1493
38 Ga0075431_100466062 3300006847 Bacteria 1257
39 Ga0075429_100096721 3300006880 Bacteria 2576
40 Ga0075429_100998600 3300006880 Bacteria 732
41 Ga0111539_10000426 3300009094 Bacteria 52948
42 Ga0111539_10406617 3300009094 Bacteria 1585
43 Ga0105245_10022749 3300009098 Bacteria 5502
44 Ga0105245_10883924 3300009098 Bacteria 935
45 Ga0114129_10225515 3300009147 Bacteria 2526
46 Ga0114129_10596305 3300009147 Bacteria 1432
47 Ga0114129_11375938 3300009147 Bacteria 872
48 Ga0114129_12633346 3300009147 Unclassified 600
49 Ga0105242_10117937 3300009176 Bacteria 2273
50 Ga0105242_10370232 3300009176 Bacteria 1328
51 Ga0105249_10933257 3300009553 Bacteria 935
52 Ga0105239_10562259 3300010375 Bacteria 1299
53 Ga0157378_10328447 3300013297 Bacteria 1488
54 Ga0157378_10675924 3300013297 Bacteria 1050
55 Ga0157375_10395491 3300013308 Unclassified 1549
56 Ga0213876_10039959 3300021384 Bacteria 2478
57 Ga0207707_10877145 3300025912 Unclassified 743
58 Ga0207687_10218319 3300025927 Bacteria 1500
59 Ga0207686_10108398 3300025934 Bacteria 1868
60 Ga0207670_11021931 3300025936 Unclassified 696
61 Ga0207689_11003978 3300025942 Bacteria 704
62 Ga0207651_11071881 3300025960 Bacteria 722
63 Ga0207683_10183208 3300026121 Bacteria 1899
64 Ga0209813_10101300 3300027866 Bacteria 980
65 Ga0209813_10173338 3300027866 Unclassified 785
66 Ga0207428_10028281 3300027907 Bacteria 4659
67 Ga0268266_10377221 3300028379 Bacteria 1337
68 Ga0268265_11418219 3300028380 Bacteria 697
69 Ga0307408_100507563 3300031548 Bacteria 1057
70 Ga0316579_10171587 3300031691 Bacteria 1048
71 Ga0316576_10003509 3300031727 Bacteria 9210
72 Ga0316576_10100774 3300031727 Bacteria 2159
73 Ga0316578_10003491 3300031728 Bacteria 7208
74 Ga0316578_10021537 3300031728 Bacteria 3578
75 Ga0307405_10171081 3300031731 Bacteria 1550
76 Ga0316577_10036956 3300031733 Unclassified 2732
77 Ga0316577_10170295 3300031733 Bacteria 1229
78 Ga0316577_10237620 3300031733 Unclassified 1030
79 Ga0307413_10278523 3300031824 Bacteria 1257
80 Ga0307413_10427663 3300031824 Bacteria 1045
81 Ga0307413_10455940 3300031824 Bacteria 1016
82 Ga0307413_10926106 3300031824 Bacteria 742
83 Ga0307410_10027081 3300031852 Bacteria 3619
84 Ga0307410_10511617 3300031852 Bacteria 989
85 Ga0307406_10312788 3300031901 Bacteria 1212
86 Ga0307407_10102202 3300031903 Bacteria 1782
87 Ga0307407_10263014 3300031903 Bacteria 1187
88 Ga0307412_10723329 3300031911 Bacteria 857
89 Ga0307409_100009715 3300031995 Bacteria 5932
90 Ga0307416_100022910 3300032002 Bacteria 4520
91 Ga0307416_100274439 3300032002 Bacteria 1658
92 Ga0307414_10201584 3300032004 Bacteria 1619
93 Ga0307411_11240478 3300032005 Bacteria 677
94 Ga0316585_10237157 3300032137 Bacteria 604
95 Ga0316580_10011200 3300032139 Bacteria 2719
96 Ga0316596_1032155 3300033541 Bacteria 1365
97 Ga0373948_0019462 3300034817 Bacteria 1284
98 Ga0373950_0022411 3300034818 Bacteria 1123
99 Ga0373951_0074040 3300035091 Bacteria 872
100 Ga0373932_0018915 3300035112 Bacteria 1788
101 Ga0373954_0109637 3300035118 Bacteria 1335
102 Ga0316574_0002448 3300035398 Bacteria 9328
103 Ga0316574_0031209 3300035398 Bacteria 3231
104 Ga0316574_0136037 3300035398 Bacteria 1582
105 Ga0316574_0444038 3300035398 Bacteria 813
106 Ga0373931_0000056 3300035691 Bacteria 56750
