F350690
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 238 | 181 | 234 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100348813|Ga0070667_1003488132 |
| Length | 212 |
| Sequence | MCQGPCRRDGEPHTMAATASTMLDLGTQAPEFALPDVTSGKAVSLVSFQGKQALLVMFICHHCPFVKHIKSELAQLGRDYAAKGVGIVAISSNDPSVSADDSPEGLQRMAAEWGFHFPVCFDETQAVAKSYAAACTPDFYLFDRDHRLVYRGQLDDSRPSNGKPVTGADLRAAIDALLAGGPVNQDQRPSLGCNIKWKPGNEPAYYATAVKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 3 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 4 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 113 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 118 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 126 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 181 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.32 |
| Metatranscriptomes | 0 |
| Isolates | 1.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.26 |
| Rhizosphere | 93.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2265009 | 2162886007 | Bacteria | 2611 |
| 2 | JGI24752J21851_1028073 | 3300001976 | Bacteria | 740 |
| 3 | JGI24033J26618_1001324 | 3300002155 | Bacteria | 2446 |
| 4 | JGI24751J29686_10002056 | 3300002459 | Bacteria | 4086 |
| 5 | Ga0070658_10089904 | 3300005327 | Bacteria | 2529 |
| 6 | Ga0070670_100342029 | 3300005331 | Bacteria | 1313 |
| 7 | Ga0070666_10255082 | 3300005335 | Bacteria | 1242 |
| 8 | Ga0070680_100103961 | 3300005336 | Bacteria | 2360 |
| 9 | Ga0068868_100011555 | 3300005338 | Bacteria | 6431 |
| 10 | Ga0070661_100039841 | 3300005344 | Bacteria | 3425 |
| 11 | Ga0070675_100033783 | 3300005354 | Bacteria | 4148 |
| 12 | Ga0070671_100023029 | 3300005355 | Bacteria | 5091 |
| 13 | Ga0070659_100059844 | 3300005366 | Bacteria | 3008 |
| 14 | Ga0070667_100348813 | 3300005367 | Unclassified | 1340 |
| 15 | Ga0070714_100007987 | 3300005435 | Bacteria | 8245 |
| 16 | Ga0070713_101190104 | 3300005436 | Bacteria | 738 |
| 17 | Ga0070701_10297307 | 3300005438 | Bacteria | 991 |
| 18 | Ga0070711_100116483 | 3300005439 | Bacteria | 1969 |
| 19 | Ga0070700_100051421 | 3300005441 | Bacteria | 2564 |
| 20 | Ga0070694_100014384 | 3300005444 | Bacteria | 4953 |
| 21 | Ga0070663_100033564 | 3300005455 | Bacteria | 3547 |
| 22 | Ga0070681_10216449 | 3300005458 | Bacteria | 1831 |
| 23 | Ga0070685_10014905 | 3300005466 | Bacteria | 4124 |
| 24 | Ga0070684_100078027 | 3300005535 | Bacteria | 2926 |
| 25 | Ga0070693_100243460 | 3300005547 | Bacteria | 1189 |
| 26 | Ga0070704_100010838 | 3300005549 | Bacteria | 5560 |
| 27 | Ga0068855_100079278 | 3300005563 | Bacteria | 3809 |
| 28 | Ga0070664_100037005 | 3300005564 | Bacteria | 4101 |
| 29 | Ga0068857_100025048 | 3300005577 | Bacteria | 5256 |
| 30 | Ga0068857_100161797 | 3300005577 | Bacteria | 2031 |
| 31 | Ga0068852_100014987 | 3300005616 | Bacteria | 5991 |
| 32 | Ga0068864_100677962 | 3300005618 | Bacteria | 1005 |
| 33 | Ga0068863_100010990 | 3300005841 | Bacteria | 8779 |
| 34 | Ga0068863_100037953 | 3300005841 | Bacteria | 4585 |
| 35 | Ga0068858_100070893 | 3300005842 | Bacteria | 3231 |
| 36 | Ga0068860_101150325 | 3300005843 | Bacteria | 796 |
| 37 | Ga0068862_100137830 | 3300005844 | Bacteria | 2164 |
| 38 | Ga0081455_10004886 | 3300005937 | Bacteria | 14855 |
| 39 | Ga0081455_10013537 | 3300005937 | Bacteria | 8043 |
| 40 | Ga0081455_10171712 | 3300005937 | Bacteria | 1651 |
| 41 | Ga0097621_100059548 | 3300006237 | Bacteria | 3127 |
| 42 | Ga0097621_101146777 | 3300006237 | Bacteria | 731 |
| 43 | Ga0068871_100064134 | 3300006358 | Unclassified | 3007 |
| 44 | Ga0068871_100423414 | 3300006358 | Bacteria | 1189 |
| 45 | Ga0068871_100423960 | 3300006358 | Bacteria | 1188 |
| 46 | Ga0075433_10076391 | 3300006852 | Bacteria | 2949 |
| 47 | Ga0075434_100072229 | 3300006871 | Bacteria | 3443 |
| 48 | Ga0075429_100155467 | 3300006880 | Bacteria | 2003 |
| 49 | Ga0075429_100517249 | 3300006880 | Bacteria | 1046 |
| 50 | Ga0097620_100543094 | 3300006931 | Bacteria | 1257 |
| 51 | Ga0105251_10015205 | 3300009011 | Bacteria | 4217 |
| 52 | Ga0111539_10009915 | 3300009094 | Bacteria | 12017 |
| 53 | Ga0111539_10629849 | 3300009094 | Unclassified | 1249 |
| 54 | Ga0111539_10726016 | 3300009094 | Bacteria | 1156 |
| 55 | Ga0105245_10009483 | 3300009098 | Bacteria | 8490 |
| 56 | Ga0105245_10075821 | 3300009098 | Unclassified | 3063 |
| 57 | Ga0105245_10688065 | 3300009098 | Bacteria | 1055 |
| 58 | Ga0105247_10073455 | 3300009101 | Bacteria | 2143 |
| 59 | Ga0114129_10009702 | 3300009147 | Bacteria | 13736 |
| 60 | Ga0114129_10165071 | 3300009147 | Bacteria | 3023 |
| 61 | Ga0105243_10565544 | 3300009148 | Bacteria | 1089 |
| 62 | Ga0105241_10153245 | 3300009174 | Unclassified | 1887 |
| 63 | Ga0105241_10186768 | 3300009174 | Bacteria | 1723 |
| 64 | Ga0105242_10021041 | 3300009176 | Bacteria | 5117 |
| 65 | Ga0105242_10174973 | 3300009176 | Bacteria | 1889 |
| 66 | Ga0105242_10458178 | 3300009176 | Bacteria | 1204 |
| 67 | Ga0105248_10014076 | 3300009177 | Bacteria | 8803 |
| 68 | Ga0105248_10063385 | 3300009177 | Bacteria | 4149 |
| 69 | Ga0105248_10215536 | 3300009177 | Bacteria | 2162 |
| 70 | Ga0105248_10326264 | 3300009177 | Bacteria | 1729 |
| 71 | Ga0105237_10077281 | 3300009545 | Bacteria | 3319 |
| 72 | Ga0105237_10190203 | 3300009545 | Bacteria | 2053 |
| 73 | Ga0105238_10246213 | 3300009551 | Bacteria | 1765 |
| 74 | Ga0105238_10331329 | 3300009551 | Bacteria | 1509 |
| 75 | Ga0105249_10024458 | 3300009553 | Bacteria | 5428 |
| 76 | Ga0105249_10108926 | 3300009553 | Bacteria | 2616 |
| 77 | Ga0105239_10112920 | 3300010375 | Bacteria | 3013 |
| 78 | Ga0105246_10110374 | 3300011119 | Bacteria | 2020 |
| 79 | Ga0105246_10644028 | 3300011119 | Bacteria | 922 |
| 80 | Ga0157370_10023036 | 3300013104 | Bacteria | 6190 |
| 81 | Ga0157369_10022119 | 3300013105 | Bacteria | 7103 |
| 82 | Ga0157374_11259755 | 3300013296 | Bacteria | 761 |
| 83 | Ga0157378_10243779 | 3300013297 | Bacteria | 1718 |
| 84 | Ga0163162_10283114 | 3300013306 | Bacteria | 1790 |
| 85 | Ga0157372_10118993 | 3300013307 | Bacteria | 3032 |
| 86 | Ga0157372_11233060 | 3300013307 | Bacteria | 864 |
| 87 | Ga0157375_10124605 | 3300013308 | Bacteria | 2690 |
| 88 | Ga0157375_10271831 | 3300013308 | Bacteria | 1857 |
| 89 | Ga0163163_10010508 | 3300014325 | Bacteria | 8329 |
| 90 | Ga0163163_10297482 | 3300014325 | Bacteria | 1666 |
| 91 | Ga0157380_10433923 | 3300014326 | Bacteria | 1257 |
| 92 | Ga0157377_10064003 | 3300014745 | Bacteria | 2108 |
| 93 | Ga0157379_10354800 | 3300014968 | Bacteria | 1343 |
| 94 | Ga0157379_10746672 | 3300014968 | Bacteria | 921 |
| 95 | Ga0157376_10158765 | 3300014969 | Bacteria | 2047 |
| 96 | Ga0182006_1024503 | 3300015261 | Bacteria | 2487 |
| 97 | Ga0163161_10135984 | 3300017792 | Bacteria | 1858 |
| 98 | Ga0213875_10015433 | 3300021388 | Unclassified | 3716 |
| 99 | Ga0213875_10045993 | 3300021388 | Unclassified | 2048 |
| 100 | Ga0213875_10159255 | 3300021388 | Bacteria | 1059 |
| 101 | Ga0207680_10239558 | 3300025903 | Bacteria | 1250 |
| 102 | Ga0207647_10005685 | 3300025904 | Bacteria | 9104 |
| 103 | Ga0207643_10000127 | 3300025908 | Bacteria | 52174 |
| 104 | Ga0207705_10020496 | 3300025909 | Bacteria | 4723 |
| 105 | Ga0207705_10401071 | 3300025909 | Bacteria | 1061 |
| 106 | Ga0207654_10085073 | 3300025911 | Bacteria | 1913 |
| 107 | Ga0207654_10108528 | 3300025911 | Bacteria | 1722 |
| 108 | Ga0207707_10145608 | 3300025912 | Bacteria | 2071 |
| 109 | Ga0207695_10031066 | 3300025913 | Bacteria | 5869 |
| 110 | Ga0207660_10687658 | 3300025917 | Bacteria | 834 |
| 111 | Ga0207657_10008775 | 3300025919 | Bacteria | 10232 |
| 112 | Ga0207694_10664561 | 3300025924 | Bacteria | 878 |
| 113 | Ga0207650_10071552 | 3300025925 | Bacteria | 2609 |
| 114 | Ga0207650_10090471 | 3300025925 | Bacteria | 2337 |
| 115 | Ga0207687_10016699 | 3300025927 | Bacteria | 4825 |
| 116 | Ga0207687_10045589 | 3300025927 | Unclassified | 3031 |
| 117 | Ga0207687_10733446 | 3300025927 | Bacteria | 840 |
| 118 | Ga0207664_10005769 | 3300025929 | Bacteria | 8470 |
| 119 | Ga0207664_10349493 | 3300025929 | Bacteria | 1308 |
| 120 | Ga0207644_10039635 | 3300025931 | Bacteria | 3326 |
| 121 | Ga0207690_10248559 | 3300025932 | Bacteria | 1373 |
| 122 | Ga0207686_10230963 | 3300025934 | Bacteria | 1341 |
| 123 | Ga0207709_10234589 | 3300025935 | Bacteria | 1331 |
| 124 | Ga0207711_10181975 | 3300025941 | Bacteria | 1912 |
| 125 | Ga0207711_10191523 | 3300025941 | Bacteria | 1864 |
| 126 | Ga0207711_10755481 | 3300025941 | Bacteria | 906 |
| 127 | Ga0207679_10231155 | 3300025945 | Bacteria | 1561 |
| 128 | Ga0207667_10027674 | 3300025949 | Bacteria | 6167 |
| 129 | Ga0207712_10176411 | 3300025961 | Bacteria | 1675 |
| 130 | Ga0207658_10048163 | 3300025986 | Bacteria | 3124 |
| 131 | Ga0207703_10067334 | 3300026035 | Unclassified | 2947 |
| 132 | Ga0207678_10043095 | 3300026067 | Bacteria | 3906 |
| 133 | Ga0207702_11108519 | 3300026078 | Bacteria | 785 |
| 134 | Ga0207641_10043842 | 3300026088 | Bacteria | 3759 |
| 135 | Ga0207641_10161994 | 3300026088 | Bacteria | 2034 |
| 136 | Ga0207676_10052559 | 3300026095 | Bacteria | 3185 |
| 137 | Ga0207674_10000174 | 3300026116 | Bacteria | 78300 |
| 138 | Ga0207674_10032781 | 3300026116 | Bacteria | 5446 |
| 139 | Ga0207698_10013978 | 3300026142 | Bacteria | 5318 |
| 140 | Ga0207698_11401883 | 3300026142 | Unclassified | 714 |
| 141 | Ga0207428_10025380 | 3300027907 | Bacteria | 4961 |
| 142 | Ga0268265_10019319 | 3300028380 | Bacteria | 4734 |
| 143 | Ga0265337_1019419 | 3300028556 | Bacteria | 2142 |
| 144 | Ga0265319_1005560 | 3300028563 | Bacteria | 6009 |
| 145 | Ga0265334_10030685 | 3300028573 | Bacteria | 2150 |
| 146 | Ga0265318_10004392 | 3300028577 | Bacteria | 6844 |
| 147 | Ga0265338_10008856 | 3300028800 | Bacteria | 12134 |
| 148 | Ga0265316_10032741 | 3300031344 | Bacteria | 4240 |
| 149 | Ga0316575_10157362 | 3300031665 | Bacteria | 939 |
| 150 | Ga0265314_10023291 | 3300031711 | Bacteria | 4723 |
| 151 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 152 | Ga0307406_10007802 | 3300031901 | Bacteria | 5952 |
| 153 | Ga0373954_0013288 | 3300035118 | Bacteria | 3669 |
| 154 | Ga0316574_0008874 | 3300035398 | Bacteria | 5608 |
| 155 | Ga0373937_0148055 | 3300036401 | Bacteria | 2198 |
| 156 | Ga0373937_0452858 | 3300036401 | Bacteria | 1219 |
| 157 | Ga0395899_0002149 | 3300037312 | Bacteria | 16190 |
| 158 | Ga0395899_0298523 | 3300037312 | Bacteria | 1091 |
| 159 | Ga0395900_0005764 | 3300037418 | Bacteria | 12941 |
| 160 | Ga0395900_0052406 | 3300037418 | Bacteria | 4200 |
| 161 | Ga0395898_0299015 | 3300037466 | Bacteria | 1535 |
| 162 | Ga0395898_0862115 | 3300037466 | Bacteria | 845 |
| 163 | Ga0395905_0019922 | 3300037471 | Bacteria | 6356 |
| 164 | Ga0436364_0924337 | 3300037853 | Bacteria | 54634 |
| 165 | Ga0436364_1080753 | 3300037853 | Bacteria | 1078 |
| 166 | Ga0436364_1454477 | 3300037853 | Bacteria | 2557 |
| 167 | Ga0395901_0001653 | 3300038443 | Bacteria | 23031 |
| 168 | Ga0395901_0054779 | 3300038443 | Bacteria | 4146 |
| 169 | Ga0436363_1460875 | 3300039450 | Bacteria | 772 |
| 170 | Ga0436362_1280649 | 3300039453 | Bacteria | 890 |
| 171 | Ga0451576_0028134 | 3300045051 | Bacteria | 6026 |
| 172 | Ga0451576_0287244 | 3300045051 | Bacteria | 1720 |
| 173 | Ga0495592_0039317 | 3300046454 | Bacteria | 3554 |
| 174 | Ga0495629_0148152 | 3300046459 | Bacteria | 1632 |
| 175 | Ga0495651_0043524 | 3300046462 | Bacteria | 3483 |
| 176 | Ga0495653_0154026 | 3300046463 | Bacteria | 1603 |
| 177 | Ga0495662_0016357 | 3300046476 | Bacteria | 3593 |
| 178 | Ga0495664_0012646 | 3300046477 | Bacteria | 4781 |
| 179 | Ga0495584_0164097 | 3300046491 | Bacteria | 1129 |
| 180 | Ga0495608_0027186 | 3300046511 | Bacteria | 3894 |
| 181 | Ga0495628_0014433 | 3300046516 | Bacteria | 6621 |
| 182 | Ga0495630_0060038 | 3300046517 | Bacteria | 2853 |
| 183 | Ga0495652_0135414 | 3300046529 | Bacteria | 1944 |
| 184 | Ga0495640_0040007 | 3300046533 | Bacteria | 3286 |
| 185 | Ga0495586_0037956 | 3300046535 | Bacteria | 2586 |
| 186 | Ga0495587_0005626 | 3300046536 | Bacteria | 8173 |
| 187 | Ga0495645_0020580 | 3300046543 | Bacteria | 4763 |
| 188 | Ga0495667_0025499 | 3300046559 | Bacteria | 3983 |
| 189 | Ga0495634_0023014 | 3300046642 | Bacteria | 4386 |
| 190 | Ga0495635_0051930 | 3300046663 | Bacteria | 2824 |
| 191 | Ga0495659_0170585 | 3300046664 | Bacteria | 882 |
| 192 | Ga0495657_0156273 | 3300046675 | Bacteria | 1413 |
| 193 | Ga0495599_0009755 | 3300046678 | Bacteria | 5878 |
| 194 | Ga0495623_0157121 | 3300046679 | Bacteria | 1339 |
| 195 | Ga0495646_0141928 | 3300046680 | Bacteria | 1342 |
| 196 | Ga0495613_0023947 | 3300046689 | Bacteria | 4549 |
| 197 | Ga0495604_0188147 | 3300047317 | Bacteria | 1440 |
| 198 | Ga0495636_0287547 | 3300047318 | Bacteria | 767 |
| 199 | Ga0495680_0057299 | 3300047322 | Bacteria | 3014 |
| 200 | Ga0495684_0094787 | 3300047471 | Bacteria | 2259 |
| 201 | Ga0495602_0115655 | 3300048088 | Bacteria | 2169 |
| 202 | Ga0496109_0272322 | 3300048912 | Bacteria | 1595 |
| 203 | Ga0496110_0365488 | 3300048913 | Bacteria | 1315 |
| 204 | Ga0496115_0270125 | 3300048918 | Bacteria | 1397 |
| 205 | Ga0496126_0386141 | 3300048929 | Bacteria | 1139 |
| 206 | Ga0501034_0000191 | 3300049571 | Bacteria | 115607 |
| 207 | Ga0501041_0635548 | 3300049577 | Bacteria | 682 |
| 208 | Ga0501043_0048468 | 3300049579 | Bacteria | 3340 |
| 209 | Ga0501048_0884146 | 3300049582 | Bacteria | 642 |
| 210 | Ga0501070_0184929 | 3300049586 | Bacteria | 1714 |
| 211 | Ga0501072_0813912 | 3300049588 | Bacteria | 731 |
| 212 | Ga0501075_0077581 | 3300049591 | Bacteria | 2514 |
| 213 | Ga0501076_0334725 | 3300049592 | Bacteria | 1242 |
| 214 | Ga0501079_0473449 | 3300049741 | Bacteria | 984 |
| 215 | Ga0501079_0818376 | 3300049741 | Bacteria | 733 |
| 216 | Ga0501079_1154631 | 3300049741 | Bacteria | 610 |
| 217 | Ga0501045_1153475 | 3300049824 | Bacteria | 566 |
| 218 | nmdc:mga05p37_1023338_c1 | 3300050507 | Bacteria | 875 |
| 219 | nmdc:mga05p37_34217_c1 | 3300050507 | Bacteria | 6223 |
| 220 | nmdc:mga09592_390023_c1 | 3300050508 | Bacteria | 1204 |
| 221 | nmdc:mga0qj67_217128_c1 | 3300050509 | Bacteria | 1553 |
| 222 | nmdc:mga08y16_26607_c1 | 3300050511 | Bacteria | 6098 |
| 223 | nmdc:mga0n895_1310231_c1 | 3300050512 | Bacteria | 695 |
| 224 | nmdc:mga0n895_30375_c1 | 3300050512 | Bacteria | 5164 |
| 225 | nmdc:mga0n895_310167_c1 | 3300050512 | Bacteria | 1599 |
| 226 | nmdc:mga0n895_442160_c1 | 3300050512 | Bacteria | 1313 |
| 227 | nmdc:mga0n895_788622_c1 | 3300050512 | Bacteria | 941 |
| 228 | nmdc:mga08x19_689418_c1 | 3300050514 | Bacteria | 725 |
| 229 | nmdc:mga0a205_139616_c1 | 3300050515 | Bacteria | 2324 |
| 230 | nmdc:mga0a205_383922_c1 | 3300050515 | Bacteria | 1270 |
| 231 | Ga0501084_0216575 | 3300054114 | Bacteria | 1616 |
| 232 | Ga0501084_0413645 | 3300054114 | Bacteria | 1140 |
| 233 | Ga0501082_0176096 | 3300060353 | Bacteria | 1860 |
| 234 | Ga0530510_0248385 | 3300061734 | Bacteria | 1326 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006880 | Ga0075429_100517249 | Ga0075429_1005172491 | 161 |
| 2 | 3300009147 | Ga0114129_10165071 | Ga0114129_101650712 | 161 |
| 3 | 3300050507 | nmdc:mga05p37_1023338_c1 | nmdc:mga05p37_1023338_c1_18_629 | 161 |
| 4 | 3300050508 | nmdc:mga09592_390023_c1 | nmdc:mga09592_390023_c1_126_737 | 161 |
| 5 | 3300050512 | nmdc:mga0n895_788622_c1 | nmdc:mga0n895_788622_c1_279_854 | 161 |
| 6 | 3300049579 | Ga0501043_0048468 | Ga0501043_0048468_19_534 | 165 |
| 7 | 3300049571 | Ga0501034_0000191 | Ga0501034_0000191_109947_110507 | 169 |
| 8 | 3300005577 | Ga0068857_100025048 | Ga0068857_1000250482 | 170 |
| 9 | 3300009553 | Ga0105249_10108926 | Ga0105249_101089262 | 170 |
| 10 | 3300025925 | Ga0207650_10090471 | Ga0207650_100904712 | 170 |
| 11 | 3300026116 | Ga0207674_10032781 | Ga0207674_100327812 | 170 |
| 12 | 3300037312 | Ga0395899_0298523 | Ga0395899_0298523_500_1057 | 170 |
| 13 | 3300037418 | Ga0395900_0052406 | Ga0395900_0052406_2530_3087 | 170 |
| 14 | 3300037466 | Ga0395898_0862115 | Ga0395898_0862115_127_684 | 170 |
| 15 | 3300038443 | Ga0395901_0054779 | Ga0395901_0054779_612_1169 | 170 |
| 16 | 3300031665 | Ga0316575_10157362 | Ga0316575_101573621 | 174 |
| 17 | 3300035398 | Ga0316574_0008874 | Ga0316574_0008874_4039_4647 | 174 |
| 18 | 3300005435 | Ga0070714_100007987 | Ga0070714_1000079872 | 175 |
| 19 | 3300005844 | Ga0068862_100137830 | Ga0068862_1001378303 | 175 |
| 20 | 3300006931 | Ga0097620_100543094 | Ga0097620_1005430942 | 175 |
| 21 | 3300013307 | Ga0157372_11233060 | Ga0157372_112330601 | 175 |
| 22 | 3300013308 | Ga0157375_10271831 | Ga0157375_102718312 | 175 |
| 23 | 3300025929 | Ga0207664_10005769 | Ga0207664_100057697 | 175 |
| 24 | 3300049582 | Ga0501048_0884146 | Ga0501048_0884146_84_632 | 175 |
| 25 | 3300049591 | Ga0501075_0077581 | Ga0501075_0077581_14_583 | 175 |
| 26 | 3300049741 | Ga0501079_1154631 | Ga0501079_1154631_44_592 | 175 |
| 27 | 3300054114 | Ga0501084_0413645 | Ga0501084_0413645_328_897 | 175 |
| 28 | 3300060353 | Ga0501082_0176096 | Ga0501082_0176096_532_1101 | 175 |
| 29 | 3300031344 | Ga0265316_10032741 | Ga0265316_100327412 | 176 |
| 30 | 3300031711 | Ga0265314_10023291 | Ga0265314_100232914 | 176 |
| 31 | 3300049588 | Ga0501072_0813912 | Ga0501072_0813912_55_585 | 176 |
| 32 | 3300050512 | nmdc:mga0n895_442160_c1 | nmdc:mga0n895_442160_c1_372_959 | 176 |
| 33 | 3300050514 | nmdc:mga08x19_689418_c1 | nmdc:mga08x19_689418_c1_127_714 | 176 |
| 34 | 2162886007 | SwRhRL2b_contig_2265009 | SwRhRL2b_0930.00008520 | 177 |
| 35 | 3300001976 | JGI24752J21851_1028073 | JGI24752J21851_10280732 | 177 |
| 36 | 3300002155 | JGI24033J26618_1001324 | JGI24033J26618_10013241 | 177 |
| 37 | 3300002459 | JGI24751J29686_10002056 | JGI24751J29686_100020562 | 177 |
| 38 | 3300005327 | Ga0070658_10089904 | Ga0070658_100899042 | 177 |
| 39 | 3300005331 | Ga0070670_100342029 | Ga0070670_1003420292 | 177 |
| 40 | 3300005335 | Ga0070666_10255082 | Ga0070666_102550823 | 177 |
| 41 | 3300005336 | Ga0070680_100103961 | Ga0070680_1001039613 | 177 |
| 42 | 3300005338 | Ga0068868_100011555 | Ga0068868_1000115553 | 177 |
| 43 | 3300005344 | Ga0070661_100039841 | Ga0070661_1000398412 | 177 |
| 44 | 3300005354 | Ga0070675_100033783 | Ga0070675_1000337832 | 177 |
| 45 | 3300005355 | Ga0070671_100023029 | Ga0070671_1000230295 | 177 |
| 46 | 3300005366 | Ga0070659_100059844 | Ga0070659_1000598443 | 177 |
| 47 | 3300005367 | Ga0070667_100348813 | Ga0070667_1003488132 | 177 |
| 48 | 3300005436 | Ga0070713_101190104 | Ga0070713_1011901041 | 177 |
| 49 | 3300005438 | Ga0070701_10297307 | Ga0070701_102973072 | 177 |
| 50 | 3300005439 | Ga0070711_100116483 | Ga0070711_1001164832 | 177 |
| 51 | 3300005441 | Ga0070700_100051421 | Ga0070700_1000514213 | 177 |
| 52 | 3300005444 | Ga0070694_100014384 | Ga0070694_1000143842 | 177 |
| 53 | 3300005455 | Ga0070663_100033564 | Ga0070663_1000335642 | 177 |
| 54 | 3300005458 | Ga0070681_10216449 | Ga0070681_102164492 | 177 |
| 55 | 3300005466 | Ga0070685_10014905 | Ga0070685_100149056 | 177 |
| 56 | 3300005535 | Ga0070684_100078027 | Ga0070684_1000780272 | 177 |
| 57 | 3300005547 | Ga0070693_100243460 | Ga0070693_1002434602 | 177 |
| 58 | 3300005549 | Ga0070704_100010838 | Ga0070704_1000108384 | 177 |
| 59 | 3300005563 | Ga0068855_100079278 | Ga0068855_1000792784 | 177 |
| 60 | 3300005564 | Ga0070664_100037005 | Ga0070664_1000370053 | 177 |
| 61 | 3300005577 | Ga0068857_100161797 | Ga0068857_1001617973 | 177 |
| 62 | 3300005616 | Ga0068852_100014987 | Ga0068852_1000149873 | 177 |
| 63 | 3300005618 | Ga0068864_100677962 | Ga0068864_1006779622 | 177 |
| 64 | 3300005841 | Ga0068863_100010990 | Ga0068863_1000109908 | 177 |
| 65 | 3300005841 | Ga0068863_100037953 | Ga0068863_1000379536 | 177 |
| 66 | 3300005842 | Ga0068858_100070893 | Ga0068858_1000708934 | 177 |
| 67 | 3300005843 | Ga0068860_101150325 | Ga0068860_1011503251 | 177 |
| 68 | 3300005937 | Ga0081455_10004886 | Ga0081455_100048867 | 177 |
| 69 | 3300005937 | Ga0081455_10013537 | Ga0081455_100135374 | 177 |
| 70 | 3300005937 | Ga0081455_10171712 | Ga0081455_101717122 | 177 |
| 71 | 3300006237 | Ga0097621_100059548 | Ga0097621_1000595482 | 177 |
| 72 | 3300006237 | Ga0097621_101146777 | Ga0097621_1011467772 | 177 |
| 73 | 3300006358 | Ga0068871_100064134 | Ga0068871_1000641345 | 177 |
| 74 | 3300006358 | Ga0068871_100423414 | Ga0068871_1004234142 | 177 |
| 75 | 3300006358 | Ga0068871_100423960 | Ga0068871_1004239602 | 177 |
| 76 | 3300006852 | Ga0075433_10076391 | Ga0075433_100763913 | 177 |
| 77 | 3300006871 | Ga0075434_100072229 | Ga0075434_1000722292 | 177 |
| 78 | 3300006880 | Ga0075429_100155467 | Ga0075429_1001554673 | 177 |
| 79 | 3300009011 | Ga0105251_10015205 | Ga0105251_100152052 | 177 |
| 80 | 3300009094 | Ga0111539_10009915 | Ga0111539_1000991514 | 177 |
| 81 | 3300009094 | Ga0111539_10629849 | Ga0111539_106298491 | 177 |
| 82 | 3300009094 | Ga0111539_10726016 | Ga0111539_107260162 | 177 |
| 83 | 3300009098 | Ga0105245_10009483 | Ga0105245_100094837 | 177 |
| 84 | 3300009098 | Ga0105245_10075821 | Ga0105245_100758212 | 177 |
| 85 | 3300009098 | Ga0105245_10688065 | Ga0105245_106880652 | 177 |
| 86 | 3300009101 | Ga0105247_10073455 | Ga0105247_100734552 | 177 |
| 87 | 3300009147 | Ga0114129_10009702 | Ga0114129_100097027 | 177 |
| 88 | 3300009148 | Ga0105243_10565544 | Ga0105243_105655442 | 177 |
| 89 | 3300009174 | Ga0105241_10153245 | Ga0105241_101532451 | 177 |
| 90 | 3300009174 | Ga0105241_10186768 | Ga0105241_101867682 | 177 |
| 91 | 3300009176 | Ga0105242_10021041 | Ga0105242_100210413 | 177 |
| 92 | 3300009176 | Ga0105242_10174973 | Ga0105242_101749733 | 177 |
| 93 | 3300009176 | Ga0105242_10458178 | Ga0105242_104581782 | 177 |
| 94 | 3300009177 | Ga0105248_10014076 | Ga0105248_100140767 | 177 |
| 95 | 3300009177 | Ga0105248_10063385 | Ga0105248_100633854 | 177 |
| 96 | 3300009177 | Ga0105248_10215536 | Ga0105248_102155364 | 177 |
| 97 | 3300009177 | Ga0105248_10326264 | Ga0105248_103262641 | 177 |
| 98 | 3300009545 | Ga0105237_10077281 | Ga0105237_100772811 | 177 |
| 99 | 3300009545 | Ga0105237_10190203 | Ga0105237_101902033 | 177 |
| 100 | 3300009551 | Ga0105238_10246213 | Ga0105238_102462132 | 177 |
| 101 | 3300009551 | Ga0105238_10331329 | Ga0105238_103313291 | 177 |
| 102 | 3300009553 | Ga0105249_10024458 | Ga0105249_100244583 | 177 |
| 103 | 3300010375 | Ga0105239_10112920 | Ga0105239_101129202 | 177 |
| 104 | 3300011119 | Ga0105246_10110374 | Ga0105246_101103742 | 177 |
| 105 | 3300011119 | Ga0105246_10644028 | Ga0105246_106440282 | 177 |
| 106 | 3300013104 | Ga0157370_10023036 | Ga0157370_100230365 | 177 |
| 107 | 3300013105 | Ga0157369_10022119 | Ga0157369_100221198 | 177 |
| 108 | 3300013296 | Ga0157374_11259755 | Ga0157374_112597551 | 177 |
| 109 | 3300013297 | Ga0157378_10243779 | Ga0157378_102437792 | 177 |
| 110 | 3300013306 | Ga0163162_10283114 | Ga0163162_102831142 | 177 |
| 111 | 3300013307 | Ga0157372_10118993 | Ga0157372_101189933 | 177 |
| 112 | 3300013308 | Ga0157375_10124605 | Ga0157375_101246053 | 177 |
| 113 | 3300014325 | Ga0163163_10010508 | Ga0163163_100105084 | 177 |
| 114 | 3300014325 | Ga0163163_10297482 | Ga0163163_102974822 | 177 |
| 115 | 3300014326 | Ga0157380_10433923 | Ga0157380_104339232 | 177 |
| 116 | 3300014745 | Ga0157377_10064003 | Ga0157377_100640032 | 177 |
| 117 | 3300014968 | Ga0157379_10354800 | Ga0157379_103548002 | 177 |
| 118 | 3300014968 | Ga0157379_10746672 | Ga0157379_107466721 | 177 |
| 119 | 3300014969 | Ga0157376_10158765 | Ga0157376_101587654 | 177 |
| 120 | 3300015261 | Ga0182006_1024503 | Ga0182006_10245034 | 177 |
| 121 | 3300017792 | Ga0163161_10135984 | Ga0163161_101359842 | 177 |
| 122 | 3300021388 | Ga0213875_10015433 | Ga0213875_100154333 | 177 |
| 123 | 3300021388 | Ga0213875_10045993 | Ga0213875_100459931 | 177 |
| 124 | 3300021388 | Ga0213875_10159255 | Ga0213875_101592552 | 177 |
| 125 | 3300025903 | Ga0207680_10239558 | Ga0207680_102395583 | 177 |
| 126 | 3300025904 | Ga0207647_10005685 | Ga0207647_100056856 | 177 |
| 127 | 3300025908 | Ga0207643_10000127 | Ga0207643_1000012713 | 177 |
| 128 | 3300025909 | Ga0207705_10020496 | Ga0207705_100204962 | 177 |
| 129 | 3300025909 | Ga0207705_10401071 | Ga0207705_104010711 | 177 |
| 130 | 3300025911 | Ga0207654_10085073 | Ga0207654_100850732 | 177 |
| 131 | 3300025911 | Ga0207654_10108528 | Ga0207654_101085282 | 177 |
| 132 | 3300025912 | Ga0207707_10145608 | Ga0207707_101456082 | 177 |
| 133 | 3300025913 | Ga0207695_10031066 | Ga0207695_100310661 | 177 |
| 134 | 3300025917 | Ga0207660_10687658 | Ga0207660_106876581 | 177 |
| 135 | 3300025919 | Ga0207657_10008775 | Ga0207657_1000877511 | 177 |
| 136 | 3300025924 | Ga0207694_10664561 | Ga0207694_106645611 | 177 |
| 137 | 3300025925 | Ga0207650_10071552 | Ga0207650_100715523 | 177 |
| 138 | 3300025927 | Ga0207687_10016699 | Ga0207687_100166992 | 177 |
| 139 | 3300025927 | Ga0207687_10045589 | Ga0207687_100455894 | 177 |
| 140 | 3300025927 | Ga0207687_10733446 | Ga0207687_107334461 | 177 |
| 141 | 3300025929 | Ga0207664_10349493 | Ga0207664_103494932 | 177 |
| 142 | 3300025931 | Ga0207644_10039635 | Ga0207644_100396353 | 177 |
| 143 | 3300025932 | Ga0207690_10248559 | Ga0207690_102485592 | 177 |
| 144 | 3300025934 | Ga0207686_10230963 | Ga0207686_102309632 | 177 |
| 145 | 3300025935 | Ga0207709_10234589 | Ga0207709_102345892 | 177 |
| 146 | 3300025941 | Ga0207711_10181975 | Ga0207711_101819752 | 177 |
| 147 | 3300025941 | Ga0207711_10191523 | Ga0207711_101915232 | 177 |
| 148 | 3300025941 | Ga0207711_10755481 | Ga0207711_107554811 | 177 |
| 149 | 3300025945 | Ga0207679_10231155 | Ga0207679_102311552 | 177 |
| 150 | 3300025949 | Ga0207667_10027674 | Ga0207667_100276744 | 177 |
| 151 | 3300025961 | Ga0207712_10176411 | Ga0207712_101764113 | 177 |
| 152 | 3300025986 | Ga0207658_10048163 | Ga0207658_100481633 | 177 |
| 153 | 3300026035 | Ga0207703_10067334 | Ga0207703_100673345 | 177 |
| 154 | 3300026067 | Ga0207678_10043095 | Ga0207678_100430952 | 177 |
| 155 | 3300026078 | Ga0207702_11108519 | Ga0207702_111085191 | 177 |
| 156 | 3300026088 | Ga0207641_10043842 | Ga0207641_100438422 | 177 |
| 157 | 3300026088 | Ga0207641_10161994 | Ga0207641_101619942 | 177 |
| 158 | 3300026095 | Ga0207676_10052559 | Ga0207676_100525592 | 177 |
| 159 | 3300026116 | Ga0207674_10000174 | Ga0207674_1000017484 | 177 |
| 160 | 3300026142 | Ga0207698_10013978 | Ga0207698_100139785 | 177 |
| 161 | 3300026142 | Ga0207698_11401883 | Ga0207698_114018831 | 177 |
| 162 | 3300027907 | Ga0207428_10025380 | Ga0207428_100253803 | 177 |
| 163 | 3300028380 | Ga0268265_10019319 | Ga0268265_100193195 | 177 |
| 164 | 3300028556 | Ga0265337_1019419 | Ga0265337_10194192 | 177 |
| 165 | 3300028563 | Ga0265319_1005560 | Ga0265319_10055603 | 177 |
| 166 | 3300028573 | Ga0265334_10030685 | Ga0265334_100306852 | 177 |
| 167 | 3300028577 | Ga0265318_10004392 | Ga0265318_100043922 | 177 |
| 168 | 3300028800 | Ga0265338_10008856 | Ga0265338_100088564 | 177 |
| 169 | 3300031731 | Ga0307405_10000001 | Ga0307405_100000011318 | 177 |
| 170 | 3300031901 | Ga0307406_10007802 | Ga0307406_100078023 | 177 |
| 171 | 3300035118 | Ga0373954_0013288 | Ga0373954_0013288_2136_2693 | 177 |
| 172 | 3300036401 | Ga0373937_0148055 | Ga0373937_0148055_108_689 | 177 |
| 173 | 3300036401 | Ga0373937_0452858 | Ga0373937_0452858_130_735 | 177 |
| 174 | 3300037312 | Ga0395899_0002149 | Ga0395899_0002149_2820_3377 | 177 |
| 175 | 3300037418 | Ga0395900_0005764 | Ga0395900_0005764_9190_9747 | 177 |
| 176 | 3300037466 | Ga0395898_0299015 | Ga0395898_0299015_34_591 | 177 |
| 177 | 3300037471 | Ga0395905_0019922 | Ga0395905_0019922_949_1506 | 177 |
| 178 | 3300037853 | Ga0436364_0924337 | Ga0436364_0924337_50850_51434 | 177 |
| 179 | 3300037853 | Ga0436364_1080753 | Ga0436364_1080753_301_876 | 177 |
| 180 | 3300037853 | Ga0436364_1454477 | Ga0436364_1454477_323_898 | 177 |
| 181 | 3300038443 | Ga0395901_0001653 | Ga0395901_0001653_18436_18993 | 177 |
| 182 | 3300039450 | Ga0436363_1460875 | Ga0436363_1460875_98_679 | 177 |
| 183 | 3300039453 | Ga0436362_1280649 | Ga0436362_1280649_15_620 | 177 |
| 184 | 3300045051 | Ga0451576_0028134 | Ga0451576_0028134_2541_3128 | 177 |
| 185 | 3300045051 | Ga0451576_0287244 | Ga0451576_0287244_976_1533 | 177 |
| 186 | 3300046454 | Ga0495592_0039317 | Ga0495592_0039317_2065_2622 | 177 |
| 187 | 3300046459 | Ga0495629_0148152 | Ga0495629_0148152_696_1253 | 177 |
| 188 | 3300046462 | Ga0495651_0043524 | Ga0495651_0043524_674_1231 | 177 |
| 189 | 3300046463 | Ga0495653_0154026 | Ga0495653_0154026_688_1245 | 177 |
| 190 | 3300046476 | Ga0495662_0016357 | Ga0495662_0016357_571_1128 | 177 |
| 191 | 3300046477 | Ga0495664_0012646 | Ga0495664_0012646_1514_2071 | 177 |
| 192 | 3300046491 | Ga0495584_0164097 | Ga0495584_0164097_113_670 | 177 |
| 193 | 3300046511 | Ga0495608_0027186 | Ga0495608_0027186_829_1386 | 177 |
| 194 | 3300046516 | Ga0495628_0014433 | Ga0495628_0014433_5691_6248 | 177 |
| 195 | 3300046517 | Ga0495630_0060038 | Ga0495630_0060038_1960_2517 | 177 |
| 196 | 3300046529 | Ga0495652_0135414 | Ga0495652_0135414_987_1544 | 177 |
| 197 | 3300046533 | Ga0495640_0040007 | Ga0495640_0040007_1747_2304 | 177 |
| 198 | 3300046535 | Ga0495586_0037956 | Ga0495586_0037956_77_634 | 177 |
| 199 | 3300046536 | Ga0495587_0005626 | Ga0495587_0005626_1364_1921 | 177 |
| 200 | 3300046543 | Ga0495645_0020580 | Ga0495645_0020580_3377_3934 | 177 |
| 201 | 3300046559 | Ga0495667_0025499 | Ga0495667_0025499_2800_3357 | 177 |
| 202 | 3300046642 | Ga0495634_0023014 | Ga0495634_0023014_924_1481 | 177 |
| 203 | 3300046663 | Ga0495635_0051930 | Ga0495635_0051930_2195_2752 | 177 |
| 204 | 3300046664 | Ga0495659_0170585 | Ga0495659_0170585_15_572 | 177 |
| 205 | 3300046675 | Ga0495657_0156273 | Ga0495657_0156273_678_1235 | 177 |
| 206 | 3300046678 | Ga0495599_0009755 | Ga0495599_0009755_949_1506 | 177 |
| 207 | 3300046679 | Ga0495623_0157121 | Ga0495623_0157121_54_629 | 177 |
| 208 | 3300046680 | Ga0495646_0141928 | Ga0495646_0141928_718_1275 | 177 |
| 209 | 3300046689 | Ga0495613_0023947 | Ga0495613_0023947_2658_3215 | 177 |
| 210 | 3300047317 | Ga0495604_0188147 | Ga0495604_0188147_769_1326 | 177 |
| 211 | 3300047318 | Ga0495636_0287547 | Ga0495636_0287547_180_737 | 177 |
| 212 | 3300047322 | Ga0495680_0057299 | Ga0495680_0057299_2319_2876 | 177 |
| 213 | 3300047471 | Ga0495684_0094787 | Ga0495684_0094787_1365_1922 | 177 |
| 214 | 3300048088 | Ga0495602_0115655 | Ga0495602_0115655_538_1113 | 177 |
| 215 | 3300048912 | Ga0496109_0272322 | Ga0496109_0272322_658_1215 | 177 |
| 216 | 3300048913 | Ga0496110_0365488 | Ga0496110_0365488_137_694 | 177 |
| 217 | 3300048918 | Ga0496115_0270125 | Ga0496115_0270125_20_595 | 177 |
| 218 | 3300048929 | Ga0496126_0386141 | Ga0496126_0386141_369_923 | 177 |
| 219 | 3300049577 | Ga0501041_0635548 | Ga0501041_0635548_17_592 | 177 |
| 220 | 3300049586 | Ga0501070_0184929 | Ga0501070_0184929_195_764 | 177 |
| 221 | 3300049592 | Ga0501076_0334725 | Ga0501076_0334725_283_852 | 177 |
| 222 | 3300049741 | Ga0501079_0473449 | Ga0501079_0473449_130_699 | 177 |
| 223 | 3300049741 | Ga0501079_0818376 | Ga0501079_0818376_124_684 | 177 |
| 224 | 3300049824 | Ga0501045_1153475 | Ga0501045_1153475_13_555 | 177 |
| 225 | 3300050507 | nmdc:mga05p37_34217_c1 | nmdc:mga05p37_34217_c1_4263_4838 | 177 |
| 226 | 3300050509 | nmdc:mga0qj67_217128_c1 | nmdc:mga0qj67_217128_c1_33_590 | 177 |
| 227 | 3300050511 | nmdc:mga08y16_26607_c1 | nmdc:mga08y16_26607_c1_58_633 | 177 |
| 228 | 3300050512 | nmdc:mga0n895_1310231_c1 | nmdc:mga0n895_1310231_c1_147_683 | 177 |
| 229 | 3300050512 | nmdc:mga0n895_30375_c1 | nmdc:mga0n895_30375_c1_157_714 | 177 |
| 230 | 3300050512 | nmdc:mga0n895_310167_c1 | nmdc:mga0n895_310167_c1_924_1499 | 177 |
| 231 | 3300050515 | nmdc:mga0a205_139616_c1 | nmdc:mga0a205_139616_c1_985_1560 | 177 |
| 232 | 3300050515 | nmdc:mga0a205_383922_c1 | nmdc:mga0a205_383922_c1_413_970 | 177 |
| 233 | 3300054114 | Ga0501084_0216575 | Ga0501084_0216575_430_999 | 177 |
| 234 | 3300061734 | Ga0530510_0248385 | Ga0530510_0248385_688_1230 | 177 |
| 235 | iso_pu_bacteria | 2617270889 | 2617918883 | 177 |
| 236 | iso_pu_bacteria | 2913844669 | 2913845251 | 177 |
| 237 | iso_pu_bacteria | 2913939268 | 2913944214 | 177 |
| 238 | iso_pu_bacteria | 642555144 | 642601643 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ywi-assembly2.cif.gz_B | crystal structure of uncharacterized conserved protein from geobacillus kaustophilus | 0.9722 | 1 | 177 |
| 3u5r-assembly1.cif.gz_E | crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 | 0.9708 | 1 | 177 |
| 2ywi-assembly2.cif.gz_B | crystal structure of uncharacterized conserved protein from geobacillus kaustophilus | 0.9669 | 1 | 177 |
| 3u5r-assembly1.cif.gz_E | crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 | 0.9601 | 1 | 177 |
| 2cvb-assembly1.cif.gz_A | crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 | 0.9268 | 2 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KAL3_50_244_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9755 | 1 | 177 | 3.40.30.10 |
| af_I1KAL3_50_244_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9701 | 1 | 177 | 3.40.30.10 |
| af_P71990_1_182_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9685 | 1 | 177 | 3.40.30.10 |
| af_P71990_1_182_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9579 | 1 | 177 | 3.40.30.10 |
| 2ywoA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9254 | 2 | 177 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849X3Y7-F1-model_v4 | Thioredoxin family protein | 0.9897 | 1 | 131 |
GO:0016209
GO:0016491 |
| AF-H9VBI5-F1-model_v4 | Thioredoxin domain-containing protein | 0.9888 | 2 | 122 |
GO:0140824
|
| AF-A0A5N6NET3-F1-model_v4 | Thioredoxin domain-containing protein | 0.9871 | 1 | 123 |
GO:0140824
|
| AF-A0A1D1Y953-F1-model_v4 | Peroxiredoxin Q, chloroplastic | 0.9864 | 1 | 123 |
GO:0140824
|
| AF-A0A287H8Q2-F1-model_v4 | deleted | 0.9853 | 1 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar