F350342

General Info

Members Datasets Scaffolds Average Seq Length
237 158 237 231

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0415522|Ga0496114_0415522_92_856
Length 254
Sequence VGVDGQHRKLVIPGDPERRAAFRAGQRAILQSLPGAAAWGLVSGVAMVKGGLSPPWAATMSLLVYAGSAQLAALPLIATGMPLWVIVATGLITNLRFVIYSAALRPYFADQSLRKRAAIGFFMTDFTFTLFMRSAQEGRLPGQHRDAWFAGVCSSNWTTWQVCAMTGIVAASYVPTQWGLEFTGTLALLALVGPALITRPAIVGAVTASLVALLTHGISYRLGLFCAAIAGIAAATLADGWRSSGGSQDAAETS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 5.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10002920 3300003322 Bacteria 5279
2 rootL2_10131626 3300003322 Bacteria 2010
3 Ga0070670_100000001 3300005331 Bacteria 728788
4 Ga0070677_10101126 3300005333 Bacteria 1271
5 Ga0068869_100038243 3300005334 Bacteria 3418
6 Ga0068869_100168849 3300005334 Bacteria 1708
7 Ga0070689_100006209 3300005340 Bacteria 8246
8 Ga0070689_100055090 3300005340 Bacteria 3080
9 Ga0070689_100276912 3300005340 Bacteria 1391
10 Ga0070669_100003202 3300005353 Bacteria 11764
11 Ga0070669_100187890 3300005353 Bacteria 1619
12 Ga0070675_100018477 3300005354 Bacteria 5550
13 Ga0070675_100042395 3300005354 Bacteria 3719
14 Ga0070675_100066807 3300005354 Bacteria 2975
15 Ga0070671_100000033 3300005355 Bacteria 105788
16 Ga0070674_100644771 3300005356 Bacteria 900
17 Ga0070667_100000096 3300005367 Bacteria 108816
18 Ga0070701_10026601 3300005438 Bacteria 2823
19 Ga0070700_100045405 3300005441 Bacteria 2710
20 Ga0070700_100048485 3300005441 Bacteria 2632
21 Ga0070700_100080437 3300005441 Bacteria 2102
22 Ga0070700_100091150 3300005441 Bacteria 1989
23 Ga0070700_100194463 3300005441 Bacteria 1421
24 Ga0070694_100043677 3300005444 Bacteria 2997
25 Ga0070663_100083218 3300005455 Bacteria 2356
26 Ga0070678_100317869 3300005456 Bacteria 1329
27 Ga0070685_10000002 3300005466 Bacteria 295205
28 Ga0070672_100018533 3300005543 Bacteria 5035
29 Ga0070672_100095053 3300005543 Bacteria 2410
30 Ga0070672_100522860 3300005543 Bacteria 1028
31 Ga0070686_100023033 3300005544 Bacteria 3718
32 Ga0070696_100016862 3300005546 Bacteria 4927
33 Ga0070693_100366603 3300005547 Bacteria 990
34 Ga0070665_100002609 3300005548 Bacteria 19675
35 Ga0070665_100913429 3300005548 Bacteria 890
36 Ga0068857_100056415 3300005577 Bacteria 3486
37 Ga0070702_100264883 3300005615 Bacteria 1172
38 Ga0068859_100068976 3300005617 Bacteria 3570
39 Ga0068859_100089833 3300005617 Bacteria 3122
40 Ga0068859_100124620 3300005617 Bacteria 2645
41 Ga0068864_100000006 3300005618 Bacteria 393838
42 Ga0068864_100631282 3300005618 Unclassified 1042
43 Ga0068861_100016305 3300005719 Bacteria 5255
44 Ga0068861_100505079 3300005719 Bacteria 1094
45 Ga0068861_100548807 3300005719 Bacteria 1053
46 Ga0068870_10054950 3300005840 Bacteria 2120
47 Ga0068863_100094614 3300005841 Bacteria 2836
48 Ga0068858_100071315 3300005842 Bacteria 3222
49 Ga0068858_100171769 3300005842 Bacteria 2044
50 Ga0068860_100114037 3300005843 Bacteria 2584
51 Ga0068862_100004683 3300005844 Bacteria 11521
52 Ga0070716_100411517 3300006173 Bacteria 975
53 Ga0097621_100092365 3300006237 Bacteria 2535
54 Ga0097621_100169627 3300006237 Bacteria 1880
55 Ga0068871_100003635 3300006358 Bacteria 10596
56 Ga0068865_100092322 3300006881 Bacteria 2199
57 Ga0097620_100068968 3300006931 Bacteria 3570
58 Ga0097620_100089834 3300006931 Bacteria 3122
59 Ga0097620_100124615 3300006931 Bacteria 2645
60 Ga0111539_10026261 3300009094 Bacteria 7123
61 Ga0105247_10015922 3300009101 Bacteria 4503
62 Ga0105242_10786924 3300009176 Bacteria 940
63 Ga0105248_10021133 3300009177 Bacteria 7212
64 Ga0105248_10376431 3300009177 Bacteria 1598
65 Ga0157378_10240381 3300013297 Bacteria 1729
66 Ga0157375_10030177 3300013308 Bacteria 5109
67 Ga0157375_10394745 3300013308 Bacteria 1550
68 Ga0157375_10583993 3300013308 Bacteria 1277
69 Ga0163163_10000032 3300014325 Bacteria 167085
70 Ga0163163_10014556 3300014325 Bacteria 7236
71 Ga0163163_10243640 3300014325 Bacteria 1848
72 Ga0163163_11035435 3300014325 Bacteria 884
73 Ga0157380_10006415 3300014326 Bacteria 8281
74 Ga0157380_10462023 3300014326 Bacteria 1222
75 Ga0157376_10104410 3300014969 Bacteria 2483
76 Ga0157376_10172830 3300014969 Bacteria 1969
77 Ga0163161_10153702 3300017792 Bacteria 1750
78 Ga0207682_10001146 3300025893 Bacteria 12278
79 Ga0207682_10138409 3300025893 Bacteria 1091
80 Ga0207692_10318945 3300025898 Bacteria 950
81 Ga0207643_10012643 3300025908 Bacteria 4560
82 Ga0207681_10004118 3300025923 Bacteria 9012
83 Ga0207681_10075951 3300025923 Bacteria 2358
84 Ga0207650_10000002 3300025925 Bacteria 1439222
85 Ga0207650_10036009 3300025925 Bacteria 3598
86 Ga0207659_10063850 3300025926 Bacteria 2664
87 Ga0207659_10065403 3300025926 Bacteria 2635
88 Ga0207644_10000079 3300025931 Bacteria 71463
89 Ga0207670_10025092 3300025936 Bacteria 3736
90 Ga0207669_10034921 3300025937 Bacteria 2855
91 Ga0207669_10111945 3300025937 Bacteria 1831
92 Ga0207704_10005201 3300025938 Bacteria 5989
93 Ga0207691_10012176 3300025940 Bacteria 8247
94 Ga0207691_10148523 3300025940 Bacteria 2062
95 Ga0207711_10000872 3300025941 Bacteria 29118
96 Ga0207689_10060799 3300025942 Bacteria 3107
97 Ga0207689_10425904 3300025942 Bacteria 1108
98 Ga0207679_10015593 3300025945 Bacteria 5027
99 Ga0207651_10022280 3300025960 Bacteria 3870
100 Ga0207651_10212513 3300025960 Bacteria 1558
101 Ga0207668_10153495 3300025972 Bacteria 1786
102 Ga0207658_10000001 3300025986 Bacteria 1439333
103 Ga0207703_10077968 3300026035 Bacteria 2752
104 Ga0207703_10101675 3300026035 Bacteria 2438
105 Ga0207678_10095965 3300026067 Bacteria 2534
106 Ga0207708_10014958 3300026075 Bacteria 5812
107 Ga0207708_10042127 3300026075 Bacteria 3481
108 Ga0207708_10087563 3300026075 Bacteria 2398
109 Ga0207708_10170987 3300026075 Bacteria 1721
110 Ga0207641_10046227 3300026088 Bacteria 3668
111 Ga0207641_10074030 3300026088 Bacteria 2937
112 Ga0207641_10106339 3300026088 Bacteria 2480
113 Ga0207648_10195680 3300026089 Bacteria 1792
114 Ga0207676_10000001 3300026095 Bacteria 1439222
115 Ga0207676_10779750 3300026095 Unclassified 931
116 Ga0207674_10166672 3300026116 Bacteria 2157
117 Ga0207675_100005010 3300026118 Bacteria 12758
118 Ga0207675_100045712 3300026118 Bacteria 4091
119 Ga0207675_100050371 3300026118 Bacteria 3886
120 Ga0207675_100410283 3300026118 Bacteria 1336
121 Ga0207675_100447464 3300026118 Bacteria 1280
122 Ga0207683_10045322 3300026121 Bacteria 3846
123 Ga0268266_10035696 3300028379 Bacteria 4228
124 Ga0268265_10004897 3300028380 Bacteria 9218
125 Ga0268265_10016679 3300028380 Bacteria 5053
126 Ga0268265_10942644 3300028380 Bacteria 850
127 Ga0268264_10000004 3300028381 Bacteria 1116842
128 Ga0307515_10096679 3300028794 Bacteria 3619
129 Ga0307513_10017928 3300031456 Bacteria 8477
130 Ga0307513_10019010 3300031456 Bacteria 8192
131 Ga0307513_10019740 3300031456 Bacteria 8011
132 Ga0307513_10099119 3300031456 Bacteria 2943
133 Ga0307509_10181592 3300031507 Bacteria 1968
134 Ga0307408_100062963 3300031548 Bacteria 2712
135 Ga0307405_10443857 3300031731 Bacteria 1027
136 Ga0307413_10008476 3300031824 Bacteria 4857
137 Ga0307410_10019819 3300031852 Bacteria 4100
138 Ga0307406_10005737 3300031901 Bacteria 6799
139 Ga0307406_10122779 3300031901 Bacteria 1809
140 Ga0307407_10022631 3300031903 Bacteria 3265
141 Ga0307407_10459453 3300031903 Bacteria 926
142 Ga0307409_100012963 3300031995 Bacteria 5340
143 Ga0307409_100047550 3300031995 Bacteria 3257
144 Ga0307416_100123279 3300032002 Bacteria 2316
145 Ga0307414_10105127 3300032004 Bacteria 2134
146 Ga0307414_10678100 3300032004 Bacteria 931
147 Ga0307411_10048095 3300032005 Bacteria 2762
148 Ga0307415_100380579 3300032126 Bacteria 1198
149 Ga0373956_0102941 3300035119 Bacteria 1326
150 Ga0373955_0426528 3300035172 Bacteria 807
151 Ga0373937_0350573 3300036401 Bacteria 1398
152 Ga0395901_0991481 3300038443 Bacteria 817
153 Ga0451791_0267567 3300041451 Bacteria 2010
154 Ga0451807_2290999 3300041486 Bacteria 1211
155 Ga0451837_0567630 3300041494 Bacteria 3858
156 Ga0451843_0839990 3300041509 Bacteria 1872
157 Ga0451577_0102094 3300042876 Bacteria 2562
158 Ga0495603_0082045 3300046455 Bacteria 1889
159 Ga0495603_0304385 3300046455 Bacteria 916
160 Ga0495638_0003825 3300046460 Bacteria 11683
161 Ga0495638_0050908 3300046460 Bacteria 2586
162 Ga0495580_0142012 3300046472 Bacteria 1664
163 Ga0495662_0228268 3300046476 Bacteria 918
164 Ga0495584_0108166 3300046491 Bacteria 1406
165 Ga0495594_0107119 3300046499 Bacteria 1574
166 Ga0495594_0196132 3300046499 Bacteria 1150
167 Ga0495606_0090685 3300046507 Bacteria 1880
168 Ga0495616_0006572 3300046513 Bacteria 7023
169 Ga0495630_0128986 3300046517 Bacteria 1920
170 Ga0495631_0047668 3300046518 Bacteria 1880
171 Ga0495666_0016804 3300046526 Bacteria 3643
172 Ga0495666_0053407 3300046526 Bacteria 1939
173 Ga0495666_0088269 3300046526 Bacteria 1464
174 Ga0495642_0113613 3300046528 Bacteria 1159
175 Ga0495652_0067329 3300046529 Bacteria 3003
176 Ga0495665_0056383 3300046531 Bacteria 2074
177 Ga0495665_0063302 3300046531 Bacteria 1952
178 Ga0495665_0273843 3300046531 Bacteria 866
179 Ga0495640_0242119 3300046533 Bacteria 1132
180 Ga0495586_0037288 3300046535 Bacteria 2610
181 Ga0495587_0047008 3300046536 Bacteria 2559
182 Ga0495597_0000750 3300046542 Bacteria 25631
183 Ga0495622_0052977 3300046557 Bacteria 1882
184 Ga0495633_0109078 3300046558 Bacteria 1283
185 Ga0495667_0161036 3300046559 Bacteria 1443
186 Ga0495668_0017193 3300046616 Bacteria 4200
187 Ga0495668_0109614 3300046616 Bacteria 1510
188 Ga0495668_0200627 3300046616 Bacteria 1092
189 Ga0495634_0218910 3300046642 Bacteria 1176
190 Ga0495625_0010426 3300046660 Bacteria 7691
191 Ga0495625_0030951 3300046660 Bacteria 3986
192 Ga0495625_0053182 3300046660 Bacteria 2898
193 Ga0495661_0059915 3300046665 Bacteria 2263
194 Ga0495588_0023747 3300046674 Bacteria 3038
195 Ga0495588_0024022 3300046674 Bacteria 3024
196 Ga0495588_0053086 3300046674 Bacteria 2089
197 Ga0495646_0118017 3300046680 Bacteria 1504
198 Ga0495613_0077562 3300046689 Bacteria 2417
199 Ga0495649_0002890 3300046694 Bacteria 11907
200 Ga0495600_0077432 3300046809 Bacteria 2171
201 Ga0495581_0039490 3300047315 Bacteria 2732
202 Ga0495604_0104486 3300047317 Bacteria 2075
203 Ga0495604_0174853 3300047317 Bacteria 1506
204 Ga0495674_0004779 3300047319 Bacteria 13028
205 Ga0495676_0063743 3300047321 Bacteria 2871
206 Ga0495680_0087017 3300047322 Bacteria 2351
207 Ga0495683_0092427 3300047323 Bacteria 1464
208 Ga0495675_0165042 3300047444 Bacteria 1362
209 Ga0495614_0066322 3300048089 Bacteria 1553
210 Ga0496114_0373964 3300048917 Bacteria 1261
211 Ga0496114_0415522 3300048917 Bacteria 1191
212 Ga0496115_0005153 3300048918 Bacteria 9510
213 Ga0496115_0180727 3300048918 Bacteria 1744
214 Ga0496115_0506220 3300048918 Bacteria 970
215 Ga0496124_0050202 3300048927 Bacteria 3556
216 Ga0496126_0090389 3300048929 Bacteria 2694
217 Ga0501036_0297093 3300049572 Bacteria 1351
218 Ga0501040_0233390 3300049576 Bacteria 1310
219 Ga0501041_0311382 3300049577 Bacteria 993
220 Ga0501042_0059779 3300049578 Bacteria 2722
221 Ga0501067_0045999 3300049583 Unclassified 2422
222 Ga0501068_0003685 3300049584 Bacteria 8289
223 Ga0501068_0151878 3300049584 Bacteria 1456
224 Ga0501070_0058028 3300049586 Bacteria 3209
225 Ga0501070_0226597 3300049586 Bacteria 1532
226 Ga0501072_0189745 3300049588 Bacteria 1639
227 Ga0501073_0018851 3300049589 Bacteria 4986
228 Ga0501074_0047060 3300049590 Bacteria 3118
229 Ga0501076_0095140 3300049592 Bacteria 2399
230 Ga0501077_0032072 3300049593 Bacteria 3343
231 Ga0501079_0001111 3300049741 Bacteria 18700
232 Ga0501080_0126748 3300049742 Bacteria 2364
233 Ga0501080_0265689 3300049742 Bacteria 1562
234 Ga0501083_0013752 3300049744 Bacteria 5659
235 nmdc:mga08y16_120507_c1 3300050511 Bacteria 2730
236 Ga0501084_0120036 3300054114 Bacteria 2210
237 Ga0501082_0075194 3300060353 Bacteria 2910

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100066807 Ga0070675_1000668074 180
2 3300005438 Ga0070701_10026601 Ga0070701_100266014 180
3 3300005441 Ga0070700_100080437 Ga0070700_1000804373 180
4 3300026075 Ga0207708_10170987 Ga0207708_101709872 180
5 3300026118 Ga0207675_100447464 Ga0207675_1004474643 180
6 3300031456 Ga0307513_10019740 Ga0307513_100197406 180
7 3300035172 Ga0373955_0426528 Ga0373955_0426528_41_667 180
8 3300031456 Ga0307513_10099119 Ga0307513_100991192 185
9 3300046694 Ga0495649_0002890 Ga0495649_0002890_9827_10462 185
10 3300049584 Ga0501068_0151878 Ga0501068_0151878_41_676 185
11 3300013297 Ga0157378_10240381 Ga0157378_102403813 186
12 3300042876 Ga0451577_0102094 Ga0451577_0102094_310_1065 187
13 3300025898 Ga0207692_10318945 Ga0207692_103189451 188
14 3300046455 Ga0495603_0304385 Ga0495603_0304385_10_681 196
15 3300046531 Ga0495665_0273843 Ga0495665_0273843_34_705 196
16 3300046536 Ga0495587_0047008 Ga0495587_0047008_1855_2526 196
17 3300046642 Ga0495634_0218910 Ga0495634_0218910_473_1144 196
18 3300035119 Ga0373956_0102941 Ga0373956_0102941_315_992 197
19 3300036401 Ga0373937_0350573 Ga0373937_0350573_46_723 197
20 3300041451 Ga0451791_0267567 Ga0451791_0267567_1192_1809 198
21 3300046491 Ga0495584_0108166 Ga0495584_0108166_501_1229 203
22 3300046616 Ga0495668_0017193 Ga0495668_0017193_2721_3449 203
23 3300005617 Ga0068859_100124620 Ga0068859_1001246203 204
24 3300006931 Ga0097620_100124615 Ga0097620_1001246153 204
25 3300005353 Ga0070669_100003202 Ga0070669_1000032026 206
26 3300005617 Ga0068859_100068976 Ga0068859_1000689762 206
27 3300005842 Ga0068858_100071315 Ga0068858_1000713152 206
28 3300005844 Ga0068862_100004683 Ga0068862_1000046836 206
29 3300006931 Ga0097620_100068968 Ga0097620_1000689683 206
30 3300009101 Ga0105247_10015922 Ga0105247_100159226 206
31 3300009177 Ga0105248_10021133 Ga0105248_100211335 206
32 3300025923 Ga0207681_10004118 Ga0207681_100041184 206
33 3300025941 Ga0207711_10000872 Ga0207711_1000087224 206
34 3300026035 Ga0207703_10077968 Ga0207703_100779683 206
35 3300028379 Ga0268266_10035696 Ga0268266_100356962 206
36 3300028380 Ga0268265_10004897 Ga0268265_100048973 206
37 3300048929 Ga0496126_0090389 Ga0496126_0090389_806_1579 206
38 3300005441 Ga0070700_100045405 Ga0070700_1000454053 207
39 3300005615 Ga0070702_100264883 Ga0070702_1002648831 207
40 3300005719 Ga0068861_100016305 Ga0068861_1000163053 207
41 3300025923 Ga0207681_10075951 Ga0207681_100759513 207
42 3300025937 Ga0207669_10111945 Ga0207669_101119452 207
43 3300026075 Ga0207708_10042127 Ga0207708_100421273 207
44 3300026089 Ga0207648_10195680 Ga0207648_101956803 207
45 3300026118 Ga0207675_100005010 Ga0207675_1000050109 207
46 3300048918 Ga0496115_0506220 Ga0496115_0506220_241_960 207
47 3300005356 Ga0070674_100644771 Ga0070674_1006447711 208
48 3300017792 Ga0163161_10153702 Ga0163161_101537024 208
49 3300047315 Ga0495581_0039490 Ga0495581_0039490_911_1621 208
50 3300047322 Ga0495680_0087017 Ga0495680_0087017_94_804 208
51 3300047444 Ga0495675_0165042 Ga0495675_0165042_281_991 208
52 3300048918 Ga0496115_0005153 Ga0496115_0005153_7437_8174 208
53 3300005340 Ga0070689_100276912 Ga0070689_1002769122 209
54 3300005354 Ga0070675_100018477 Ga0070675_1000184776 209
55 3300005719 Ga0068861_100505079 Ga0068861_1005050792 209
56 3300005840 Ga0068870_10054950 Ga0068870_100549503 209
57 3300014325 Ga0163163_10243640 Ga0163163_102436403 209
58 3300025893 Ga0207682_10001146 Ga0207682_1000114611 209
59 3300025908 Ga0207643_10012643 Ga0207643_100126433 209
60 3300025926 Ga0207659_10063850 Ga0207659_100638502 209
61 3300025960 Ga0207651_10212513 Ga0207651_102125132 209
62 3300026118 Ga0207675_100410283 Ga0207675_1004102832 209
63 3300031456 Ga0307513_10019010 Ga0307513_100190107 209
64 3300046507 Ga0495606_0090685 Ga0495606_0090685_362_1105 209
65 3300046518 Ga0495631_0047668 Ga0495631_0047668_763_1506 209
66 3300046558 Ga0495633_0109078 Ga0495633_0109078_515_1258 209
67 3300046616 Ga0495668_0109614 Ga0495668_0109614_218_961 209
68 3300046665 Ga0495661_0059915 Ga0495661_0059915_1119_1862 209
69 3300047323 Ga0495683_0092427 Ga0495683_0092427_574_1317 209
70 3300049586 Ga0501070_0226597 Ga0501070_0226597_579_1310 209
71 3300005353 Ga0070669_100187890 Ga0070669_1001878901 210
72 3300005355 Ga0070671_100000033 Ga0070671_10000003378 210
73 3300005441 Ga0070700_100048485 Ga0070700_1000484853 210
74 3300005456 Ga0070678_100317869 Ga0070678_1003178692 210
75 3300005466 Ga0070685_10000002 Ga0070685_10000002245 210
76 3300006237 Ga0097621_100169627 Ga0097621_1001696274 210
77 3300009177 Ga0105248_10376431 Ga0105248_103764312 210
78 3300013308 Ga0157375_10394745 Ga0157375_103947453 210
79 3300013308 Ga0157375_10583993 Ga0157375_105839932 210
80 3300014969 Ga0157376_10104410 Ga0157376_101044102 210
81 3300025931 Ga0207644_10000079 Ga0207644_1000007946 210
82 3300026075 Ga0207708_10014958 Ga0207708_100149585 210
83 3300026121 Ga0207683_10045322 Ga0207683_100453221 210
84 3300028381 Ga0268264_10000004 Ga0268264_10000004880 210
85 3300031507 Ga0307509_10181592 Ga0307509_101815923 210
86 3300046542 Ga0495597_0000750 Ga0495597_0000750_15305_16060 210
87 3300048917 Ga0496114_0373964 Ga0496114_0373964_86_859 210
88 3300048927 Ga0496124_0050202 Ga0496124_0050202_1386_2159 210
89 3300049742 Ga0501080_0265689 Ga0501080_0265689_405_1154 210
90 3300005331 Ga0070670_100000001 Ga0070670_100000001191 211
91 3300005367 Ga0070667_100000096 Ga0070667_10000009672 211
92 3300005618 Ga0068864_100000006 Ga0068864_100000006195 211
93 3300014325 Ga0163163_10000032 Ga0163163_1000003245 211
94 3300025925 Ga0207650_10000002 Ga0207650_10000002870 211
95 3300025986 Ga0207658_10000001 Ga0207658_10000001484 211
96 3300026088 Ga0207641_10046227 Ga0207641_100462274 211
97 3300026095 Ga0207676_10000001 Ga0207676_10000001870 211
98 3300031456 Ga0307513_10017928 Ga0307513_100179285 211
99 3300038443 Ga0395901_0991481 Ga0395901_0991481_25_771 211
100 3300046472 Ga0495580_0142012 Ga0495580_0142012_181_927 211
101 3300046476 Ga0495662_0228268 Ga0495662_0228268_17_754 211
102 3300046499 Ga0495594_0107119 Ga0495594_0107119_643_1380 211
103 3300046499 Ga0495594_0196132 Ga0495594_0196132_28_777 211
104 3300046517 Ga0495630_0128986 Ga0495630_0128986_675_1412 211
105 3300046526 Ga0495666_0016804 Ga0495666_0016804_2389_3126 211
106 3300046526 Ga0495666_0053407 Ga0495666_0053407_1000_1749 211
107 3300046526 Ga0495666_0088269 Ga0495666_0088269_141_887 211
108 3300046528 Ga0495642_0113613 Ga0495642_0113613_113_850 211
109 3300046529 Ga0495652_0067329 Ga0495652_0067329_551_1288 211
110 3300046531 Ga0495665_0056383 Ga0495665_0056383_841_1587 211
111 3300046531 Ga0495665_0063302 Ga0495665_0063302_179_928 211
112 3300046533 Ga0495640_0242119 Ga0495640_0242119_86_832 211
113 3300046535 Ga0495586_0037288 Ga0495586_0037288_850_1599 211
114 3300046557 Ga0495622_0052977 Ga0495622_0052977_709_1446 211
115 3300046559 Ga0495667_0161036 Ga0495667_0161036_119_856 211
116 3300046674 Ga0495588_0023747 Ga0495588_0023747_1607_2356 211
117 3300046674 Ga0495588_0024022 Ga0495588_0024022_427_1164 211
118 3300046674 Ga0495588_0053086 Ga0495588_0053086_1283_2032 211
119 3300046680 Ga0495646_0118017 Ga0495646_0118017_384_1121 211
120 3300046689 Ga0495613_0077562 Ga0495613_0077562_543_1280 211
121 3300046809 Ga0495600_0077432 Ga0495600_0077432_608_1345 211
122 3300047317 Ga0495604_0104486 Ga0495604_0104486_1188_1925 211
123 3300047317 Ga0495604_0174853 Ga0495604_0174853_112_858 211
124 3300047319 Ga0495674_0004779 Ga0495674_0004779_11779_12528 211
125 3300047321 Ga0495676_0063743 Ga0495676_0063743_553_1302 211
126 3300048089 Ga0495614_0066322 Ga0495614_0066322_745_1494 211
127 3300048918 Ga0496115_0180727 Ga0496115_0180727_266_1012 211
128 3300014326 Ga0157380_10462023 Ga0157380_104620232 212
129 3300005334 Ga0068869_100168849 Ga0068869_1001688493 213
130 3300005340 Ga0070689_100006209 Ga0070689_1000062098 213
131 3300005441 Ga0070700_100091150 Ga0070700_1000911504 213
132 3300005441 Ga0070700_100194463 Ga0070700_1001944632 213
133 3300005444 Ga0070694_100043677 Ga0070694_1000436774 213
134 3300005543 Ga0070672_100018533 Ga0070672_1000185334 213
135 3300005546 Ga0070696_100016862 Ga0070696_1000168627 213
136 3300005617 Ga0068859_100089833 Ga0068859_1000898334 213
137 3300005841 Ga0068863_100094614 Ga0068863_1000946145 213
138 3300005842 Ga0068858_100171769 Ga0068858_1001717692 213
139 3300005843 Ga0068860_100114037 Ga0068860_1001140374 213
140 3300006881 Ga0068865_100092322 Ga0068865_1000923223 213
141 3300006931 Ga0097620_100089834 Ga0097620_1000898344 213
142 3300013308 Ga0157375_10030177 Ga0157375_100301774 213
143 3300025936 Ga0207670_10025092 Ga0207670_100250924 213
144 3300025938 Ga0207704_10005201 Ga0207704_100052015 213
145 3300025940 Ga0207691_10012176 Ga0207691_100121766 213
146 3300025942 Ga0207689_10425904 Ga0207689_104259042 213
147 3300025960 Ga0207651_10022280 Ga0207651_100222804 213
148 3300026035 Ga0207703_10101675 Ga0207703_101016754 213
149 3300026075 Ga0207708_10087563 Ga0207708_100875633 213
150 3300026088 Ga0207641_10074030 Ga0207641_100740304 213
151 3300026088 Ga0207641_10106339 Ga0207641_101063392 213
152 3300026118 Ga0207675_100050371 Ga0207675_1000503714 213
153 3300028380 Ga0268265_10016679 Ga0268265_100166794 213
154 3300031548 Ga0307408_100062963 Ga0307408_1000629632 213
155 3300031824 Ga0307413_10008476 Ga0307413_100084766 213
156 3300031852 Ga0307410_10019819 Ga0307410_100198193 213
157 3300031901 Ga0307406_10005737 Ga0307406_100057375 213
158 3300031995 Ga0307409_100047550 Ga0307409_1000475505 213
159 3300032004 Ga0307414_10678100 Ga0307414_106781002 213
160 3300032005 Ga0307411_10048095 Ga0307411_100480953 213
161 3300046455 Ga0495603_0082045 Ga0495603_0082045_466_1194 213
162 3300005455 Ga0070663_100083218 Ga0070663_1000832184 214
163 3300005577 Ga0068857_100056415 Ga0068857_1000564154 214
164 3300009094 Ga0111539_10026261 Ga0111539_100262617 214
165 3300009176 Ga0105242_10786924 Ga0105242_107869242 214
166 3300014325 Ga0163163_11035435 Ga0163163_110354351 214
167 3300014969 Ga0157376_10172830 Ga0157376_101728302 214
168 3300026067 Ga0207678_10095965 Ga0207678_100959654 214
169 3300026116 Ga0207674_10166672 Ga0207674_101666724 214
170 3300028380 Ga0268265_10942644 Ga0268265_109426441 214
171 3300031901 Ga0307406_10122779 Ga0307406_101227792 214
172 3300031903 Ga0307407_10459453 Ga0307407_104594532 214
173 3300032002 Ga0307416_100123279 Ga0307416_1001232793 214
174 3300032126 Ga0307415_100380579 Ga0307415_1003805792 214
175 3300041486 Ga0451807_2290999 Ga0451807_2290999_156_884 214
176 3300046460 Ga0495638_0003825 Ga0495638_0003825_1254_1985 214
177 3300046460 Ga0495638_0050908 Ga0495638_0050908_1562_2317 214
178 3300046513 Ga0495616_0006572 Ga0495616_0006572_2028_2783 214
179 3300046616 Ga0495668_0200627 Ga0495668_0200627_189_917 214
180 3300046660 Ga0495625_0010426 Ga0495625_0010426_5258_5989 214
181 3300046660 Ga0495625_0030951 Ga0495625_0030951_2261_3016 214
182 3300050511 nmdc:mga08y16_120507_c1 nmdc:mga08y16_120507_c1_998_1759 214
183 3300003322 rootL2_10002920 rootL2_100029202 215
184 3300003322 rootL2_10131626 rootL2_101316264 215
185 3300005333 Ga0070677_10101126 Ga0070677_101011262 215
186 3300005334 Ga0068869_100038243 Ga0068869_1000382435 215
187 3300005340 Ga0070689_100055090 Ga0070689_1000550903 215
188 3300005354 Ga0070675_100042395 Ga0070675_1000423953 215
189 3300005543 Ga0070672_100095053 Ga0070672_1000950533 215
190 3300005543 Ga0070672_100522860 Ga0070672_1005228602 215
191 3300005544 Ga0070686_100023033 Ga0070686_1000230334 215
192 3300005547 Ga0070693_100366603 Ga0070693_1003666032 215
193 3300005548 Ga0070665_100002609 Ga0070665_10000260911 215
194 3300005548 Ga0070665_100913429 Ga0070665_1009134292 215
195 3300005618 Ga0068864_100631282 Ga0068864_1006312822 215
196 3300005719 Ga0068861_100548807 Ga0068861_1005488072 215
197 3300006173 Ga0070716_100411517 Ga0070716_1004115172 215
198 3300006237 Ga0097621_100092365 Ga0097621_1000923653 215
199 3300006358 Ga0068871_100003635 Ga0068871_1000036359 215
200 3300014325 Ga0163163_10014556 Ga0163163_100145565 215
201 3300014326 Ga0157380_10006415 Ga0157380_100064157 215
202 3300025893 Ga0207682_10138409 Ga0207682_101384092 215
203 3300025925 Ga0207650_10036009 Ga0207650_100360095 215
204 3300025926 Ga0207659_10065403 Ga0207659_100654033 215
205 3300025937 Ga0207669_10034921 Ga0207669_100349214 215
206 3300025940 Ga0207691_10148523 Ga0207691_101485233 215
207 3300025942 Ga0207689_10060799 Ga0207689_100607992 215
208 3300025945 Ga0207679_10015593 Ga0207679_100155934 215
209 3300025972 Ga0207668_10153495 Ga0207668_101534953 215
210 3300026095 Ga0207676_10779750 Ga0207676_107797502 215
211 3300026118 Ga0207675_100045712 Ga0207675_1000457125 215
212 3300028794 Ga0307515_10096679 Ga0307515_100966794 215
213 3300031731 Ga0307405_10443857 Ga0307405_104438572 215
214 3300031903 Ga0307407_10022631 Ga0307407_100226311 215
215 3300031995 Ga0307409_100012963 Ga0307409_1000129636 215
216 3300032004 Ga0307414_10105127 Ga0307414_101051273 215
217 3300041494 Ga0451837_0567630 Ga0451837_0567630_546_1295 215
218 3300041509 Ga0451843_0839990 Ga0451843_0839990_574_1323 215
219 3300046660 Ga0495625_0053182 Ga0495625_0053182_426_1166 215
220 3300048917 Ga0496114_0415522 Ga0496114_0415522_92_856 215
221 3300049572 Ga0501036_0297093 Ga0501036_0297093_159_914 215
222 3300049576 Ga0501040_0233390 Ga0501040_0233390_182_937 215
223 3300049577 Ga0501041_0311382 Ga0501041_0311382_163_927 215
224 3300049578 Ga0501042_0059779 Ga0501042_0059779_1654_2409 215
225 3300049583 Ga0501067_0045999 Ga0501067_0045999_26_763 215
226 3300049584 Ga0501068_0003685 Ga0501068_0003685_491_1228 215
227 3300049586 Ga0501070_0058028 Ga0501070_0058028_673_1410 215
228 3300049588 Ga0501072_0189745 Ga0501072_0189745_702_1439 215
229 3300049589 Ga0501073_0018851 Ga0501073_0018851_1481_2218 215
230 3300049590 Ga0501074_0047060 Ga0501074_0047060_925_1662 215
231 3300049592 Ga0501076_0095140 Ga0501076_0095140_1470_2207 215
232 3300049593 Ga0501077_0032072 Ga0501077_0032072_464_1201 215
233 3300049741 Ga0501079_0001111 Ga0501079_0001111_16815_17552 215
234 3300049742 Ga0501080_0126748 Ga0501080_0126748_189_926 215
235 3300049744 Ga0501083_0013752 Ga0501083_0013752_3514_4251 215
236 3300054114 Ga0501084_0120036 Ga0501084_0120036_840_1577 215
237 3300060353 Ga0501082_0075194 Ga0501082_0075194_1479_2216 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03591

AzlC

AzlC protein

32

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa6-assembly1.cif.gz_B aristolochene synthase from aspergillus terreus complexed with pyrophosphate 0.3173 49 151
8fed-assembly1.cif.gz_K structure of mce1-lucb complex from mycobacterium smegmatis (map1) 0.311 34 160
7zoy-assembly1.cif.gz_A crystal structure of synechocystis halorhodopsin (syhr), so4-bound form, ground state 0.3102 29 162
3bny-assembly1.cif.gz_D crystal structure of aristolochene synthase complexed with 2-fluorofarnesyl diphosphate (2f-fpp) 0.3026 49 151
5aqd-assembly1.cif.gz_P crystal structure of phormidium phycoerythrin at ph 8.5 0.2896 2 157
ID Description Score Start End Superfamily
af_Q9M007_41_449_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.4234 74 164 1.20.1530.20
af_Q2FVB6_8_378_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.3546 18 181 1.20.1720.10
af_K7MPH0_48_451_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3525 72 154 1.20.1530.20
af_A0A1D6MVG0_125_298_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3504 83 156 1.20.1530.20
af_Q4DN15_2_175_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3393 11 159 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A5C8X9V5-F1-model_v4 deleted 0.8661 11 164
AF-A0A7C5MJI2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8633 7 185 GO:0005886
GO:1903785
AF-C7RR12-F1-model_v4 AzlC family protein 0.8622 7 188 GO:0005886
GO:1903785
AF-A0A7Z9UYT9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8613 10 159 GO:0005886
GO:1903785
AF-A0A7W0LRQ9-F1-model_v4 AzlC family ABC transporter permease 0.861 5 157 GO:0005886
GO:1903785

Feature Viewer

pLDDT pTM Quality
78.76 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map