107 Ga0373937_0536985 3300036401 Bacteria 1111
108 Ga0316582_0020941 3300036647 Bacteria 3854
109 Ga0316584_0010187 3300036712 Bacteria 6562
110 Ga0316584_0016801 3300036712 Bacteria 5250
111 Ga0316584_0290321 3300036712 Bacteria 1186
112 Ga0436365_0647933 3300039437 Bacteria 12215
113 Ga0451793_0901215 3300041452 Unclassified 630
114 Ga0451837_1533304 3300041494 Bacteria 618
115 Ga0451853_3575927 3300041512 Unclassified 687
116 Ga0451853_3975572 3300041512 Bacteria 727
117 Ga0466965_0429857 3300044683 Unclassified 733
118 Ga0466967_0239577 3300045976 Bacteria 1730
119 Ga0495592_0273912 3300046454 Bacteria 1106
120 Ga0495603_0744613 3300046455 Bacteria 560
121 Ga0495629_0420357 3300046459 Bacteria 907
122 Ga0495653_0107340 3300046463 Bacteria 2012
123 Ga0495608_0017834 3300046511 Bacteria 4906
124 Ga0495628_0132349 3300046516 Bacteria 1907
125 Ga0495621_0030552 3300046539 Bacteria 1843
126 Ga0495667_0179070 3300046559 Bacteria 1361
127 Ga0495634_0358596 3300046642 Bacteria 872
128 Ga0495635_0893767 3300046663 Unclassified 569
129 Ga0495588_0445269 3300046674 Bacteria 680
130 Ga0495657_0263039 3300046675 Bacteria 1036
131 Ga0495657_0310469 3300046675 Bacteria 939
132 Ga0495613_0001988 3300046689 Bacteria 15516
133 Ga0495613_0120317 3300046689 Bacteria 1886
134 Ga0495672_0000470 3300047320 Bacteria 47741
135 Ga0495672_0148543 3300047320 Bacteria 1218
136 Ga0495676_0197663 3300047321 Bacteria 1399
137 Ga0495684_0411090 3300047471 Unclassified 948
138 Ga0495684_0553300 3300047471 Bacteria 783
139 Ga0495593_0434265 3300047673 Bacteria 657
140 Ga0495614_0354303 3300048089 Unclassified 684
141 Ga0496101_1011507 3300048904 Bacteria 654
142 Ga0496102_1475755 3300048905 Unclassified 599
143 Ga0496109_1260222 3300048912 Bacteria 676
144 Ga0496114_0884284 3300048917 Bacteria 774
145 Ga0501031_0012993 3300049568 Bacteria 5434
146 Ga0501031_0104645 3300049568 Unclassified 1847
147 Ga0501031_0458021 3300049568 Bacteria 824
148 Ga0501031_0671491 3300049568 Bacteria 666
149 Ga0501032_0240340 3300049569 Bacteria 1177
150 Ga0501033_0031907 3300049570 Bacteria 3954
151 Ga0501034_0000282 3300049571 Bacteria 91445
152 Ga0501034_0010130 3300049571 Bacteria 9834
153 Ga0501034_0027564 3300049571 Bacteria 5777
154 Ga0501034_0472748 3300049571 Bacteria 1169
155 Ga0501036_0182383 3300049572 Bacteria 1767
156 Ga0501036_0455368 3300049572 Bacteria 1066
157 Ga0501036_0556251 3300049572 Bacteria 953
158 Ga0501039_0218255 3300049575 Bacteria 1499
159 Ga0501039_0246071 3300049575 Bacteria 1406
160 Ga0501040_0231288 3300049576 Bacteria 1316
161 Ga0501040_0365268 3300049576 Bacteria 1035
162 Ga0501041_0230326 3300049577 Bacteria 1163
163 Ga0501042_0047187 3300049578 Bacteria 3071
164 Ga0501042_0403148 3300049578 Bacteria 991
165 Ga0501042_0604171 3300049578 Bacteria 798
166 Ga0501042_0908908 3300049578 Bacteria 641
167 Ga0501043_0585464 3300049579 Bacteria 826
168 Ga0501047_0051227 3300049581 Bacteria 3988
169 Ga0501048_0190452 3300049582 Bacteria 1453
170 Ga0501048_0526684 3300049582 Bacteria 848
171 Ga0501068_0230349 3300049584 Bacteria 1178
172 Ga0501068_0490193 3300049584 Bacteria 797
173 Ga0501068_0908422 3300049584 Bacteria 579
174 Ga0501069_0000754 3300049585 Bacteria 15112
175 Ga0501069_0572033 3300049585 Bacteria 677
