F350342
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 237 | 158 | 237 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0415522|Ga0496114_0415522_92_856 |
| Length | 254 |
| Sequence | VGVDGQHRKLVIPGDPERRAAFRAGQRAILQSLPGAAAWGLVSGVAMVKGGLSPPWAATMSLLVYAGSAQLAALPLIATGMPLWVIVATGLITNLRFVIYSAALRPYFADQSLRKRAAIGFFMTDFTFTLFMRSAQEGRLPGQHRDAWFAGVCSSNWTTWQVCAMTGIVAASYVPTQWGLEFTGTLALLALVGPALITRPAIVGAVTASLVALLTHGISYRLGLFCAAIAGIAAATLADGWRSSGGSQDAAETS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 77 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 78 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 79 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 80 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 81 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 82 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 83 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 84 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 89 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 90 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 95 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 96 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 97 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 98 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 99 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 139 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 140 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 91.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10002920 | 3300003322 | Bacteria | 5279 |
| 2 | rootL2_10131626 | 3300003322 | Bacteria | 2010 |
| 3 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 4 | Ga0070677_10101126 | 3300005333 | Bacteria | 1271 |
| 5 | Ga0068869_100038243 | 3300005334 | Bacteria | 3418 |
| 6 | Ga0068869_100168849 | 3300005334 | Bacteria | 1708 |
| 7 | Ga0070689_100006209 | 3300005340 | Bacteria | 8246 |
| 8 | Ga0070689_100055090 | 3300005340 | Bacteria | 3080 |
| 9 | Ga0070689_100276912 | 3300005340 | Bacteria | 1391 |
| 10 | Ga0070669_100003202 | 3300005353 | Bacteria | 11764 |
| 11 | Ga0070669_100187890 | 3300005353 | Bacteria | 1619 |
| 12 | Ga0070675_100018477 | 3300005354 | Bacteria | 5550 |
| 13 | Ga0070675_100042395 | 3300005354 | Bacteria | 3719 |
| 14 | Ga0070675_100066807 | 3300005354 | Bacteria | 2975 |
| 15 | Ga0070671_100000033 | 3300005355 | Bacteria | 105788 |
| 16 | Ga0070674_100644771 | 3300005356 | Bacteria | 900 |
| 17 | Ga0070667_100000096 | 3300005367 | Bacteria | 108816 |
| 18 | Ga0070701_10026601 | 3300005438 | Bacteria | 2823 |
| 19 | Ga0070700_100045405 | 3300005441 | Bacteria | 2710 |
| 20 | Ga0070700_100048485 | 3300005441 | Bacteria | 2632 |
| 21 | Ga0070700_100080437 | 3300005441 | Bacteria | 2102 |
| 22 | Ga0070700_100091150 | 3300005441 | Bacteria | 1989 |
| 23 | Ga0070700_100194463 | 3300005441 | Bacteria | 1421 |
| 24 | Ga0070694_100043677 | 3300005444 | Bacteria | 2997 |
| 25 | Ga0070663_100083218 | 3300005455 | Bacteria | 2356 |
| 26 | Ga0070678_100317869 | 3300005456 | Bacteria | 1329 |
| 27 | Ga0070685_10000002 | 3300005466 | Bacteria | 295205 |
| 28 | Ga0070672_100018533 | 3300005543 | Bacteria | 5035 |
| 29 | Ga0070672_100095053 | 3300005543 | Bacteria | 2410 |
| 30 | Ga0070672_100522860 | 3300005543 | Bacteria | 1028 |
| 31 | Ga0070686_100023033 | 3300005544 | Bacteria | 3718 |
| 32 | Ga0070696_100016862 | 3300005546 | Bacteria | 4927 |
| 33 | Ga0070693_100366603 | 3300005547 | Bacteria | 990 |
| 34 | Ga0070665_100002609 | 3300005548 | Bacteria | 19675 |
| 35 | Ga0070665_100913429 | 3300005548 | Bacteria | 890 |
| 36 | Ga0068857_100056415 | 3300005577 | Bacteria | 3486 |
| 37 | Ga0070702_100264883 | 3300005615 | Bacteria | 1172 |
| 38 | Ga0068859_100068976 | 3300005617 | Bacteria | 3570 |
| 39 | Ga0068859_100089833 | 3300005617 | Bacteria | 3122 |
| 40 | Ga0068859_100124620 | 3300005617 | Bacteria | 2645 |
| 41 | Ga0068864_100000006 | 3300005618 | Bacteria | 393838 |
| 42 | Ga0068864_100631282 | 3300005618 | Unclassified | 1042 |
| 43 | Ga0068861_100016305 | 3300005719 | Bacteria | 5255 |
| 44 | Ga0068861_100505079 | 3300005719 | Bacteria | 1094 |
| 45 | Ga0068861_100548807 | 3300005719 | Bacteria | 1053 |
| 46 | Ga0068870_10054950 | 3300005840 | Bacteria | 2120 |
| 47 | Ga0068863_100094614 | 3300005841 | Bacteria | 2836 |
