F350690

General Info

Members Datasets Scaffolds Average Seq Length
238 181 234 191

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100348813|Ga0070667_1003488132
Length 212
Sequence MCQGPCRRDGEPHTMAATASTMLDLGTQAPEFALPDVTSGKAVSLVSFQGKQALLVMFICHHCPFVKHIKSELAQLGRDYAAKGVGIVAISSNDPSVSADDSPEGLQRMAAEWGFHFPVCFDETQAVAKSYAAACTPDFYLFDRDHRLVYRGQLDDSRPSNGKPVTGADLRAAIDALLAGGPVNQDQRPSLGCNIKWKPGNEPAYYATAVKR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
3 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
4 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.26
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2265009 2162886007 Bacteria 2611
2 JGI24752J21851_1028073 3300001976 Bacteria 740
3 JGI24033J26618_1001324 3300002155 Bacteria 2446
4 JGI24751J29686_10002056 3300002459 Bacteria 4086
5 Ga0070658_10089904 3300005327 Bacteria 2529
6 Ga0070670_100342029 3300005331 Bacteria 1313
7 Ga0070666_10255082 3300005335 Bacteria 1242
8 Ga0070680_100103961 3300005336 Bacteria 2360
9 Ga0068868_100011555 3300005338 Bacteria 6431
10 Ga0070661_100039841 3300005344 Bacteria 3425
11 Ga0070675_100033783 3300005354 Bacteria 4148
12 Ga0070671_100023029 3300005355 Bacteria 5091
13 Ga0070659_100059844 3300005366 Bacteria 3008
14 Ga0070667_100348813 3300005367 Unclassified 1340
15 Ga0070714_100007987 3300005435 Bacteria 8245
16 Ga0070713_101190104 3300005436 Bacteria 738
17 Ga0070701_10297307 3300005438 Bacteria 991
18 Ga0070711_100116483 3300005439 Bacteria 1969
19 Ga0070700_100051421 3300005441 Bacteria 2564
20 Ga0070694_100014384 3300005444 Bacteria 4953
21 Ga0070663_100033564 3300005455 Bacteria 3547
22 Ga0070681_10216449 3300005458 Bacteria 1831
23 Ga0070685_10014905 3300005466 Bacteria 4124
24 Ga0070684_100078027 3300005535 Bacteria 2926
25 Ga0070693_100243460 3300005547 Bacteria 1189
26 Ga0070704_100010838 3300005549 Bacteria 5560
27 Ga0068855_100079278 3300005563 Bacteria 3809
28 Ga0070664_100037005 3300005564 Bacteria 4101
29 Ga0068857_100025048 3300005577 Bacteria 5256
30 Ga0068857_100161797 3300005577 Bacteria 2031
31 Ga0068852_100014987 3300005616 Bacteria 5991
32 Ga0068864_100677962 3300005618 Bacteria 1005
33 Ga0068863_100010990 3300005841 Bacteria 8779
34 Ga0068863_100037953 3300005841 Bacteria 4585
35 Ga0068858_100070893 3300005842 Bacteria 3231
36 Ga0068860_101150325 3300005843 Bacteria 796
37 Ga0068862_100137830 3300005844 Bacteria 2164
38 Ga0081455_10004886 3300005937 Bacteria 14855
39 Ga0081455_10013537 3300005937 Bacteria 8043
40 Ga0081455_10171712 3300005937 Bacteria 1651
41 Ga0097621_100059548 3300006237 Bacteria 3127
42 Ga0097621_101146777 3300006237 Bacteria 731
43 Ga0068871_100064134 3300006358 Unclassified 3007
44 Ga0068871_100423414 3300006358 Bacteria 1189
45 Ga0068871_100423960 3300006358 Bacteria 1188
46 Ga0075433_10076391 3300006852 Bacteria 2949
47 Ga0075434_100072229 3300006871 Bacteria 3443
48 Ga0075429_100155467 3300006880 Bacteria 2003
49 Ga0075429_100517249 3300006880 Bacteria 1046
50 Ga0097620_100543094 3300006931 Bacteria 1257
51 Ga0105251_10015205 3300009011 Bacteria 4217
52 Ga0111539_10009915 3300009094 Bacteria 12017
53 Ga0111539_10629849 3300009094 Unclassified 1249
54 Ga0111539_10726016 3300009094 Bacteria 1156
55 Ga0105245_10009483 3300009098 Bacteria 8490
56 Ga0105245_10075821 3300009098 Unclassified 3063
57 Ga0105245_10688065 3300009098 Bacteria 1055
58 Ga0105247_10073455 3300009101 Bacteria 2143
59 Ga0114129_10009702 3300009147 Bacteria 13736