176 Ga0501070_0006203 3300049586 Bacteria 10186
177 Ga0501070_1297659 3300049586 Bacteria 556
178 Ga0501071_0009541 3300049587 Bacteria 6470
179 Ga0501071_0114934 3300049587 Bacteria 1991
180 Ga0501072_0073319 3300049588 Bacteria 2707
181 Ga0501072_0266024 3300049588 Bacteria 1364
182 Ga0501072_0381451 3300049588 Unclassified 1118
183 Ga0501073_0000404 3300049589 Bacteria 29460
184 Ga0501073_0127806 3300049589 Bacteria 1762
185 Ga0501074_0114891 3300049590 Bacteria 1926
186 Ga0501074_0144668 3300049590 Bacteria 1700
187 Ga0501075_0204244 3300049591 Bacteria 1507
188 Ga0501075_0269555 3300049591 Bacteria 1297
189 Ga0501076_0056278 3300049592 Bacteria 3121
190 Ga0501076_0295425 3300049592 Bacteria 1328
191 Ga0501076_1790956 3300049592 Bacteria 503
192 Ga0501079_0149305 3300049741 Bacteria 1822
193 Ga0501079_0236208 3300049741 Bacteria 1428
194 Ga0501080_0176521 3300049742 Bacteria 1967
195 Ga0501080_0346970 3300049742 Bacteria 1341
196 Ga0501080_0393657 3300049742 Bacteria 1247
197 Ga0501081_0262228 3300049743 Bacteria 1263
198 Ga0501083_0001352 3300049744 Bacteria 16651
199 Ga0501044_0001341 3300049823 Bacteria 28925
200 Ga0501045_0039884 3300049824 Bacteria 3417
201 nmdc:mga03683_377524_c1 3300050489 Bacteria 674
202 nmdc:mga03683_92759_c1 3300050489 Unclassified 1318
203 nmdc:mga03n38_236819_c1 3300050490 Archaea 959
204 nmdc:mga00v17_353762_c1 3300050491 Bacteria 955
205 nmdc:mga00v17_50995_c1 3300050491 Bacteria 2516
206 nmdc:mga0yw44_1006203_c1 3300050492 Bacteria 564
207 nmdc:mga0yw44_1035107_c1 3300050492 Unclassified 555
208 nmdc:mga0yw44_11249_c1 3300050492 Bacteria 4609
209 nmdc:mga0yw44_5592_c1 3300050492 Bacteria 5969
210 nmdc:mga0yw44_790228_c1 3300050492 Bacteria 644
211 nmdc:mga06z11_237122_c1 3300050494 Bacteria 1070
212 nmdc:mga06z11_569618_c1 3300050494 Bacteria 688
213 nmdc:mga04h51_199686_c1 3300050495 Unclassified 785
214 nmdc:mga05p37_1578975_c1 3300050507 Unclassified 648
215 nmdc:mga05p37_761156_c1 3300050507 Bacteria 1066
216 nmdc:mga05p37_965610_c1 3300050507 Bacteria 910
217 nmdc:mga09592_186843_c1 3300050508 Bacteria 1793
218 nmdc:mga09592_97447_c1 3300050508 Bacteria 2517
219 nmdc:mga0qj67_339155_c1 3300050509 Bacteria 1216
220 nmdc:mga0qj67_4363_c1 3300050509 Bacteria 10245
221 nmdc:mga06r32_1134035_c1 3300050510 Bacteria 730
222 nmdc:mga06r32_127411_c1 3300050510 Bacteria 2515
223 nmdc:mga06r32_2263_c1 3300050510 Bacteria 17213
224 nmdc:mga08y16_110732_c1 3300050511 Bacteria 2859
225 nmdc:mga08y16_9765_c1 3300050511 Bacteria 10079
226 Ga0500635_0209124 3300053080 Bacteria 759
227 Ga0495619_0978932 3300053085 Bacteria 566
228 Ga0500566_0007438 3300053094 Bacteria 6490
229 Ga0501084_0216430 3300054114 Bacteria 1616
230 Ga0501084_0434671 3300054114 Bacteria 1109
231 Ga0501084_0791056 3300054114 Bacteria 799
232 Ga0501082_0140366 3300060353 Bacteria 2097
233 Ga0501082_0148917 3300060353 Bacteria 2033
234 Ga0501082_0187298 3300060353 Bacteria 1801
235 Ga0530510_0015815 3300061734 Bacteria 5334
236 Ga0530510_0420425 3300061734 Bacteria 1009
237 Ga0530510_0624315 3300061734 Bacteria 820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0127806 Ga0501073_0127806_759_1145 123
2 3300060353 Ga0501082_0148917 Ga0501082_0148917_758_1144 123
3 3300060353 Ga0501082_0187298 Ga0501082_0187298_376_762 123