| 48 | Ga0068858_100071315 | 3300005842 | Bacteria | 3222 |
| 49 | Ga0068858_100171769 | 3300005842 | Bacteria | 2044 |
| 50 | Ga0068860_100114037 | 3300005843 | Bacteria | 2584 |
| 51 | Ga0068862_100004683 | 3300005844 | Bacteria | 11521 |
| 52 | Ga0070716_100411517 | 3300006173 | Bacteria | 975 |
| 53 | Ga0097621_100092365 | 3300006237 | Bacteria | 2535 |
| 54 | Ga0097621_100169627 | 3300006237 | Bacteria | 1880 |
| 55 | Ga0068871_100003635 | 3300006358 | Bacteria | 10596 |
| 56 | Ga0068865_100092322 | 3300006881 | Bacteria | 2199 |
| 57 | Ga0097620_100068968 | 3300006931 | Bacteria | 3570 |
| 58 | Ga0097620_100089834 | 3300006931 | Bacteria | 3122 |
| 59 | Ga0097620_100124615 | 3300006931 | Bacteria | 2645 |
| 60 | Ga0111539_10026261 | 3300009094 | Bacteria | 7123 |
| 61 | Ga0105247_10015922 | 3300009101 | Bacteria | 4503 |
| 62 | Ga0105242_10786924 | 3300009176 | Bacteria | 940 |
| 63 | Ga0105248_10021133 | 3300009177 | Bacteria | 7212 |
| 64 | Ga0105248_10376431 | 3300009177 | Bacteria | 1598 |
| 65 | Ga0157378_10240381 | 3300013297 | Bacteria | 1729 |
| 66 | Ga0157375_10030177 | 3300013308 | Bacteria | 5109 |
| 67 | Ga0157375_10394745 | 3300013308 | Bacteria | 1550 |
| 68 | Ga0157375_10583993 | 3300013308 | Bacteria | 1277 |
| 69 | Ga0163163_10000032 | 3300014325 | Bacteria | 167085 |
| 70 | Ga0163163_10014556 | 3300014325 | Bacteria | 7236 |
| 71 | Ga0163163_10243640 | 3300014325 | Bacteria | 1848 |
| 72 | Ga0163163_11035435 | 3300014325 | Bacteria | 884 |
| 73 | Ga0157380_10006415 | 3300014326 | Bacteria | 8281 |
| 74 | Ga0157380_10462023 | 3300014326 | Bacteria | 1222 |
| 75 | Ga0157376_10104410 | 3300014969 | Bacteria | 2483 |
| 76 | Ga0157376_10172830 | 3300014969 | Bacteria | 1969 |
| 77 | Ga0163161_10153702 | 3300017792 | Bacteria | 1750 |
| 78 | Ga0207682_10001146 | 3300025893 | Bacteria | 12278 |
| 79 | Ga0207682_10138409 | 3300025893 | Bacteria | 1091 |
| 80 | Ga0207692_10318945 | 3300025898 | Bacteria | 950 |
| 81 | Ga0207643_10012643 | 3300025908 | Bacteria | 4560 |
| 82 | Ga0207681_10004118 | 3300025923 | Bacteria | 9012 |
| 83 | Ga0207681_10075951 | 3300025923 | Bacteria | 2358 |
| 84 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 85 | Ga0207650_10036009 | 3300025925 | Bacteria | 3598 |
| 86 | Ga0207659_10063850 | 3300025926 | Bacteria | 2664 |
| 87 | Ga0207659_10065403 | 3300025926 | Bacteria | 2635 |
| 88 | Ga0207644_10000079 | 3300025931 | Bacteria | 71463 |
| 89 | Ga0207670_10025092 | 3300025936 | Bacteria | 3736 |
| 90 | Ga0207669_10034921 | 3300025937 | Bacteria | 2855 |
| 91 | Ga0207669_10111945 | 3300025937 | Bacteria | 1831 |
| 92 | Ga0207704_10005201 | 3300025938 | Bacteria | 5989 |
| 93 | Ga0207691_10012176 | 3300025940 | Bacteria | 8247 |
| 94 | Ga0207691_10148523 | 3300025940 | Bacteria | 2062 |
| 95 | Ga0207711_10000872 | 3300025941 | Bacteria | 29118 |
| 96 | Ga0207689_10060799 | 3300025942 | Bacteria | 3107 |
| 97 | Ga0207689_10425904 | 3300025942 | Bacteria | 1108 |
| 98 | Ga0207679_10015593 | 3300025945 | Bacteria | 5027 |
| 99 | Ga0207651_10022280 | 3300025960 | Bacteria | 3870 |
| 100 | Ga0207651_10212513 | 3300025960 | Bacteria | 1558 |
| 101 | Ga0207668_10153495 | 3300025972 | Bacteria | 1786 |
| 102 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 103 | Ga0207703_10077968 | 3300026035 | Bacteria | 2752 |
| 104 | Ga0207703_10101675 | 3300026035 | Bacteria | 2438 |
| 105 | Ga0207678_10095965 | 3300026067 | Bacteria | 2534 |
| 106 | Ga0207708_10014958 | 3300026075 | Bacteria | 5812 |
| 107 | Ga0207708_10042127 | 3300026075 | Bacteria | 3481 |
| 108 | Ga0207708_10087563 | 3300026075 | Bacteria | 2398 |
| 109 | Ga0207708_10170987 | 3300026075 | Bacteria | 1721 |
| 110 | Ga0207641_10046227 | 3300026088 | Bacteria | 3668 |
| 111 | Ga0207641_10074030 | 3300026088 | Bacteria | 2937 |
| 112 | Ga0207641_10106339 | 3300026088 | Bacteria | 2480 |
| 113 | Ga0207648_10195680 | 3300026089 | Bacteria | 1792 |
| 114 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 115 | Ga0207676_10779750 | 3300026095 | Unclassified | 931 |
| 116 | Ga0207674_10166672 | 3300026116 | Bacteria | 2157 |
| 117 | Ga0207675_100005010 | 3300026118 | Bacteria | 12758 |
| 118 | Ga0207675_100045712 | 3300026118 | Bacteria | 4091 |
| 119 | Ga0207675_100050371 | 3300026118 | Bacteria | 3886 |
| 120 | Ga0207675_100410283 | 3300026118 | Bacteria | 1336 |
| 121 | Ga0207675_100447464 | 3300026118 | Bacteria | 1280 |
| 122 | Ga0207683_10045322 | 3300026121 | Bacteria | 3846 |
| 123 | Ga0268266_10035696 | 3300028379 | Bacteria | 4228 |
| 124 | Ga0268265_10004897 | 3300028380 | Bacteria | 9218 |
| 125 | Ga0268265_10016679 | 3300028380 | Bacteria | 5053 |
| 126 | Ga0268265_10942644 | 3300028380 | Bacteria | 850 |
| 127 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 128 | Ga0307515_10096679 | 3300028794 | Bacteria | 3619 |
| 129 | Ga0307513_10017928 | 3300031456 | Bacteria | 8477 |
| 130 | Ga0307513_10019010 | 3300031456 | Bacteria | 8192 |
| 131 | Ga0307513_10019740 | 3300031456 | Bacteria | 8011 |
| 132 | Ga0307513_10099119 | 3300031456 | Bacteria | 2943 |
| 133 | Ga0307509_10181592 | 3300031507 | Bacteria | 1968 |
| 134 | Ga0307408_100062963 | 3300031548 | Bacteria | 2712 |
| 135 | Ga0307405_10443857 | 3300031731 | Bacteria | 1027 |
| 136 | Ga0307413_10008476 | 3300031824 | Bacteria | 4857 |
| 137 | Ga0307410_10019819 | 3300031852 | Bacteria | 4100 |
| 138 | Ga0307406_10005737 | 3300031901 | Bacteria | 6799 |
| 139 | Ga0307406_10122779 | 3300031901 | Bacteria | 1809 |
| 140 | Ga0307407_10022631 | 3300031903 | Bacteria | 3265 |
| 141 | Ga0307407_10459453 | 3300031903 | Bacteria | 926 |
| 142 | Ga0307409_100012963 | 3300031995 | Bacteria | 5340 |
| 143 | Ga0307409_100047550 | 3300031995 | Bacteria | 3257 |
| 144 | Ga0307416_100123279 | 3300032002 | Bacteria | 2316 |
| 145 | Ga0307414_10105127 | 3300032004 | Bacteria | 2134 |
| 146 | Ga0307414_10678100 | 3300032004 | Bacteria | 931 |
| 147 | Ga0307411_10048095 | 3300032005 | Bacteria | 2762 |
| 148 | Ga0307415_100380579 | 3300032126 | Bacteria | 1198 |
| 149 | Ga0373956_0102941 | 3300035119 | Bacteria | 1326 |
| 150 | Ga0373955_0426528 | 3300035172 | Bacteria | 807 |
| 151 | Ga0373937_0350573 | 3300036401 | Bacteria | 1398 |
| 152 | Ga0395901_0991481 | 3300038443 | Bacteria | 817 |
| 153 | Ga0451791_0267567 | 3300041451 | Bacteria | 2010 |
| 154 | Ga0451807_2290999 | 3300041486 | Bacteria | 1211 |
| 155 | Ga0451837_0567630 | 3300041494 | Bacteria | 3858 |
| 156 | Ga0451843_0839990 | 3300041509 | Bacteria | 1872 |
| 157 | Ga0451577_0102094 | 3300042876 | Bacteria | 2562 |
| 158 | Ga0495603_0082045 | 3300046455 | Bacteria | 1889 |
| 159 | Ga0495603_0304385 | 3300046455 | Bacteria | 916 |
| 160 | Ga0495638_0003825 | 3300046460 | Bacteria | 11683 |
| 161 | Ga0495638_0050908 | 3300046460 | Bacteria | 2586 |
| 162 | Ga0495580_0142012 | 3300046472 | Bacteria | 1664 |
| 163 | Ga0495662_0228268 | 3300046476 | Bacteria | 918 |
| 164 | Ga0495584_0108166 | 3300046491 | Bacteria | 1406 |
| 165 | Ga0495594_0107119 | 3300046499 | Bacteria | 1574 |
| 166 | Ga0495594_0196132 | 3300046499 | Bacteria | 1150 |
| 167 | Ga0495606_0090685 | 3300046507 | Bacteria | 1880 |
| 168 | Ga0495616_0006572 | 3300046513 | Bacteria | 7023 |
| 169 | Ga0495630_0128986 | 3300046517 | Bacteria | 1920 |
| 170 | Ga0495631_0047668 | 3300046518 | Bacteria | 1880 |
| 171 | Ga0495666_0016804 | 3300046526 | Bacteria | 3643 |
| 172 | Ga0495666_0053407 | 3300046526 | Bacteria | 1939 |
| 173 | Ga0495666_0088269 | 3300046526 | Bacteria | 1464 |
| 174 | Ga0495642_0113613 | 3300046528 | Bacteria | 1159 |
| 175 | Ga0495652_0067329 | 3300046529 | Bacteria | 3003 |
| 176 | Ga0495665_0056383 | 3300046531 | Bacteria | 2074 |
| 177 | Ga0495665_0063302 | 3300046531 | Bacteria | 1952 |
| 178 | Ga0495665_0273843 | 3300046531 | Bacteria | 866 |
| 179 | Ga0495640_0242119 | 3300046533 | Bacteria | 1132 |
| 180 | Ga0495586_0037288 | 3300046535 | Bacteria | 2610 |
| 181 | Ga0495587_0047008 | 3300046536 | Bacteria | 2559 |
| 182 | Ga0495597_0000750 | 3300046542 | Bacteria | 25631 |
| 183 | Ga0495622_0052977 | 3300046557 | Bacteria | 1882 |
| 184 | Ga0495633_0109078 | 3300046558 | Bacteria | 1283 |
| 185 | Ga0495667_0161036 | 3300046559 | Bacteria | 1443 |
| 186 | Ga0495668_0017193 | 3300046616 | Bacteria | 4200 |
| 187 | Ga0495668_0109614 | 3300046616 | Bacteria | 1510 |
| 188 | Ga0495668_0200627 | 3300046616 | Bacteria | 1092 |
| 189 | Ga0495634_0218910 | 3300046642 | Bacteria | 1176 |
| 190 | Ga0495625_0010426 | 3300046660 | Bacteria | 7691 |
| 191 | Ga0495625_0030951 | 3300046660 | Bacteria | 3986 |
| 192 | Ga0495625_0053182 | 3300046660 | Bacteria | 2898 |
| 193 | Ga0495661_0059915 | 3300046665 | Bacteria | 2263 |
| 194 | Ga0495588_0023747 | 3300046674 | Bacteria | 3038 |
| 195 | Ga0495588_0024022 | 3300046674 | Bacteria | 3024 |
| 196 | Ga0495588_0053086 | 3300046674 | Bacteria | 2089 |
| 197 | Ga0495646_0118017 | 3300046680 | Bacteria | 1504 |
| 198 | Ga0495613_0077562 | 3300046689 | Bacteria | 2417 |
| 199 | Ga0495649_0002890 | 3300046694 | Bacteria | 11907 |
| 200 | Ga0495600_0077432 | 3300046809 | Bacteria | 2171 |
| 201 | Ga0495581_0039490 | 3300047315 | Bacteria | 2732 |
| 202 | Ga0495604_0104486 | 3300047317 | Bacteria | 2075 |
| 203 | Ga0495604_0174853 | 3300047317 | Bacteria | 1506 |
| 204 | Ga0495674_0004779 | 3300047319 | Bacteria | 13028 |
| 205 | Ga0495676_0063743 | 3300047321 | Bacteria | 2871 |
| 206 | Ga0495680_0087017 | 3300047322 | Bacteria | 2351 |
| 207 | Ga0495683_0092427 | 3300047323 | Bacteria | 1464 |
| 208 | Ga0495675_0165042 | 3300047444 | Bacteria | 1362 |
| 209 | Ga0495614_0066322 | 3300048089 | Bacteria | 1553 |
| 210 | Ga0496114_0373964 | 3300048917 | Bacteria | 1261 |
| 211 | Ga0496114_0415522 | 3300048917 | Bacteria | 1191 |
| 212 | Ga0496115_0005153 | 3300048918 | Bacteria | 9510 |
| 213 | Ga0496115_0180727 | 3300048918 | Bacteria | 1744 |
| 214 | Ga0496115_0506220 | 3300048918 | Bacteria | 970 |
| 215 | Ga0496124_0050202 | 3300048927 | Bacteria | 3556 |
| 216 | Ga0496126_0090389 | 3300048929 | Bacteria | 2694 |
| 217 | Ga0501036_0297093 | 3300049572 | Bacteria | 1351 |
| 218 | Ga0501040_0233390 | 3300049576 | Bacteria | 1310 |
| 219 | Ga0501041_0311382 | 3300049577 | Bacteria | 993 |
| 220 | Ga0501042_0059779 | 3300049578 | Bacteria | 2722 |
| 221 | Ga0501067_0045999 | 3300049583 | Unclassified | 2422 |
| 222 | Ga0501068_0003685 | 3300049584 | Bacteria | 8289 |
| 223 | Ga0501068_0151878 | 3300049584 | Bacteria | 1456 |
| 224 | Ga0501070_0058028 | 3300049586 | Bacteria | 3209 |
| 225 | Ga0501070_0226597 | 3300049586 | Bacteria | 1532 |
| 226 | Ga0501072_0189745 | 3300049588 | Bacteria | 1639 |
| 227 | Ga0501073_0018851 | 3300049589 | Bacteria | 4986 |
| 228 | Ga0501074_0047060 | 3300049590 | Bacteria | 3118 |
| 229 | Ga0501076_0095140 | 3300049592 | Bacteria | 2399 |
| 230 | Ga0501077_0032072 | 3300049593 | Bacteria | 3343 |
| 231 | Ga0501079_0001111 | 3300049741 | Bacteria | 18700 |
| 232 | Ga0501080_0126748 | 3300049742 | Bacteria | 2364 |
| 233 | Ga0501080_0265689 | 3300049742 | Bacteria | 1562 |
| 234 | Ga0501083_0013752 | 3300049744 | Bacteria | 5659 |
| 235 | nmdc:mga08y16_120507_c1 | 3300050511 | Bacteria | 2730 |
| 236 | Ga0501084_0120036 | 3300054114 | Bacteria | 2210 |
| 237 | Ga0501082_0075194 | 3300060353 | Bacteria | 2910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100066807 | Ga0070675_1000668074 | 180 |
| 2 | 3300005438 | Ga0070701_10026601 | Ga0070701_100266014 | 180 |
| 3 | 3300005441 | Ga0070700_100080437 | Ga0070700_1000804373 | 180 |
| 4 | 3300026075 | Ga0207708_10170987 | Ga0207708_101709872 | 180 |
| 5 | 3300026118 | Ga0207675_100447464 | Ga0207675_1004474643 | 180 |
| 6 | 3300031456 | Ga0307513_10019740 | Ga0307513_100197406 | 180 |
| 7 | 3300035172 | Ga0373955_0426528 | Ga0373955_0426528_41_667 | 180 |
| 8 | 3300031456 | Ga0307513_10099119 | Ga0307513_100991192 | 185 |
| 9 | 3300046694 | Ga0495649_0002890 | Ga0495649_0002890_9827_10462 | 185 |
| 10 | 3300049584 | Ga0501068_0151878 | Ga0501068_0151878_41_676 | 185 |
| 11 | 3300013297 | Ga0157378_10240381 | Ga0157378_102403813 | 186 |
| 12 | 3300042876 | Ga0451577_0102094 | Ga0451577_0102094_310_1065 | 187 |
| 13 | 3300025898 | Ga0207692_10318945 | Ga0207692_103189451 | 188 |
| 14 | 3300046455 | Ga0495603_0304385 | Ga0495603_0304385_10_681 | 196 |
| 15 | 3300046531 | Ga0495665_0273843 | Ga0495665_0273843_34_705 | 196 |
| 16 | 3300046536 | Ga0495587_0047008 | Ga0495587_0047008_1855_2526 | 196 |
| 17 | 3300046642 | Ga0495634_0218910 | Ga0495634_0218910_473_1144 | 196 |
| 18 | 3300035119 | Ga0373956_0102941 | Ga0373956_0102941_315_992 | 197 |
| 19 | 3300036401 | Ga0373937_0350573 | Ga0373937_0350573_46_723 | 197 |
| 20 | 3300041451 | Ga0451791_0267567 | Ga0451791_0267567_1192_1809 | 198 |
| 21 | 3300046491 | Ga0495584_0108166 | Ga0495584_0108166_501_1229 | 203 |
| 22 | 3300046616 | Ga0495668_0017193 | Ga0495668_0017193_2721_3449 | 203 |
| 23 | 3300005617 | Ga0068859_100124620 | Ga0068859_1001246203 | 204 |