60 Ga0114129_10165071 3300009147 Bacteria 3023
61 Ga0105243_10565544 3300009148 Bacteria 1089
62 Ga0105241_10153245 3300009174 Unclassified 1887
63 Ga0105241_10186768 3300009174 Bacteria 1723
64 Ga0105242_10021041 3300009176 Bacteria 5117
65 Ga0105242_10174973 3300009176 Bacteria 1889
66 Ga0105242_10458178 3300009176 Bacteria 1204
67 Ga0105248_10014076 3300009177 Bacteria 8803
68 Ga0105248_10063385 3300009177 Bacteria 4149
69 Ga0105248_10215536 3300009177 Bacteria 2162
70 Ga0105248_10326264 3300009177 Bacteria 1729
71 Ga0105237_10077281 3300009545 Bacteria 3319
72 Ga0105237_10190203 3300009545 Bacteria 2053
73 Ga0105238_10246213 3300009551 Bacteria 1765
74 Ga0105238_10331329 3300009551 Bacteria 1509
75 Ga0105249_10024458 3300009553 Bacteria 5428
76 Ga0105249_10108926 3300009553 Bacteria 2616
77 Ga0105239_10112920 3300010375 Bacteria 3013
78 Ga0105246_10110374 3300011119 Bacteria 2020
79 Ga0105246_10644028 3300011119 Bacteria 922
80 Ga0157370_10023036 3300013104 Bacteria 6190
81 Ga0157369_10022119 3300013105 Bacteria 7103
82 Ga0157374_11259755 3300013296 Bacteria 761
83 Ga0157378_10243779 3300013297 Bacteria 1718
84 Ga0163162_10283114 3300013306 Bacteria 1790
85 Ga0157372_10118993 3300013307 Bacteria 3032
86 Ga0157372_11233060 3300013307 Bacteria 864
87 Ga0157375_10124605 3300013308 Bacteria 2690
88 Ga0157375_10271831 3300013308 Bacteria 1857
89 Ga0163163_10010508 3300014325 Bacteria 8329
90 Ga0163163_10297482 3300014325 Bacteria 1666
91 Ga0157380_10433923 3300014326 Bacteria 1257
92 Ga0157377_10064003 3300014745 Bacteria 2108
93 Ga0157379_10354800 3300014968 Bacteria 1343
94 Ga0157379_10746672 3300014968 Bacteria 921
95 Ga0157376_10158765 3300014969 Bacteria 2047
96 Ga0182006_1024503 3300015261 Bacteria 2487
97 Ga0163161_10135984 3300017792 Bacteria 1858
98 Ga0213875_10015433 3300021388 Unclassified 3716
99 Ga0213875_10045993 3300021388 Unclassified 2048
100 Ga0213875_10159255 3300021388 Bacteria 1059
101 Ga0207680_10239558 3300025903 Bacteria 1250
102 Ga0207647_10005685 3300025904 Bacteria 9104
103 Ga0207643_10000127 3300025908 Bacteria 52174
104 Ga0207705_10020496 3300025909 Bacteria 4723
105 Ga0207705_10401071 3300025909 Bacteria 1061
106 Ga0207654_10085073 3300025911 Bacteria 1913
107 Ga0207654_10108528 3300025911 Bacteria 1722
108 Ga0207707_10145608 3300025912 Bacteria 2071
109 Ga0207695_10031066 3300025913 Bacteria 5869
110 Ga0207660_10687658 3300025917 Bacteria 834
111 Ga0207657_10008775 3300025919 Bacteria 10232
112 Ga0207694_10664561 3300025924 Bacteria 878
113 Ga0207650_10071552 3300025925 Bacteria 2609
114 Ga0207650_10090471 3300025925 Bacteria 2337
115 Ga0207687_10016699 3300025927 Bacteria 4825
116 Ga0207687_10045589 3300025927 Unclassified 3031
117 Ga0207687_10733446 3300025927 Bacteria 840
118 Ga0207664_10005769 3300025929 Bacteria 8470
119 Ga0207664_10349493 3300025929 Bacteria 1308
120 Ga0207644_10039635 3300025931 Bacteria 3326
121 Ga0207690_10248559 3300025932 Bacteria 1373
122 Ga0207686_10230963 3300025934 Bacteria 1341
123 Ga0207709_10234589 3300025935 Bacteria 1331
124 Ga0207711_10181975 3300025941 Bacteria 1912
125 Ga0207711_10191523 3300025941 Bacteria 1864
126 Ga0207711_10755481 3300025941 Bacteria 906
127 Ga0207679_10231155 3300025945 Bacteria 1561
128 Ga0207667_10027674 3300025949 Bacteria 6167
129 Ga0207712_10176411 3300025961 Bacteria 1675
130 Ga0207658_10048163 3300025986 Bacteria 3124
131 Ga0207703_10067334 3300026035 Unclassified 2947
132 Ga0207678_10043095 3300026067 Bacteria 3906
133 Ga0207702_11108519 3300026078 Bacteria 785
134 Ga0207641_10043842 3300026088 Bacteria 3759
135 Ga0207641_10161994 3300026088 Bacteria 2034
136 Ga0207676_10052559 3300026095 Bacteria 3185
137 Ga0207674_10000174 3300026116 Bacteria 78300
138 Ga0207674_10032781 3300026116 Bacteria 5446
139 Ga0207698_10013978 3300026142 Bacteria 5318
140 Ga0207698_11401883 3300026142 Unclassified 714
141 Ga0207428_10025380 3300027907 Bacteria 4961
142 Ga0268265_10019319 3300028380 Bacteria 4734
143 Ga0265337_1019419 3300028556 Bacteria 2142
144 Ga0265319_1005560 3300028563 Bacteria 6009
145 Ga0265334_10030685 3300028573 Bacteria 2150
146 Ga0265318_10004392 3300028577 Bacteria 6844
147 Ga0265338_10008856 3300028800 Bacteria 12134
148 Ga0265316_10032741 3300031344 Bacteria 4240
149 Ga0316575_10157362 3300031665 Bacteria 939
150 Ga0265314_10023291 3300031711 Bacteria 4723
151 Ga0307405_10000001 3300031731 Bacteria 1731270
152 Ga0307406_10007802 3300031901 Bacteria 5952
153 Ga0373954_0013288 3300035118 Bacteria 3669
154 Ga0316574_0008874 3300035398 Bacteria 5608
155 Ga0373937_0148055 3300036401 Bacteria 2198
156 Ga0373937_0452858 3300036401 Bacteria 1219
157 Ga0395899_0002149 3300037312 Bacteria 16190
158 Ga0395899_0298523 3300037312 Bacteria 1091
159 Ga0395900_0005764 3300037418 Bacteria 12941
160 Ga0395900_0052406 3300037418 Bacteria 4200
161 Ga0395898_0299015 3300037466 Bacteria 1535
162 Ga0395898_0862115 3300037466 Bacteria 845
163 Ga0395905_0019922 3300037471 Bacteria 6356
164 Ga0436364_0924337 3300037853 Bacteria 54634
165 Ga0436364_1080753 3300037853 Bacteria 1078
166 Ga0436364_1454477 3300037853 Bacteria 2557
167 Ga0395901_0001653 3300038443 Bacteria 23031
168 Ga0395901_0054779 3300038443 Bacteria 4146
169 Ga0436363_1460875 3300039450 Bacteria 772
170 Ga0436362_1280649 3300039453 Bacteria 890
171 Ga0451576_0028134 3300045051 Bacteria 6026
172 Ga0451576_0287244 3300045051 Bacteria 1720
173 Ga0495592_0039317 3300046454 Bacteria 3554
174 Ga0495629_0148152 3300046459 Bacteria 1632
175 Ga0495651_0043524 3300046462 Bacteria 3483
176 Ga0495653_0154026 3300046463 Bacteria 1603
177 Ga0495662_0016357 3300046476 Bacteria 3593
178 Ga0495664_0012646 3300046477 Bacteria 4781
179 Ga0495584_0164097 3300046491 Bacteria 1129
180 Ga0495608_0027186 3300046511 Bacteria 3894
181 Ga0495628_0014433 3300046516 Bacteria 6621
182 Ga0495630_0060038 3300046517 Bacteria 2853
183 Ga0495652_0135414 3300046529 Bacteria 1944
184 Ga0495640_0040007 3300046533 Bacteria 3286
185 Ga0495586_0037956 3300046535 Bacteria 2586
186 Ga0495587_0005626 3300046536 Bacteria 8173
187 Ga0495645_0020580 3300046543 Bacteria 4763
188 Ga0495667_0025499 3300046559 Bacteria 3983
189 Ga0495634_0023014 3300046642 Bacteria 4386
190 Ga0495635_0051930 3300046663 Bacteria 2824
191 Ga0495659_0170585 3300046664 Bacteria 882
192 Ga0495657_0156273 3300046675 Bacteria 1413
193 Ga0495599_0009755 3300046678 Bacteria 5878
194 Ga0495623_0157121 3300046679 Bacteria 1339
195 Ga0495646_0141928 3300046680 Bacteria 1342
196 Ga0495613_0023947 3300046689 Bacteria 4549
197 Ga0495604_0188147 3300047317 Bacteria 1440
198 Ga0495636_0287547 3300047318 Bacteria 767
199 Ga0495680_0057299 3300047322 Bacteria 3014
200 Ga0495684_0094787 3300047471 Bacteria 2259
201 Ga0495602_0115655 3300048088 Bacteria 2169
202 Ga0496109_0272322 3300048912 Bacteria 1595
203 Ga0496110_0365488 3300048913 Bacteria 1315
204 Ga0496115_0270125 3300048918 Bacteria 1397