4 3300049742 Ga0501080_0346970 Ga0501080_0346970_873_1262 124
5 3300006178 Ga0075367_10173977 Ga0075367_101739772 151
6 3300009098 Ga0105245_10883924 Ga0105245_108839241 151
7 3300027866 Ga0209813_10101300 Ga0209813_101013001 151
8 3300027866 Ga0209813_10173338 Ga0209813_101733381 151
9 3300031691 Ga0316579_10171587 Ga0316579_101715872 151
10 3300031727 Ga0316576_10003509 Ga0316576_100035095 151
11 3300031727 Ga0316576_10100774 Ga0316576_101007743 151
12 3300031728 Ga0316578_10003491 Ga0316578_100034918 151
13 3300031728 Ga0316578_10021537 Ga0316578_100215371 151
14 3300031733 Ga0316577_10170295 Ga0316577_101702951 151
15 3300031733 Ga0316577_10237620 Ga0316577_102376201 151
16 3300032137 Ga0316585_10237157 Ga0316585_102371571 151
17 3300033541 Ga0316596_1032155 Ga0316596_10321552 151
18 3300035398 Ga0316574_0031209 Ga0316574_0031209_541_999 151
19 3300035398 Ga0316574_0136037 Ga0316574_0136037_564_1028 151
20 3300036712 Ga0316584_0010187 Ga0316584_0010187_3867_4331 151
21 3300036712 Ga0316584_0016801 Ga0316584_0016801_4626_5084 151
22 3300050492 nmdc:mga0yw44_1035107_c1 nmdc:mga0yw44_1035107_c1_18_479 151
23 3300050492 nmdc:mga0yw44_790228_c1 nmdc:mga0yw44_790228_c1_94_549 151
24 3300050495 nmdc:mga04h51_199686_c1 nmdc:mga04h51_199686_c1_239_700 151
25 3300061734 Ga0530510_0420425 Ga0530510_0420425_220_681 151
26 3300005456 Ga0070678_100937858 Ga0070678_1009378581 152
27 3300005456 Ga0070678_101085764 Ga0070678_1010857641 152
28 3300005467 Ga0070706_100706349 Ga0070706_1007063492 152
29 3300006178 Ga0075367_10597917 Ga0075367_105979172 152
30 3300009094 Ga0111539_10406617 Ga0111539_104066172 152
31 3300009176 Ga0105242_10117937 Ga0105242_101179372 152
32 3300009553 Ga0105249_10933257 Ga0105249_109332572 152
33 3300013297 Ga0157378_10675924 Ga0157378_106759242 152
34 3300013308 Ga0157375_10395491 Ga0157375_103954912 152
35 3300025912 Ga0207707_10877145 Ga0207707_108771451 152
36 3300025936 Ga0207670_11021931 Ga0207670_110219312 152
37 3300025960 Ga0207651_11071881 Ga0207651_110718811 152
38 3300026121 Ga0207683_10183208 Ga0207683_101832082 152
39 3300028379 Ga0268266_10377221 Ga0268266_103772212 152
40 3300028380 Ga0268265_11418219 Ga0268265_114182192 152
41 3300035118 Ga0373954_0109637 Ga0373954_0109637_46_507 152
42 3300036401 Ga0373937_0536985 Ga0373937_0536985_301_762 152
43 3300041494 Ga0451837_1533304 Ga0451837_1533304_128_586 152
44 3300041512 Ga0451853_3975572 Ga0451853_3975572_153_614 152
45 3300046454 Ga0495592_0273912 Ga0495592_0273912_632_1093 152
46 3300046455 Ga0495603_0744613 Ga0495603_0744613_46_507 152
47 3300046459 Ga0495629_0420357 Ga0495629_0420357_184_645 152
48 3300046463 Ga0495653_0107340 Ga0495653_0107340_1440_1901 152
49 3300046511 Ga0495608_0017834 Ga0495608_0017834_464_925 152
50 3300046516 Ga0495628_0132349 Ga0495628_0132349_47_508 152
51 3300046539 Ga0495621_0030552 Ga0495621_0030552_1113_1571 152
52 3300046559 Ga0495667_0179070 Ga0495667_0179070_452_913 152
53 3300046642 Ga0495634_0358596 Ga0495634_0358596_63_524 152
54 3300046674 Ga0495588_0445269 Ga0495588_0445269_31_489 152
55 3300046689 Ga0495613_0120317 Ga0495613_0120317_294_755 152
56 3300047471 Ga0495684_0553300 Ga0495684_0553300_292_753 152
57 3300047673 Ga0495593_0434265 Ga0495593_0434265_59_523 152
58 3300048905 Ga0496102_1475755 Ga0496102_1475755_120_578 152
59 3300048917 Ga0496114_0884284 Ga0496114_0884284_108_566 152
60 3300049568 Ga0501031_0012993 Ga0501031_0012993_2132_2590 152
61 3300049568 Ga0501031_0458021 Ga0501031_0458021_33_491 152
62 3300049569 Ga0501032_0240340 Ga0501032_0240340_528_986 152
63 3300049572 Ga0501036_0182383 Ga0501036_0182383_138_596 152
64 3300049575 Ga0501039_0218255 Ga0501039_0218255_1010_1468 152
65 3300049575 Ga0501039_0246071 Ga0501039_0246071_453_911 152
66 3300049576 Ga0501040_0231288 Ga0501040_0231288_815_1273 152
67 3300049576 Ga0501040_0365268 Ga0501040_0365268_284_742 152
68 3300049577 Ga0501041_0230326 Ga0501041_0230326_24_482 152
69 3300049578 Ga0501042_0047187 Ga0501042_0047187_2039_2497 152
70 3300049578 Ga0501042_0403148 Ga0501042_0403148_161_628 152
71 3300049578 Ga0501042_0908908 Ga0501042_0908908_12_470 152
72 3300049582 Ga0501048_0190452 Ga0501048_0190452_820_1278 152
73 3300049584 Ga0501068_0230349 Ga0501068_0230349_553_1011 152
74 3300049584 Ga0501068_0490193 Ga0501068_0490193_314_787 152
75 3300049585 Ga0501069_0572033 Ga0501069_0572033_154_612 152
76 3300049586 Ga0501070_1297659 Ga0501070_1297659_30_488 152
77 3300049587 Ga0501071_0114934 Ga0501071_0114934_1003_1461 152
78 3300049588 Ga0501072_0073319 Ga0501072_0073319_662_1120 152
79 3300049588 Ga0501072_0266024 Ga0501072_0266024_836_1294 152
80 3300049591 Ga0501075_0204244 Ga0501075_0204244_704_1162 152
81 3300049591 Ga0501075_0269555 Ga0501075_0269555_183_641 152
82 3300049592 Ga0501076_0056278 Ga0501076_0056278_2487_2945 152
83 3300049592 Ga0501076_0295425 Ga0501076_0295425_766_1224 152
84 3300049741 Ga0501079_0149305 Ga0501079_0149305_1017_1475 152
85 3300049743 Ga0501081_0262228 Ga0501081_0262228_760_1218 152
86 3300049824 Ga0501045_0039884 Ga0501045_0039884_1788_2246 152
87 3300050511 nmdc:mga08y16_110732_c1 nmdc:mga08y16_110732_c1_1664_2122 152
88 3300053085 Ga0495619_0978932 Ga0495619_0978932_90_551 152
89 3300054114 Ga0501084_0216430 Ga0501084_0216430_793_1251 152
90 3300061734 Ga0530510_0015815 Ga0530510_0015815_888_1346 152
91 3300061734 Ga0530510_0624315 Ga0530510_0624315_318_776 152
92 3300005344 Ga0070661_100158154 Ga0070661_1001581541 153
93 3300005539 Ga0068853_101522681 Ga0068853_1015226811 153
94 3300005843 Ga0068860_100008677 Ga0068860_10000867710 153
95 3300005937 Ga0081455_10001515 Ga0081455_1000151514 153
96 3300005937 Ga0081455_10012914 Ga0081455_1001291410 153
97 3300005937 Ga0081455_10018912 Ga0081455_100189124 153
98 3300005981 Ga0081538_10000033 Ga0081538_1000003357 153
99 3300005981 Ga0081538_10000913 Ga0081538_1000091319 153
100 3300005981 Ga0081538_10051779 Ga0081538_100517793 153
101 3300006038 Ga0075365_10991625 Ga0075365_109916251 153
102 3300006048 Ga0075363_100257924 Ga0075363_1002579242 153
103 3300006048 Ga0075363_100378496 Ga0075363_1003784962 153
104 3300006178 Ga0075367_10520586 Ga0075367_105205861 153
105 3300006178 Ga0075367_10647334 Ga0075367_106473342 153
106 3300006178 Ga0075367_10790695 Ga0075367_107906951 153
107 3300006194 Ga0075427_10023590 Ga0075427_100235902 153
108 3300006844 Ga0075428_100028954 Ga0075428_1000289548 153
109 3300006844 Ga0075428_100307521 Ga0075428_1003075212 153
110 3300006844 Ga0075428_100688788 Ga0075428_1006887882 153
111 3300006844 Ga0075428_100784467 Ga0075428_1007844672 153
112 3300006846 Ga0075430_100001405 Ga0075430_10000140525 153
113 3300006846 Ga0075430_100010200 Ga0075430_1000102003 153
114 3300006846 Ga0075430_100035599 Ga0075430_1000355992 153
115 3300006847 Ga0075431_100001012 Ga0075431_10000101230 153
116 3300006847 Ga0075431_100012975 Ga0075431_1000129757 153
117 3300006847 Ga0075431_100347042 Ga0075431_1003470422 153
118 3300006847 Ga0075431_100466062 Ga0075431_1004660621 153
119 3300006880 Ga0075429_100096721 Ga0075429_1000967212 153
120 3300006880 Ga0075429_100998600 Ga0075429_1009986001 153
121 3300009094 Ga0111539_10000426 Ga0111539_1000042638 153
122 3300009098 Ga0105245_10022749 Ga0105245_100227494 153
123 3300009147 Ga0114129_10225515 Ga0114129_102255153 153
124 3300009147 Ga0114129_10596305 Ga0114129_105963051 153
125 3300009147 Ga0114129_11375938 Ga0114129_113759381 153
126 3300009147 Ga0114129_12633346 Ga0114129_126333461 153
127 3300009176 Ga0105242_10370232 Ga0105242_103702322 153
128 3300010375 Ga0105239_10562259 Ga0105239_105622592 153
129 3300013297 Ga0157378_10328447 Ga0157378_103284472 153
130 3300021384 Ga0213876_10039959 Ga0213876_100399592 153
131 3300025927 Ga0207687_10218319 Ga0207687_102183191 153
132 3300025934 Ga0207686_10108398 Ga0207686_101083982 153
133 3300025942 Ga0207689_11003978 Ga0207689_110039781 153
134 3300027907 Ga0207428_10028281 Ga0207428_100282816 153
135 3300031733 Ga0316577_10036956 Ga0316577_100369563 153
136 3300031824 Ga0307413_10427663 Ga0307413_104276631 153
137 3300031824 Ga0307413_10926106 Ga0307413_109261061 153
138 3300031901 Ga0307406_10312788 Ga0307406_103127882 153
139 3300032139 Ga0316580_10011200 Ga0316580_100112003 153
140 3300034818 Ga0373950_0022411 Ga0373950_0022411_484_948 153
141 3300035398 Ga0316574_0002448 Ga0316574_0002448_8044_8511 153
142 3300035398 Ga0316574_0444038 Ga0316574_0444038_203_670 153
143 3300036647 Ga0316582_0020941 Ga0316582_0020941_30_497 153
144 3300036712 Ga0316584_0290321 Ga0316584_0290321_534_1001 153
145 3300039437 Ga0436365_0647933 Ga0436365_0647933_1198_1659 153
146 3300041452 Ga0451793_0901215 Ga0451793_0901215_54_515 153
147 3300041512 Ga0451853_3575927 Ga0451853_3575927_128_616 153
148 3300044683 Ga0466965_0429857 Ga0466965_0429857_139_603 153
149 3300045976 Ga0466967_0239577 Ga0466967_0239577_1203_1670 153
150 3300046663 Ga0495635_0893767 Ga0495635_0893767_29_505 153
151 3300046675 Ga0495657_0263039 Ga0495657_0263039_203_667 153
152 3300046675 Ga0495657_0310469 Ga0495657_0310469_151_612 153
153 3300046689 Ga0495613_0001988 Ga0495613_0001988_14424_14900 153
154 3300047320 Ga0495672_0000470 Ga0495672_0000470_6089_6565 153
155 3300047320 Ga0495672_0148543 Ga0495672_0148543_209_676 153
156 3300047321 Ga0495676_0197663 Ga0495676_0197663_265_726 153
157 3300047471 Ga0495684_0411090 Ga0495684_0411090_100_567 153
158 3300048089 Ga0495614_0354303 Ga0495614_0354303_101_577 153
159 3300048904 Ga0496101_1011507 Ga0496101_1011507_106_573 153
160 3300048912 Ga0496109_1260222 Ga0496109_1260222_170_637 153
161 3300049568 Ga0501031_0104645 Ga0501031_0104645_1144_1629 153
162 3300049568 Ga0501031_0671491 Ga0501031_0671491_113_595 153
163 3300049571 Ga0501034_0000282 Ga0501034_0000282_66624_67088 153
164 3300049571 Ga0501034_0010130 Ga0501034_0010130_6064_6531 153
165 3300049571 Ga0501034_0027564 Ga0501034_0027564_4148_4612 153
166 3300049571 Ga0501034_0472748 Ga0501034_0472748_121_585 153
167 3300049572 Ga0501036_0556251 Ga0501036_0556251_82_561 153
168 3300049578 Ga0501042_0604171 Ga0501042_0604171_183_662 153
169 3300049579 Ga0501043_0585464 Ga0501043_0585464_309_773 153
170 3300049582 Ga0501048_0526684 Ga0501048_0526684_10_489 153
171 3300049584 Ga0501068_0908422 Ga0501068_0908422_74_538 153
172 3300049585 Ga0501069_0000754 Ga0501069_0000754_8882_9346 153
173 3300049586 Ga0501070_0006203 Ga0501070_0006203_9124_9588 153
174 3300049587 Ga0501071_0009541 Ga0501071_0009541_5964_6428 153
175 3300049588 Ga0501072_0381451 Ga0501072_0381451_85_552 153
176 3300049589 Ga0501073_0000404 Ga0501073_0000404_11289_11753 153
177 3300049590 Ga0501074_0114891 Ga0501074_0114891_712_1176 153
178 3300049590 Ga0501074_0144668 Ga0501074_0144668_622_1083 153
179 3300049592 Ga0501076_1790956 Ga0501076_1790956_19_483 153
180 3300049741 Ga0501079_0236208 Ga0501079_0236208_70_534 153
181 3300049742 Ga0501080_0176521 Ga0501080_0176521_1047_1511 153
182 3300049742 Ga0501080_0393657 Ga0501080_0393657_199_660 153
183 3300049744 Ga0501083_0001352 Ga0501083_0001352_6047_6511 153
184 3300050492 nmdc:mga0yw44_1006203_c1 nmdc:mga0yw44_1006203_c1_67_534 153
185 3300050494 nmdc:mga06z11_237122_c1 nmdc:mga06z11_237122_c1_463_948 153
186 3300050494 nmdc:mga06z11_569618_c1 nmdc:mga06z11_569618_c1_130_603 153
187 3300050507 nmdc:mga05p37_1578975_c1 nmdc:mga05p37_1578975_c1_60_527 153
188 3300050507 nmdc:mga05p37_761156_c1 nmdc:mga05p37_761156_c1_491_958 153
189 3300050507 nmdc:mga05p37_965610_c1 nmdc:mga05p37_965610_c1_16_480 153
190 3300050508 nmdc:mga09592_186843_c1 nmdc:mga09592_186843_c1_265_729 153
191 3300050508 nmdc:mga09592_97447_c1 nmdc:mga09592_97447_c1_976_1443 153
192 3300050509 nmdc:mga0qj67_339155_c1 nmdc:mga0qj67_339155_c1_653_1120 153
193 3300050509 nmdc:mga0qj67_4363_c1 nmdc:mga0qj67_4363_c1_2195_2662 153
194 3300050510 nmdc:mga06r32_1134035_c1 nmdc:mga06r32_1134035_c1_158_625 153
195 3300050510 nmdc:mga06r32_127411_c1 nmdc:mga06r32_127411_c1_387_854 153
196 3300050510 nmdc:mga06r32_2263_c1 nmdc:mga06r32_2263_c1_1079_1546 153
197 3300050511 nmdc:mga08y16_9765_c1 nmdc:mga08y16_9765_c1_9433_9900 153
198 3300053080 Ga0500635_0209124 Ga0500635_0209124_167_634 153
199 3300054114 Ga0501084_0434671 Ga0501084_0434671_47_511 153
200 3300054114 Ga0501084_0791056 Ga0501084_0791056_88_552 153
201 3300060353 Ga0501082_0140366 Ga0501082_0140366_85_549 153
202 3300031548 Ga0307408_100507563 Ga0307408_1005075632 154
203 3300031824 Ga0307413_10278523 Ga0307413_102785232 154
204 3300031852 Ga0307410_10511617 Ga0307410_105116171 154
205 3300031903 Ga0307407_10102202 Ga0307407_101022022 154
206 3300031911 Ga0307412_10723329 Ga0307412_107233292 154
207 3300032002 Ga0307416_100274439 Ga0307416_1002744391 154
208 3300006038 Ga0075365_10286767 Ga0075365_102867672 155
209 3300006038 Ga0075365_10377024 Ga0075365_103770241 155
210 3300006038 Ga0075365_10995782 Ga0075365_109957821 155
211 3300049570 Ga0501033_0031907 Ga0501033_0031907_3304_3783 155
212 3300049572 Ga0501036_0455368 Ga0501036_0455368_571_1050 155
213 3300049581 Ga0501047_0051227 Ga0501047_0051227_3224_3703 155
214 3300049823 Ga0501044_0001341 Ga0501044_0001341_3489_3968 155
215 3300050489 nmdc:mga03683_92759_c1 nmdc:mga03683_92759_c1_337_804 155
216 3300053094 Ga0500566_0007438 Ga0500566_0007438_4090_4557 155
217 3300005331 Ga0070670_100412588 Ga0070670_1004125883 156
218 3300006038 Ga0075365_10040684 Ga0075365_100406842 156
219 3300006177 Ga0075362_10300599 Ga0075362_103005991 156
220 3300031731 Ga0307405_10171081 Ga0307405_101710811 156
221 3300031824 Ga0307413_10455940 Ga0307413_104559402 156
222 3300031852 Ga0307410_10027081 Ga0307410_100270816 156
223 3300031903 Ga0307407_10263014 Ga0307407_102630142 156
224 3300031995 Ga0307409_100009715 Ga0307409_1000097157 156
225 3300032002 Ga0307416_100022910 Ga0307416_1000229102 156
226 3300032004 Ga0307414_10201584 Ga0307414_102015842 156
227 3300032005 Ga0307411_11240478 Ga0307411_112404781 156
228 3300034817 Ga0373948_0019462 Ga0373948_0019462_403_873 156
229 3300035091 Ga0373951_0074040 Ga0373951_0074040_111_581 156
230 3300035112 Ga0373932_0018915 Ga0373932_0018915_800_1270 156
231 3300035691 Ga0373931_0000056 Ga0373931_0000056_46949_47419 156
232 3300050489 nmdc:mga03683_377524_c1 nmdc:mga03683_377524_c1_83_553 156
233 3300050490 nmdc:mga03n38_236819_c1 nmdc:mga03n38_236819_c1_39_509 156
234 3300050491 nmdc:mga00v17_353762_c1 nmdc:mga00v17_353762_c1_17_487 156
235 3300050491 nmdc:mga00v17_50995_c1 nmdc:mga00v17_50995_c1_577_1047 156
236 3300050492 nmdc:mga0yw44_11249_c1 nmdc:mga0yw44_11249_c1_1678_2148 156
237 3300050492 nmdc:mga0yw44_5592_c1 nmdc:mga0yw44_5592_c1_3511_3981 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10722

YbjN

Putative bacterial sensory transduction regulator

33

160

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k3s-assembly1.cif.gz_B type iii secretion chaperone sige 0.8063 59 141
2bsh-assembly1.cif.gz_A crystal structure of the type iii secretion chaperone syct from yersinia enterocolitica (crystal form 2) 0.7424 16 146
2plg-assembly1.cif.gz_A crystal structure of t110839 protein from synechococcus elongatus 0.7414 5 147
4akx-assembly1.cif.gz_A structure of the heterodimeric complex exou-spcu from the type iii secretion system (t3ss) of pseudomonas aeruginosa 0.7346 20 145
1xkp-assembly1.cif.gz_C crystal structure of the virulence factor yopn in complex with its heterodimeric chaperone sycn-yscb 0.7306 48 145
ID Description Score Start End Superfamily
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9767 59 154 3.30.1460.10
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9114 59 154 3.30.1460.10
1k3sB00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7876 59 141 3.30.1460.10
af_Q4DSF1_306_445_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7514 48 147 3.30.1460.10
af_Q9W466_37_196_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7498 46 75 3.40.1000.30
ID Description Score Start End GO Terms
AF-A0A7W0LT99-F1-model_v4 YbjN domain-containing protein 0.9877 5 155
AF-A0A6B1E9Y6-F1-model_v4 YbjN domain-containing protein 0.9844 7 156
AF-A0A7K0JZD5-F1-model_v4 deleted 0.9832 42 155
AF-A0A388NVT6-F1-model_v4 YbjN domain-containing protein 0.983 9 152
AF-A0A3D0HHI4-F1-model_v4 YbjN domain-containing protein 0.9817 9 152

Feature Viewer

pLDDT pTM Quality
95.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map