| 24 | 3300006931 | Ga0097620_100124615 | Ga0097620_1001246153 | 204 |
| 25 | 3300005353 | Ga0070669_100003202 | Ga0070669_1000032026 | 206 |
| 26 | 3300005617 | Ga0068859_100068976 | Ga0068859_1000689762 | 206 |
| 27 | 3300005842 | Ga0068858_100071315 | Ga0068858_1000713152 | 206 |
| 28 | 3300005844 | Ga0068862_100004683 | Ga0068862_1000046836 | 206 |
| 29 | 3300006931 | Ga0097620_100068968 | Ga0097620_1000689683 | 206 |
| 30 | 3300009101 | Ga0105247_10015922 | Ga0105247_100159226 | 206 |
| 31 | 3300009177 | Ga0105248_10021133 | Ga0105248_100211335 | 206 |
| 32 | 3300025923 | Ga0207681_10004118 | Ga0207681_100041184 | 206 |
| 33 | 3300025941 | Ga0207711_10000872 | Ga0207711_1000087224 | 206 |
| 34 | 3300026035 | Ga0207703_10077968 | Ga0207703_100779683 | 206 |
| 35 | 3300028379 | Ga0268266_10035696 | Ga0268266_100356962 | 206 |
| 36 | 3300028380 | Ga0268265_10004897 | Ga0268265_100048973 | 206 |
| 37 | 3300048929 | Ga0496126_0090389 | Ga0496126_0090389_806_1579 | 206 |
| 38 | 3300005441 | Ga0070700_100045405 | Ga0070700_1000454053 | 207 |
| 39 | 3300005615 | Ga0070702_100264883 | Ga0070702_1002648831 | 207 |
| 40 | 3300005719 | Ga0068861_100016305 | Ga0068861_1000163053 | 207 |
| 41 | 3300025923 | Ga0207681_10075951 | Ga0207681_100759513 | 207 |
| 42 | 3300025937 | Ga0207669_10111945 | Ga0207669_101119452 | 207 |
| 43 | 3300026075 | Ga0207708_10042127 | Ga0207708_100421273 | 207 |
| 44 | 3300026089 | Ga0207648_10195680 | Ga0207648_101956803 | 207 |
| 45 | 3300026118 | Ga0207675_100005010 | Ga0207675_1000050109 | 207 |
| 46 | 3300048918 | Ga0496115_0506220 | Ga0496115_0506220_241_960 | 207 |
| 47 | 3300005356 | Ga0070674_100644771 | Ga0070674_1006447711 | 208 |
| 48 | 3300017792 | Ga0163161_10153702 | Ga0163161_101537024 | 208 |
| 49 | 3300047315 | Ga0495581_0039490 | Ga0495581_0039490_911_1621 | 208 |
| 50 | 3300047322 | Ga0495680_0087017 | Ga0495680_0087017_94_804 | 208 |
| 51 | 3300047444 | Ga0495675_0165042 | Ga0495675_0165042_281_991 | 208 |
| 52 | 3300048918 | Ga0496115_0005153 | Ga0496115_0005153_7437_8174 | 208 |
| 53 | 3300005340 | Ga0070689_100276912 | Ga0070689_1002769122 | 209 |
| 54 | 3300005354 | Ga0070675_100018477 | Ga0070675_1000184776 | 209 |
| 55 | 3300005719 | Ga0068861_100505079 | Ga0068861_1005050792 | 209 |
| 56 | 3300005840 | Ga0068870_10054950 | Ga0068870_100549503 | 209 |
| 57 | 3300014325 | Ga0163163_10243640 | Ga0163163_102436403 | 209 |
| 58 | 3300025893 | Ga0207682_10001146 | Ga0207682_1000114611 | 209 |
| 59 | 3300025908 | Ga0207643_10012643 | Ga0207643_100126433 | 209 |
| 60 | 3300025926 | Ga0207659_10063850 | Ga0207659_100638502 | 209 |
| 61 | 3300025960 | Ga0207651_10212513 | Ga0207651_102125132 | 209 |
| 62 | 3300026118 | Ga0207675_100410283 | Ga0207675_1004102832 | 209 |
| 63 | 3300031456 | Ga0307513_10019010 | Ga0307513_100190107 | 209 |
| 64 | 3300046507 | Ga0495606_0090685 | Ga0495606_0090685_362_1105 | 209 |
| 65 | 3300046518 | Ga0495631_0047668 | Ga0495631_0047668_763_1506 | 209 |
| 66 | 3300046558 | Ga0495633_0109078 | Ga0495633_0109078_515_1258 | 209 |
| 67 | 3300046616 | Ga0495668_0109614 | Ga0495668_0109614_218_961 | 209 |
| 68 | 3300046665 | Ga0495661_0059915 | Ga0495661_0059915_1119_1862 | 209 |
| 69 | 3300047323 | Ga0495683_0092427 | Ga0495683_0092427_574_1317 | 209 |
| 70 | 3300049586 | Ga0501070_0226597 | Ga0501070_0226597_579_1310 | 209 |
| 71 | 3300005353 | Ga0070669_100187890 | Ga0070669_1001878901 | 210 |
| 72 | 3300005355 | Ga0070671_100000033 | Ga0070671_10000003378 | 210 |
| 73 | 3300005441 | Ga0070700_100048485 | Ga0070700_1000484853 | 210 |
| 74 | 3300005456 | Ga0070678_100317869 | Ga0070678_1003178692 | 210 |
| 75 | 3300005466 | Ga0070685_10000002 | Ga0070685_10000002245 | 210 |
| 76 | 3300006237 | Ga0097621_100169627 | Ga0097621_1001696274 | 210 |
| 77 | 3300009177 | Ga0105248_10376431 | Ga0105248_103764312 | 210 |
| 78 | 3300013308 | Ga0157375_10394745 | Ga0157375_103947453 | 210 |
| 79 | 3300013308 | Ga0157375_10583993 | Ga0157375_105839932 | 210 |
| 80 | 3300014969 | Ga0157376_10104410 | Ga0157376_101044102 | 210 |
| 81 | 3300025931 | Ga0207644_10000079 | Ga0207644_1000007946 | 210 |
| 82 | 3300026075 | Ga0207708_10014958 | Ga0207708_100149585 | 210 |
| 83 | 3300026121 | Ga0207683_10045322 | Ga0207683_100453221 | 210 |
| 84 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004880 | 210 |
| 85 | 3300031507 | Ga0307509_10181592 | Ga0307509_101815923 | 210 |
| 86 | 3300046542 | Ga0495597_0000750 | Ga0495597_0000750_15305_16060 | 210 |
| 87 | 3300048917 | Ga0496114_0373964 | Ga0496114_0373964_86_859 | 210 |
| 88 | 3300048927 | Ga0496124_0050202 | Ga0496124_0050202_1386_2159 | 210 |
| 89 | 3300049742 | Ga0501080_0265689 | Ga0501080_0265689_405_1154 | 210 |
| 90 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001191 | 211 |
| 91 | 3300005367 | Ga0070667_100000096 | Ga0070667_10000009672 | 211 |
| 92 | 3300005618 | Ga0068864_100000006 | Ga0068864_100000006195 | 211 |
| 93 | 3300014325 | Ga0163163_10000032 | Ga0163163_1000003245 | 211 |
| 94 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002870 | 211 |
| 95 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001484 | 211 |
| 96 | 3300026088 | Ga0207641_10046227 | Ga0207641_100462274 | 211 |
| 97 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001870 | 211 |
| 98 | 3300031456 | Ga0307513_10017928 | Ga0307513_100179285 | 211 |
| 99 | 3300038443 | Ga0395901_0991481 | Ga0395901_0991481_25_771 | 211 |
| 100 | 3300046472 | Ga0495580_0142012 | Ga0495580_0142012_181_927 | 211 |
| 101 | 3300046476 | Ga0495662_0228268 | Ga0495662_0228268_17_754 | 211 |
| 102 | 3300046499 | Ga0495594_0107119 | Ga0495594_0107119_643_1380 | 211 |
| 103 | 3300046499 | Ga0495594_0196132 | Ga0495594_0196132_28_777 | 211 |
| 104 | 3300046517 | Ga0495630_0128986 | Ga0495630_0128986_675_1412 | 211 |
| 105 | 3300046526 | Ga0495666_0016804 | Ga0495666_0016804_2389_3126 | 211 |
| 106 | 3300046526 | Ga0495666_0053407 | Ga0495666_0053407_1000_1749 | 211 |
| 107 | 3300046526 | Ga0495666_0088269 | Ga0495666_0088269_141_887 | 211 |
| 108 | 3300046528 | Ga0495642_0113613 | Ga0495642_0113613_113_850 | 211 |
| 109 | 3300046529 | Ga0495652_0067329 | Ga0495652_0067329_551_1288 | 211 |
| 110 | 3300046531 | Ga0495665_0056383 | Ga0495665_0056383_841_1587 | 211 |
| 111 | 3300046531 | Ga0495665_0063302 | Ga0495665_0063302_179_928 | 211 |
| 112 | 3300046533 | Ga0495640_0242119 | Ga0495640_0242119_86_832 | 211 |
| 113 | 3300046535 | Ga0495586_0037288 | Ga0495586_0037288_850_1599 | 211 |
| 114 | 3300046557 | Ga0495622_0052977 | Ga0495622_0052977_709_1446 | 211 |
| 115 | 3300046559 | Ga0495667_0161036 | Ga0495667_0161036_119_856 | 211 |
| 116 | 3300046674 | Ga0495588_0023747 | Ga0495588_0023747_1607_2356 | 211 |
| 117 | 3300046674 | Ga0495588_0024022 | Ga0495588_0024022_427_1164 | 211 |
| 118 | 3300046674 | Ga0495588_0053086 | Ga0495588_0053086_1283_2032 | 211 |
| 119 | 3300046680 | Ga0495646_0118017 | Ga0495646_0118017_384_1121 | 211 |
| 120 | 3300046689 | Ga0495613_0077562 | Ga0495613_0077562_543_1280 | 211 |
| 121 | 3300046809 | Ga0495600_0077432 | Ga0495600_0077432_608_1345 | 211 |
| 122 | 3300047317 | Ga0495604_0104486 | Ga0495604_0104486_1188_1925 | 211 |
| 123 | 3300047317 | Ga0495604_0174853 | Ga0495604_0174853_112_858 | 211 |
| 124 | 3300047319 | Ga0495674_0004779 | Ga0495674_0004779_11779_12528 | 211 |
| 125 | 3300047321 | Ga0495676_0063743 | Ga0495676_0063743_553_1302 | 211 |
| 126 | 3300048089 | Ga0495614_0066322 | Ga0495614_0066322_745_1494 | 211 |
| 127 | 3300048918 | Ga0496115_0180727 | Ga0496115_0180727_266_1012 | 211 |
| 128 | 3300014326 | Ga0157380_10462023 | Ga0157380_104620232 | 212 |
| 129 | 3300005334 | Ga0068869_100168849 | Ga0068869_1001688493 | 213 |
| 130 | 3300005340 | Ga0070689_100006209 | Ga0070689_1000062098 | 213 |
| 131 | 3300005441 | Ga0070700_100091150 | Ga0070700_1000911504 | 213 |
| 132 | 3300005441 | Ga0070700_100194463 | Ga0070700_1001944632 | 213 |
| 133 | 3300005444 | Ga0070694_100043677 | Ga0070694_1000436774 | 213 |
| 134 | 3300005543 | Ga0070672_100018533 | Ga0070672_1000185334 | 213 |
| 135 | 3300005546 | Ga0070696_100016862 | Ga0070696_1000168627 | 213 |
| 136 | 3300005617 | Ga0068859_100089833 | Ga0068859_1000898334 | 213 |
| 137 | 3300005841 | Ga0068863_100094614 | Ga0068863_1000946145 | 213 |
| 138 | 3300005842 | Ga0068858_100171769 | Ga0068858_1001717692 | 213 |
| 139 | 3300005843 | Ga0068860_100114037 | Ga0068860_1001140374 | 213 |
| 140 | 3300006881 | Ga0068865_100092322 | Ga0068865_1000923223 | 213 |
| 141 | 3300006931 | Ga0097620_100089834 | Ga0097620_1000898344 | 213 |
| 142 | 3300013308 | Ga0157375_10030177 | Ga0157375_100301774 | 213 |
| 143 | 3300025936 | Ga0207670_10025092 | Ga0207670_100250924 | 213 |