205 Ga0496126_0386141 3300048929 Bacteria 1139
206 Ga0501034_0000191 3300049571 Bacteria 115607
207 Ga0501041_0635548 3300049577 Bacteria 682
208 Ga0501043_0048468 3300049579 Bacteria 3340
209 Ga0501048_0884146 3300049582 Bacteria 642
210 Ga0501070_0184929 3300049586 Bacteria 1714
211 Ga0501072_0813912 3300049588 Bacteria 731
212 Ga0501075_0077581 3300049591 Bacteria 2514
213 Ga0501076_0334725 3300049592 Bacteria 1242
214 Ga0501079_0473449 3300049741 Bacteria 984
215 Ga0501079_0818376 3300049741 Bacteria 733
216 Ga0501079_1154631 3300049741 Bacteria 610
217 Ga0501045_1153475 3300049824 Bacteria 566
218 nmdc:mga05p37_1023338_c1 3300050507 Bacteria 875
219 nmdc:mga05p37_34217_c1 3300050507 Bacteria 6223
220 nmdc:mga09592_390023_c1 3300050508 Bacteria 1204
221 nmdc:mga0qj67_217128_c1 3300050509 Bacteria 1553
222 nmdc:mga08y16_26607_c1 3300050511 Bacteria 6098
223 nmdc:mga0n895_1310231_c1 3300050512 Bacteria 695
224 nmdc:mga0n895_30375_c1 3300050512 Bacteria 5164
225 nmdc:mga0n895_310167_c1 3300050512 Bacteria 1599
226 nmdc:mga0n895_442160_c1 3300050512 Bacteria 1313
227 nmdc:mga0n895_788622_c1 3300050512 Bacteria 941
228 nmdc:mga08x19_689418_c1 3300050514 Bacteria 725
229 nmdc:mga0a205_139616_c1 3300050515 Bacteria 2324
230 nmdc:mga0a205_383922_c1 3300050515 Bacteria 1270
231 Ga0501084_0216575 3300054114 Bacteria 1616
232 Ga0501084_0413645 3300054114 Bacteria 1140
233 Ga0501082_0176096 3300060353 Bacteria 1860
234 Ga0530510_0248385 3300061734 Bacteria 1326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_100517249 Ga0075429_1005172491 161
2 3300009147 Ga0114129_10165071 Ga0114129_101650712 161
3 3300050507 nmdc:mga05p37_1023338_c1 nmdc:mga05p37_1023338_c1_18_629 161
4 3300050508 nmdc:mga09592_390023_c1 nmdc:mga09592_390023_c1_126_737 161
5 3300050512 nmdc:mga0n895_788622_c1 nmdc:mga0n895_788622_c1_279_854 161
6 3300049579 Ga0501043_0048468 Ga0501043_0048468_19_534 165
7 3300049571 Ga0501034_0000191 Ga0501034_0000191_109947_110507 169
8 3300005577 Ga0068857_100025048 Ga0068857_1000250482 170
9 3300009553 Ga0105249_10108926 Ga0105249_101089262 170
10 3300025925 Ga0207650_10090471 Ga0207650_100904712 170
11 3300026116 Ga0207674_10032781 Ga0207674_100327812 170
12 3300037312 Ga0395899_0298523 Ga0395899_0298523_500_1057 170
13 3300037418 Ga0395900_0052406 Ga0395900_0052406_2530_3087 170
14 3300037466 Ga0395898_0862115 Ga0395898_0862115_127_684 170
15 3300038443 Ga0395901_0054779 Ga0395901_0054779_612_1169 170
16 3300031665 Ga0316575_10157362 Ga0316575_101573621 174
17 3300035398 Ga0316574_0008874 Ga0316574_0008874_4039_4647 174
18 3300005435 Ga0070714_100007987 Ga0070714_1000079872 175
19 3300005844 Ga0068862_100137830 Ga0068862_1001378303 175
20 3300006931 Ga0097620_100543094 Ga0097620_1005430942 175
21 3300013307 Ga0157372_11233060 Ga0157372_112330601 175
22 3300013308 Ga0157375_10271831 Ga0157375_102718312 175
23 3300025929 Ga0207664_10005769 Ga0207664_100057697 175
24 3300049582 Ga0501048_0884146 Ga0501048_0884146_84_632 175
25 3300049591 Ga0501075_0077581 Ga0501075_0077581_14_583 175
26 3300049741 Ga0501079_1154631 Ga0501079_1154631_44_592 175
27 3300054114 Ga0501084_0413645 Ga0501084_0413645_328_897 175
28 3300060353 Ga0501082_0176096 Ga0501082_0176096_532_1101 175
29 3300031344 Ga0265316_10032741 Ga0265316_100327412 176
30 3300031711 Ga0265314_10023291 Ga0265314_100232914 176
31 3300049588 Ga0501072_0813912 Ga0501072_0813912_55_585 176
32 3300050512 nmdc:mga0n895_442160_c1 nmdc:mga0n895_442160_c1_372_959 176
33 3300050514 nmdc:mga08x19_689418_c1 nmdc:mga08x19_689418_c1_127_714 176
34 2162886007 SwRhRL2b_contig_2265009 SwRhRL2b_0930.00008520 177
35 3300001976 JGI24752J21851_1028073 JGI24752J21851_10280732 177
36 3300002155 JGI24033J26618_1001324 JGI24033J26618_10013241 177
37 3300002459 JGI24751J29686_10002056 JGI24751J29686_100020562 177
38 3300005327 Ga0070658_10089904 Ga0070658_100899042 177
39 3300005331 Ga0070670_100342029 Ga0070670_1003420292 177
40 3300005335 Ga0070666_10255082 Ga0070666_102550823 177
41 3300005336 Ga0070680_100103961 Ga0070680_1001039613 177
42 3300005338 Ga0068868_100011555 Ga0068868_1000115553 177
43 3300005344 Ga0070661_100039841 Ga0070661_1000398412 177
44 3300005354 Ga0070675_100033783 Ga0070675_1000337832 177
45 3300005355 Ga0070671_100023029 Ga0070671_1000230295 177
46 3300005366 Ga0070659_100059844 Ga0070659_1000598443 177
47 3300005367 Ga0070667_100348813 Ga0070667_1003488132 177
48 3300005436 Ga0070713_101190104 Ga0070713_1011901041 177
49 3300005438 Ga0070701_10297307 Ga0070701_102973072 177
50 3300005439 Ga0070711_100116483 Ga0070711_1001164832 177
51 3300005441 Ga0070700_100051421 Ga0070700_1000514213 177
52 3300005444 Ga0070694_100014384 Ga0070694_1000143842 177
53 3300005455 Ga0070663_100033564 Ga0070663_1000335642 177
54 3300005458 Ga0070681_10216449 Ga0070681_102164492 177
55 3300005466 Ga0070685_10014905 Ga0070685_100149056 177
56 3300005535 Ga0070684_100078027 Ga0070684_1000780272 177
57 3300005547 Ga0070693_100243460 Ga0070693_1002434602 177
58 3300005549 Ga0070704_100010838 Ga0070704_1000108384 177
59 3300005563 Ga0068855_100079278 Ga0068855_1000792784 177
60 3300005564 Ga0070664_100037005 Ga0070664_1000370053 177
61 3300005577 Ga0068857_100161797 Ga0068857_1001617973 177
62 3300005616 Ga0068852_100014987 Ga0068852_1000149873 177
63 3300005618 Ga0068864_100677962 Ga0068864_1006779622 177
64 3300005841 Ga0068863_100010990 Ga0068863_1000109908 177
65 3300005841 Ga0068863_100037953 Ga0068863_1000379536 177
66 3300005842 Ga0068858_100070893 Ga0068858_1000708934 177
67 3300005843 Ga0068860_101150325 Ga0068860_1011503251 177
68 3300005937 Ga0081455_10004886 Ga0081455_100048867 177
69 3300005937 Ga0081455_10013537 Ga0081455_100135374 177
70 3300005937 Ga0081455_10171712 Ga0081455_101717122 177
71 3300006237 Ga0097621_100059548 Ga0097621_1000595482 177
72 3300006237 Ga0097621_101146777 Ga0097621_1011467772 177
73 3300006358 Ga0068871_100064134 Ga0068871_1000641345 177
74 3300006358 Ga0068871_100423414 Ga0068871_1004234142 177
75 3300006358 Ga0068871_100423960 Ga0068871_1004239602 177
76 3300006852 Ga0075433_10076391 Ga0075433_100763913 177
77 3300006871 Ga0075434_100072229 Ga0075434_1000722292 177
78 3300006880 Ga0075429_100155467 Ga0075429_1001554673 177
79 3300009011 Ga0105251_10015205 Ga0105251_100152052 177
80 3300009094 Ga0111539_10009915 Ga0111539_1000991514 177
81 3300009094 Ga0111539_10629849 Ga0111539_106298491 177
82 3300009094 Ga0111539_10726016 Ga0111539_107260162 177
83 3300009098 Ga0105245_10009483 Ga0105245_100094837 177
84 3300009098 Ga0105245_10075821 Ga0105245_100758212 177
85 3300009098 Ga0105245_10688065 Ga0105245_106880652 177
86 3300009101 Ga0105247_10073455 Ga0105247_100734552 177
87 3300009147 Ga0114129_10009702 Ga0114129_100097027 177
88 3300009148 Ga0105243_10565544 Ga0105243_105655442 177
89 3300009174 Ga0105241_10153245 Ga0105241_101532451 177
90 3300009174 Ga0105241_10186768 Ga0105241_101867682 177
91 3300009176 Ga0105242_10021041 Ga0105242_100210413 177
92 3300009176 Ga0105242_10174973 Ga0105242_101749733 177
93 3300009176 Ga0105242_10458178 Ga0105242_104581782 177
94 3300009177 Ga0105248_10014076 Ga0105248_100140767 177
95 3300009177 Ga0105248_10063385 Ga0105248_100633854 177
96 3300009177 Ga0105248_10215536 Ga0105248_102155364 177
97 3300009177 Ga0105248_10326264 Ga0105248_103262641 177
98 3300009545 Ga0105237_10077281 Ga0105237_100772811 177
99 3300009545 Ga0105237_10190203 Ga0105237_101902033 177
100 3300009551 Ga0105238_10246213 Ga0105238_102462132 177
101 3300009551 Ga0105238_10331329 Ga0105238_103313291 177
102 3300009553 Ga0105249_10024458 Ga0105249_100244583 177
103 3300010375 Ga0105239_10112920 Ga0105239_101129202 177
104 3300011119 Ga0105246_10110374 Ga0105246_101103742 177
105 3300011119 Ga0105246_10644028 Ga0105246_106440282 177
106 3300013104 Ga0157370_10023036 Ga0157370_100230365 177
107 3300013105 Ga0157369_10022119 Ga0157369_100221198 177
108 3300013296 Ga0157374_11259755 Ga0157374_112597551 177
109 3300013297 Ga0157378_10243779 Ga0157378_102437792 177
110 3300013306 Ga0163162_10283114 Ga0163162_102831142 177
111 3300013307 Ga0157372_10118993 Ga0157372_101189933 177
112 3300013308 Ga0157375_10124605 Ga0157375_101246053 177
113 3300014325 Ga0163163_10010508 Ga0163163_100105084 177
114 3300014325 Ga0163163_10297482 Ga0163163_102974822 177
115 3300014326 Ga0157380_10433923 Ga0157380_104339232 177
116 3300014745 Ga0157377_10064003 Ga0157377_100640032 177
117 3300014968 Ga0157379_10354800 Ga0157379_103548002 177
118 3300014968 Ga0157379_10746672 Ga0157379_107466721 177
119 3300014969 Ga0157376_10158765 Ga0157376_101587654 177
120 3300015261 Ga0182006_1024503 Ga0182006_10245034 177
121 3300017792 Ga0163161_10135984 Ga0163161_101359842 177
122 3300021388 Ga0213875_10015433 Ga0213875_100154333 177
123 3300021388 Ga0213875_10045993 Ga0213875_100459931 177
124 3300021388 Ga0213875_10159255 Ga0213875_101592552 177
125 3300025903 Ga0207680_10239558 Ga0207680_102395583 177
126 3300025904 Ga0207647_10005685 Ga0207647_100056856 177
127 3300025908 Ga0207643_10000127 Ga0207643_1000012713 177
128 3300025909 Ga0207705_10020496 Ga0207705_100204962 177
129 3300025909 Ga0207705_10401071 Ga0207705_104010711 177
130 3300025911 Ga0207654_10085073 Ga0207654_100850732 177
131 3300025911 Ga0207654_10108528 Ga0207654_101085282 177
132 3300025912 Ga0207707_10145608 Ga0207707_101456082 177
133 3300025913 Ga0207695_10031066 Ga0207695_100310661 177
134 3300025917 Ga0207660_10687658 Ga0207660_106876581 177
135 3300025919 Ga0207657_10008775 Ga0207657_1000877511 177
136 3300025924 Ga0207694_10664561 Ga0207694_106645611 177
137 3300025925 Ga0207650_10071552 Ga0207650_100715523 177
138 3300025927 Ga0207687_10016699 Ga0207687_100166992 177
139 3300025927 Ga0207687_10045589 Ga0207687_100455894 177
140 3300025927 Ga0207687_10733446 Ga0207687_107334461 177
141 3300025929 Ga0207664_10349493 Ga0207664_103494932 177
142 3300025931 Ga0207644_10039635 Ga0207644_100396353 177
143 3300025932 Ga0207690_10248559 Ga0207690_102485592 177
144 3300025934 Ga0207686_10230963 Ga0207686_102309632 177
145 3300025935 Ga0207709_10234589 Ga0207709_102345892 177
146 3300025941 Ga0207711_10181975 Ga0207711_101819752 177
147 3300025941 Ga0207711_10191523 Ga0207711_101915232 177
148 3300025941 Ga0207711_10755481 Ga0207711_107554811 177
149 3300025945 Ga0207679_10231155 Ga0207679_102311552 177
150 3300025949 Ga0207667_10027674 Ga0207667_100276744 177
151 3300025961 Ga0207712_10176411 Ga0207712_101764113 177
152 3300025986 Ga0207658_10048163 Ga0207658_100481633 177
153 3300026035 Ga0207703_10067334 Ga0207703_100673345 177
154 3300026067 Ga0207678_10043095 Ga0207678_100430952 177
155 3300026078 Ga0207702_11108519 Ga0207702_111085191 177
156 3300026088 Ga0207641_10043842 Ga0207641_100438422 177
157 3300026088 Ga0207641_10161994 Ga0207641_101619942 177
158 3300026095 Ga0207676_10052559 Ga0207676_100525592 177
159 3300026116 Ga0207674_10000174 Ga0207674_1000017484 177
160 3300026142 Ga0207698_10013978 Ga0207698_100139785 177
161 3300026142 Ga0207698_11401883 Ga0207698_114018831 177
162 3300027907 Ga0207428_10025380 Ga0207428_100253803 177
163 3300028380 Ga0268265_10019319 Ga0268265_100193195 177
164 3300028556 Ga0265337_1019419 Ga0265337_10194192 177
165 3300028563 Ga0265319_1005560 Ga0265319_10055603 177
166 3300028573 Ga0265334_10030685 Ga0265334_100306852 177
167 3300028577 Ga0265318_10004392 Ga0265318_100043922 177
168 3300028800 Ga0265338_10008856 Ga0265338_100088564 177
169 3300031731 Ga0307405_10000001 Ga0307405_100000011318 177
170 3300031901 Ga0307406_10007802 Ga0307406_100078023 177
171 3300035118 Ga0373954_0013288 Ga0373954_0013288_2136_2693 177
172 3300036401 Ga0373937_0148055 Ga0373937_0148055_108_689 177
173 3300036401 Ga0373937_0452858 Ga0373937_0452858_130_735 177
174 3300037312 Ga0395899_0002149 Ga0395899_0002149_2820_3377 177
175 3300037418 Ga0395900_0005764 Ga0395900_0005764_9190_9747 177
176 3300037466 Ga0395898_0299015 Ga0395898_0299015_34_591 177
177 3300037471 Ga0395905_0019922 Ga0395905_0019922_949_1506 177
178 3300037853 Ga0436364_0924337 Ga0436364_0924337_50850_51434 177
179 3300037853 Ga0436364_1080753 Ga0436364_1080753_301_876 177
180 3300037853 Ga0436364_1454477 Ga0436364_1454477_323_898 177
181 3300038443 Ga0395901_0001653 Ga0395901_0001653_18436_18993 177
182 3300039450 Ga0436363_1460875 Ga0436363_1460875_98_679 177
183 3300039453 Ga0436362_1280649 Ga0436362_1280649_15_620 177
184 3300045051 Ga0451576_0028134 Ga0451576_0028134_2541_3128 177
185 3300045051 Ga0451576_0287244 Ga0451576_0287244_976_1533 177
186 3300046454 Ga0495592_0039317 Ga0495592_0039317_2065_2622 177
187 3300046459 Ga0495629_0148152 Ga0495629_0148152_696_1253 177
188 3300046462 Ga0495651_0043524 Ga0495651_0043524_674_1231 177
189 3300046463 Ga0495653_0154026 Ga0495653_0154026_688_1245 177
190 3300046476 Ga0495662_0016357 Ga0495662_0016357_571_1128 177
191 3300046477 Ga0495664_0012646 Ga0495664_0012646_1514_2071 177
192 3300046491 Ga0495584_0164097 Ga0495584_0164097_113_670 177
193 3300046511 Ga0495608_0027186 Ga0495608_0027186_829_1386 177
194 3300046516 Ga0495628_0014433 Ga0495628_0014433_5691_6248 177
195 3300046517 Ga0495630_0060038 Ga0495630_0060038_1960_2517 177
196 3300046529 Ga0495652_0135414 Ga0495652_0135414_987_1544 177
197 3300046533 Ga0495640_0040007 Ga0495640_0040007_1747_2304 177
198 3300046535 Ga0495586_0037956 Ga0495586_0037956_77_634 177
199 3300046536 Ga0495587_0005626 Ga0495587_0005626_1364_1921 177
200 3300046543 Ga0495645_0020580 Ga0495645_0020580_3377_3934 177
201 3300046559 Ga0495667_0025499 Ga0495667_0025499_2800_3357 177
202 3300046642 Ga0495634_0023014 Ga0495634_0023014_924_1481 177
203 3300046663 Ga0495635_0051930 Ga0495635_0051930_2195_2752 177
204 3300046664 Ga0495659_0170585 Ga0495659_0170585_15_572 177
205 3300046675 Ga0495657_0156273 Ga0495657_0156273_678_1235 177
206 3300046678 Ga0495599_0009755 Ga0495599_0009755_949_1506 177
207 3300046679 Ga0495623_0157121 Ga0495623_0157121_54_629 177
208 3300046680 Ga0495646_0141928 Ga0495646_0141928_718_1275 177
209 3300046689 Ga0495613_0023947 Ga0495613_0023947_2658_3215 177
210 3300047317 Ga0495604_0188147 Ga0495604_0188147_769_1326 177
211 3300047318 Ga0495636_0287547 Ga0495636_0287547_180_737 177
212 3300047322 Ga0495680_0057299 Ga0495680_0057299_2319_2876 177
213 3300047471 Ga0495684_0094787 Ga0495684_0094787_1365_1922 177
214 3300048088 Ga0495602_0115655 Ga0495602_0115655_538_1113 177
215 3300048912 Ga0496109_0272322 Ga0496109_0272322_658_1215 177
216 3300048913 Ga0496110_0365488 Ga0496110_0365488_137_694 177
217 3300048918 Ga0496115_0270125 Ga0496115_0270125_20_595 177
218 3300048929 Ga0496126_0386141 Ga0496126_0386141_369_923 177
219 3300049577 Ga0501041_0635548 Ga0501041_0635548_17_592 177
220 3300049586 Ga0501070_0184929 Ga0501070_0184929_195_764 177
221 3300049592 Ga0501076_0334725 Ga0501076_0334725_283_852 177
222 3300049741 Ga0501079_0473449 Ga0501079_0473449_130_699 177
223 3300049741 Ga0501079_0818376 Ga0501079_0818376_124_684 177
224 3300049824 Ga0501045_1153475 Ga0501045_1153475_13_555 177
225 3300050507 nmdc:mga05p37_34217_c1 nmdc:mga05p37_34217_c1_4263_4838 177
226 3300050509 nmdc:mga0qj67_217128_c1 nmdc:mga0qj67_217128_c1_33_590 177
227 3300050511 nmdc:mga08y16_26607_c1 nmdc:mga08y16_26607_c1_58_633 177
228 3300050512 nmdc:mga0n895_1310231_c1 nmdc:mga0n895_1310231_c1_147_683 177
229 3300050512 nmdc:mga0n895_30375_c1 nmdc:mga0n895_30375_c1_157_714 177
230 3300050512 nmdc:mga0n895_310167_c1 nmdc:mga0n895_310167_c1_924_1499 177
231 3300050515 nmdc:mga0a205_139616_c1 nmdc:mga0a205_139616_c1_985_1560 177
232 3300050515 nmdc:mga0a205_383922_c1 nmdc:mga0a205_383922_c1_413_970 177
233 3300054114 Ga0501084_0216575 Ga0501084_0216575_430_999 177
234 3300061734 Ga0530510_0248385 Ga0530510_0248385_688_1230 177
235 iso_pu_bacteria 2617270889 2617918883 177
236 iso_pu_bacteria 2913844669 2913845251 177
237 iso_pu_bacteria 2913939268 2913944214 177
238 iso_pu_bacteria 642555144 642601643 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

25

151

0.9

PF08534

Redoxin

Redoxin

24

170

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9722 1 177
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9708 1 177
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9669 1 177
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9601 1 177
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.9268 2 177
ID Description Score Start End Superfamily
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9755 1 177 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9701 1 177 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9685 1 177 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9579 1 177 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9254 2 177 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A849X3Y7-F1-model_v4 Thioredoxin family protein 0.9897 1 131 GO:0016209
GO:0016491
AF-H9VBI5-F1-model_v4 Thioredoxin domain-containing protein 0.9888 2 122 GO:0140824
AF-A0A5N6NET3-F1-model_v4 Thioredoxin domain-containing protein 0.9871 1 123 GO:0140824
AF-A0A1D1Y953-F1-model_v4 Peroxiredoxin Q, chloroplastic 0.9864 1 123 GO:0140824
AF-A0A287H8Q2-F1-model_v4 deleted 0.9853 1 122

Feature Viewer

pLDDT pTM Quality
92.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map