| 144 | 3300025938 | Ga0207704_10005201 | Ga0207704_100052015 | 213 |
| 145 | 3300025940 | Ga0207691_10012176 | Ga0207691_100121766 | 213 |
| 146 | 3300025942 | Ga0207689_10425904 | Ga0207689_104259042 | 213 |
| 147 | 3300025960 | Ga0207651_10022280 | Ga0207651_100222804 | 213 |
| 148 | 3300026035 | Ga0207703_10101675 | Ga0207703_101016754 | 213 |
| 149 | 3300026075 | Ga0207708_10087563 | Ga0207708_100875633 | 213 |
| 150 | 3300026088 | Ga0207641_10074030 | Ga0207641_100740304 | 213 |
| 151 | 3300026088 | Ga0207641_10106339 | Ga0207641_101063392 | 213 |
| 152 | 3300026118 | Ga0207675_100050371 | Ga0207675_1000503714 | 213 |
| 153 | 3300028380 | Ga0268265_10016679 | Ga0268265_100166794 | 213 |
| 154 | 3300031548 | Ga0307408_100062963 | Ga0307408_1000629632 | 213 |
| 155 | 3300031824 | Ga0307413_10008476 | Ga0307413_100084766 | 213 |
| 156 | 3300031852 | Ga0307410_10019819 | Ga0307410_100198193 | 213 |
| 157 | 3300031901 | Ga0307406_10005737 | Ga0307406_100057375 | 213 |
| 158 | 3300031995 | Ga0307409_100047550 | Ga0307409_1000475505 | 213 |
| 159 | 3300032004 | Ga0307414_10678100 | Ga0307414_106781002 | 213 |
| 160 | 3300032005 | Ga0307411_10048095 | Ga0307411_100480953 | 213 |
| 161 | 3300046455 | Ga0495603_0082045 | Ga0495603_0082045_466_1194 | 213 |
| 162 | 3300005455 | Ga0070663_100083218 | Ga0070663_1000832184 | 214 |
| 163 | 3300005577 | Ga0068857_100056415 | Ga0068857_1000564154 | 214 |
| 164 | 3300009094 | Ga0111539_10026261 | Ga0111539_100262617 | 214 |
| 165 | 3300009176 | Ga0105242_10786924 | Ga0105242_107869242 | 214 |
| 166 | 3300014325 | Ga0163163_11035435 | Ga0163163_110354351 | 214 |
| 167 | 3300014969 | Ga0157376_10172830 | Ga0157376_101728302 | 214 |
| 168 | 3300026067 | Ga0207678_10095965 | Ga0207678_100959654 | 214 |
| 169 | 3300026116 | Ga0207674_10166672 | Ga0207674_101666724 | 214 |
| 170 | 3300028380 | Ga0268265_10942644 | Ga0268265_109426441 | 214 |
| 171 | 3300031901 | Ga0307406_10122779 | Ga0307406_101227792 | 214 |
| 172 | 3300031903 | Ga0307407_10459453 | Ga0307407_104594532 | 214 |
| 173 | 3300032002 | Ga0307416_100123279 | Ga0307416_1001232793 | 214 |
| 174 | 3300032126 | Ga0307415_100380579 | Ga0307415_1003805792 | 214 |
| 175 | 3300041486 | Ga0451807_2290999 | Ga0451807_2290999_156_884 | 214 |
| 176 | 3300046460 | Ga0495638_0003825 | Ga0495638_0003825_1254_1985 | 214 |
| 177 | 3300046460 | Ga0495638_0050908 | Ga0495638_0050908_1562_2317 | 214 |
| 178 | 3300046513 | Ga0495616_0006572 | Ga0495616_0006572_2028_2783 | 214 |
| 179 | 3300046616 | Ga0495668_0200627 | Ga0495668_0200627_189_917 | 214 |
| 180 | 3300046660 | Ga0495625_0010426 | Ga0495625_0010426_5258_5989 | 214 |
| 181 | 3300046660 | Ga0495625_0030951 | Ga0495625_0030951_2261_3016 | 214 |
| 182 | 3300050511 | nmdc:mga08y16_120507_c1 | nmdc:mga08y16_120507_c1_998_1759 | 214 |
| 183 | 3300003322 | rootL2_10002920 | rootL2_100029202 | 215 |
| 184 | 3300003322 | rootL2_10131626 | rootL2_101316264 | 215 |
| 185 | 3300005333 | Ga0070677_10101126 | Ga0070677_101011262 | 215 |
| 186 | 3300005334 | Ga0068869_100038243 | Ga0068869_1000382435 | 215 |
| 187 | 3300005340 | Ga0070689_100055090 | Ga0070689_1000550903 | 215 |
| 188 | 3300005354 | Ga0070675_100042395 | Ga0070675_1000423953 | 215 |
| 189 | 3300005543 | Ga0070672_100095053 | Ga0070672_1000950533 | 215 |
| 190 | 3300005543 | Ga0070672_100522860 | Ga0070672_1005228602 | 215 |
| 191 | 3300005544 | Ga0070686_100023033 | Ga0070686_1000230334 | 215 |
| 192 | 3300005547 | Ga0070693_100366603 | Ga0070693_1003666032 | 215 |
| 193 | 3300005548 | Ga0070665_100002609 | Ga0070665_10000260911 | 215 |
| 194 | 3300005548 | Ga0070665_100913429 | Ga0070665_1009134292 | 215 |
| 195 | 3300005618 | Ga0068864_100631282 | Ga0068864_1006312822 | 215 |
| 196 | 3300005719 | Ga0068861_100548807 | Ga0068861_1005488072 | 215 |
| 197 | 3300006173 | Ga0070716_100411517 | Ga0070716_1004115172 | 215 |
| 198 | 3300006237 | Ga0097621_100092365 | Ga0097621_1000923653 | 215 |
| 199 | 3300006358 | Ga0068871_100003635 | Ga0068871_1000036359 | 215 |
| 200 | 3300014325 | Ga0163163_10014556 | Ga0163163_100145565 | 215 |
| 201 | 3300014326 | Ga0157380_10006415 | Ga0157380_100064157 | 215 |
| 202 | 3300025893 | Ga0207682_10138409 | Ga0207682_101384092 | 215 |
| 203 | 3300025925 | Ga0207650_10036009 | Ga0207650_100360095 | 215 |
| 204 | 3300025926 | Ga0207659_10065403 | Ga0207659_100654033 | 215 |
| 205 | 3300025937 | Ga0207669_10034921 | Ga0207669_100349214 | 215 |
| 206 | 3300025940 | Ga0207691_10148523 | Ga0207691_101485233 | 215 |
| 207 | 3300025942 | Ga0207689_10060799 | Ga0207689_100607992 | 215 |
| 208 | 3300025945 | Ga0207679_10015593 | Ga0207679_100155934 | 215 |
| 209 | 3300025972 | Ga0207668_10153495 | Ga0207668_101534953 | 215 |
| 210 | 3300026095 | Ga0207676_10779750 | Ga0207676_107797502 | 215 |
| 211 | 3300026118 | Ga0207675_100045712 | Ga0207675_1000457125 | 215 |
| 212 | 3300028794 | Ga0307515_10096679 | Ga0307515_100966794 | 215 |
| 213 | 3300031731 | Ga0307405_10443857 | Ga0307405_104438572 | 215 |
| 214 | 3300031903 | Ga0307407_10022631 | Ga0307407_100226311 | 215 |
| 215 | 3300031995 | Ga0307409_100012963 | Ga0307409_1000129636 | 215 |
| 216 | 3300032004 | Ga0307414_10105127 | Ga0307414_101051273 | 215 |
| 217 | 3300041494 | Ga0451837_0567630 | Ga0451837_0567630_546_1295 | 215 |
| 218 | 3300041509 | Ga0451843_0839990 | Ga0451843_0839990_574_1323 | 215 |
| 219 | 3300046660 | Ga0495625_0053182 | Ga0495625_0053182_426_1166 | 215 |
| 220 | 3300048917 | Ga0496114_0415522 | Ga0496114_0415522_92_856 | 215 |
| 221 | 3300049572 | Ga0501036_0297093 | Ga0501036_0297093_159_914 | 215 |
| 222 | 3300049576 | Ga0501040_0233390 | Ga0501040_0233390_182_937 | 215 |
| 223 | 3300049577 | Ga0501041_0311382 | Ga0501041_0311382_163_927 | 215 |
| 224 | 3300049578 | Ga0501042_0059779 | Ga0501042_0059779_1654_2409 | 215 |
| 225 | 3300049583 | Ga0501067_0045999 | Ga0501067_0045999_26_763 | 215 |
| 226 | 3300049584 | Ga0501068_0003685 | Ga0501068_0003685_491_1228 | 215 |
| 227 | 3300049586 | Ga0501070_0058028 | Ga0501070_0058028_673_1410 | 215 |
| 228 | 3300049588 | Ga0501072_0189745 | Ga0501072_0189745_702_1439 | 215 |
| 229 | 3300049589 | Ga0501073_0018851 | Ga0501073_0018851_1481_2218 | 215 |
| 230 | 3300049590 | Ga0501074_0047060 | Ga0501074_0047060_925_1662 | 215 |
| 231 | 3300049592 | Ga0501076_0095140 | Ga0501076_0095140_1470_2207 | 215 |
| 232 | 3300049593 | Ga0501077_0032072 | Ga0501077_0032072_464_1201 | 215 |
| 233 | 3300049741 | Ga0501079_0001111 | Ga0501079_0001111_16815_17552 | 215 |
| 234 | 3300049742 | Ga0501080_0126748 | Ga0501080_0126748_189_926 | 215 |
| 235 | 3300049744 | Ga0501083_0013752 | Ga0501083_0013752_3514_4251 | 215 |
| 236 | 3300054114 | Ga0501084_0120036 | Ga0501084_0120036_840_1577 | 215 |
| 237 | 3300060353 | Ga0501082_0075194 | Ga0501082_0075194_1479_2216 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oa6-assembly1.cif.gz_B | aristolochene synthase from aspergillus terreus complexed with pyrophosphate | 0.3173 | 49 | 151 |
| 8fed-assembly1.cif.gz_K | structure of mce1-lucb complex from mycobacterium smegmatis (map1) | 0.311 | 34 | 160 |
| 7zoy-assembly1.cif.gz_A | crystal structure of synechocystis halorhodopsin (syhr), so4-bound form, ground state | 0.3102 | 29 | 162 |
| 3bny-assembly1.cif.gz_D | crystal structure of aristolochene synthase complexed with 2-fluorofarnesyl diphosphate (2f-fpp) | 0.3026 | 49 | 151 |
| 5aqd-assembly1.cif.gz_P | crystal structure of phormidium phycoerythrin at ph 8.5 | 0.2896 | 2 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9M007_41_449_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.4234 | 74 | 164 | 1.20.1530.20 |
| af_Q2FVB6_8_378_1.20.1720.10 | Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D | 0.3546 | 18 | 181 | 1.20.1720.10 |
| af_K7MPH0_48_451_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.3525 | 72 | 154 | 1.20.1530.20 |
| af_A0A1D6MVG0_125_298_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.3504 | 83 | 156 | 1.20.1530.20 |
| af_Q4DN15_2_175_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3393 | 11 | 159 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C8X9V5-F1-model_v4 | deleted | 0.8661 | 11 | 164 |
|
| AF-A0A7C5MJI2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8633 | 7 | 185 |
GO:0005886
GO:1903785 |
| AF-C7RR12-F1-model_v4 | AzlC family protein | 0.8622 | 7 | 188 |
GO:0005886
GO:1903785 |
| AF-A0A7Z9UYT9-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.8613 | 10 | 159 |
GO:0005886
GO:1903785 |
| AF-A0A7W0LRQ9-F1-model_v4 | AzlC family ABC transporter permease | 0.861 | 5 | 157 |
GO:0005886
GO:1903785 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar