F351005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 238 | 143 | 238 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10587852|Ga0207705_105878522 |
| Length | 137 |
| Sequence | MDKTEKLIDWEENEREDRNRNGLSDDIEPPEVDIATGSAKLAQRLREGGGSVDPSLSAGDVDASWEMAESQGDEAAGGSTPTPGQNNVQEIGEAIGVTYQDNEELRAGEKERDRDKKRWELDPASSDDYQERLRDET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 124 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 127 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 128 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.42 |
| Rhizosphere | 94.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11139425 | 3300004798 | Bacteria | 512 |
| 2 | Ga0065715_10178298 | 3300005293 | Bacteria | 1485 |
| 3 | Ga0065707_10207026 | 3300005295 | Bacteria | 1283 |
| 4 | Ga0065707_10288916 | 3300005295 | Bacteria | 1027 |
| 5 | Ga0070658_10266353 | 3300005327 | Bacteria | 1456 |
| 6 | Ga0070676_10141149 | 3300005328 | Bacteria | 1534 |
| 7 | Ga0070683_100000009 | 3300005329 | Bacteria | 319830 |
| 8 | Ga0070683_100141659 | 3300005329 | Bacteria | 2278 |
| 9 | Ga0070690_101191466 | 3300005330 | Bacteria | 607 |
| 10 | Ga0070670_100000131 | 3300005331 | Bacteria | 70778 |
| 11 | Ga0070670_100494969 | 3300005331 | Bacteria | 1086 |
| 12 | Ga0068869_100005907 | 3300005334 | Bacteria | 7731 |
| 13 | Ga0068869_100313323 | 3300005334 | Bacteria | 1271 |
| 14 | Ga0068869_100540120 | 3300005334 | Bacteria | 978 |
| 15 | Ga0070680_100149565 | 3300005336 | Bacteria | 1960 |
| 16 | Ga0070682_100062162 | 3300005337 | Bacteria | 2365 |
| 17 | Ga0068868_100001221 | 3300005338 | Bacteria | 17666 |
| 18 | Ga0068868_100001770 | 3300005338 | Bacteria | 14782 |
| 19 | Ga0070689_100111021 | 3300005340 | Bacteria | 2181 |
| 20 | Ga0070689_100595540 | 3300005340 | Bacteria | 957 |
| 21 | Ga0070689_101067824 | 3300005340 | Bacteria | 721 |
| 22 | Ga0070691_10385546 | 3300005341 | Unclassified | 786 |
| 23 | Ga0070687_100292103 | 3300005343 | Bacteria | 1031 |
| 24 | Ga0070687_100300072 | 3300005343 | Bacteria | 1019 |
| 25 | Ga0070687_100647055 | 3300005343 | Bacteria | 732 |
| 26 | Ga0070661_100310726 | 3300005344 | Bacteria | 1229 |
| 27 | Ga0070661_101566152 | 3300005344 | Unclassified | 557 |
| 28 | Ga0070692_10049112 | 3300005345 | Bacteria | 2188 |
| 29 | Ga0070675_100000002 | 3300005354 | Bacteria | 435215 |
| 30 | Ga0070675_100521523 | 3300005354 | Bacteria | 1072 |
| 31 | Ga0070674_100657808 | 3300005356 | Bacteria | 891 |
| 32 | Ga0070673_100372800 | 3300005364 | Bacteria | 1271 |
| 33 | Ga0070673_100410638 | 3300005364 | Bacteria | 1212 |
| 34 | Ga0070659_100676984 | 3300005366 | Bacteria | 891 |
| 35 | Ga0070709_10341550 | 3300005434 | Bacteria | 1104 |
| 36 | Ga0070713_100098313 | 3300005436 | Bacteria | 2531 |
| 37 | Ga0070710_10237687 | 3300005437 | Bacteria | 1166 |
| 38 | Ga0070710_10387213 | 3300005437 | Bacteria | 934 |
| 39 | Ga0070701_10709634 | 3300005438 | Bacteria | 677 |
| 40 | Ga0070705_100116062 | 3300005440 | Bacteria | 1720 |
| 41 | Ga0070700_100000030 | 3300005441 | Bacteria | 118205 |
| 42 | Ga0070708_100189043 | 3300005445 | Bacteria | 1926 |
| 43 | Ga0070708_101573044 | 3300005445 | Unclassified | 612 |
| 44 | Ga0070678_100599744 | 3300005456 | Bacteria | 983 |
| 45 | Ga0070662_101662489 | 3300005457 | Unclassified | 551 |
| 46 | Ga0068867_100054551 | 3300005459 | Bacteria | 2953 |
| 47 | Ga0070706_100068300 | 3300005467 | Bacteria | 3286 |
| 48 | Ga0070706_100099306 | 3300005467 | Bacteria | 2705 |
| 49 | Ga0070706_100099444 | 3300005467 | Bacteria | 2703 |
| 50 | Ga0070706_101321499 | 3300005467 | Unclassified | 661 |
| 51 | Ga0070707_100003590 | 3300005468 | Bacteria | 14633 |
| 52 | Ga0070707_100133444 | 3300005468 | Bacteria | 2415 |
| 53 | Ga0070707_100604704 | 3300005468 | Unclassified | 1059 |
| 54 | Ga0070698_100616573 | 3300005471 | Bacteria | 1026 |
| 55 | Ga0070698_100955953 | 3300005471 | Bacteria | 803 |
| 56 | Ga0070698_101207886 | 3300005471 | Unclassified | 705 |
| 57 | Ga0070698_101207888 | 3300005471 | Unclassified | 705 |
| 58 | Ga0070699_100016505 | 3300005518 | Bacteria | 6340 |
| 59 | Ga0070699_100334393 | 3300005518 | Bacteria | 1363 |
| 60 | Ga0070699_100482399 | 3300005518 | Unclassified | 1125 |
| 61 | Ga0070684_100000074 | 3300005535 | Bacteria | 64492 |
| 62 | Ga0070684_100013707 | 3300005535 | Bacteria | 6542 |
| 63 | Ga0070697_100144909 | 3300005536 | Bacteria | 1999 |
| 64 | Ga0070697_100376211 | 3300005536 | Bacteria | 1230 |
| 65 | Ga0068853_100112083 | 3300005539 | Bacteria | 2424 |
| 66 | Ga0068853_100512985 | 3300005539 | Bacteria | 1133 |
| 67 | Ga0070672_100000113 | 3300005543 | Bacteria | 40820 |
| 68 | Ga0070686_100118706 | 3300005544 | Bacteria | 1813 |
| 69 | Ga0070686_100749582 | 3300005544 | Bacteria | 783 |
| 70 | Ga0070696_101325364 | 3300005546 | Unclassified | 612 |
| 71 | Ga0070693_100140100 | 3300005547 | Bacteria | 1521 |
| 72 | Ga0068857_100847028 | 3300005577 | Bacteria | 875 |
| 73 | Ga0068857_101288742 | 3300005577 | Bacteria | 709 |
| 74 | Ga0068854_100074602 | 3300005578 | Bacteria | 2488 |
| 75 | Ga0068854_100114771 | 3300005578 | Bacteria | 2037 |
| 76 | Ga0070702_100108859 | 3300005615 | Bacteria | 1714 |
| 77 | Ga0070702_100303209 | 3300005615 | Bacteria | 1106 |
| 78 | Ga0070702_100373171 | 3300005615 | Bacteria | 1012 |
| 79 | Ga0070702_100452384 | 3300005615 | Unclassified | 932 |
| 80 | Ga0070702_101720348 | 3300005615 | Unclassified | 522 |
| 81 | Ga0068852_100925741 | 3300005616 | Bacteria | 889 |
| 82 | Ga0068859_101577829 | 3300005617 | Bacteria | 725 |
| 83 | Ga0068861_100146957 | 3300005719 | Bacteria | 1930 |
| 84 | Ga0068870_10013915 | 3300005840 | Bacteria | 3790 |
| 85 | Ga0068858_100001900 | 3300005842 | Bacteria | 21314 |
| 86 | Ga0068858_102032687 | 3300005842 | Unclassified | 568 |
| 87 | Ga0070717_10000050 | 3300006028 | Bacteria | 103137 |
| 88 | Ga0070717_10290502 | 3300006028 | Bacteria | 1452 |
| 89 | Ga0070715_10654258 | 3300006163 | Unclassified | 622 |
| 90 | Ga0070716_100268625 | 3300006173 | Bacteria | 1171 |
| 91 | Ga0070716_100402352 | 3300006173 | Bacteria | 985 |
| 92 | Ga0097621_100468032 | 3300006237 | Bacteria | 1138 |
| 93 | Ga0068871_100181596 | 3300006358 | Bacteria | 1808 |
| 94 | Ga0068871_100744526 | 3300006358 | Bacteria | 900 |
| 95 | Ga0075428_100007626 | 3300006844 | Bacteria | 11996 |
| 96 | Ga0075428_100218201 | 3300006844 | Bacteria | 2060 |
| 97 | Ga0075431_100205645 | 3300006847 | Bacteria | 2013 |
| 98 | Ga0075433_10655566 | 3300006852 | Bacteria | 920 |
| 99 | Ga0075434_100557272 | 3300006871 | Bacteria | 1166 |
| 100 | Ga0075434_100958802 | 3300006871 | Bacteria | 870 |
| 101 | Ga0075434_101529841 | 3300006871 | Unclassified | 676 |
| 102 | Ga0075434_101980880 | 3300006871 | Bacteria | 588 |
| 103 | Ga0075429_100643344 | 3300006880 | Unclassified | 929 |
| 104 | Ga0075429_100973562 | 3300006880 | Bacteria | 742 |
| 105 | Ga0068865_100479834 | 3300006881 | Bacteria | 1033 |
| 106 | Ga0075436_100018227 | 3300006914 | Bacteria | 4808 |
| 107 | Ga0075436_100508444 | 3300006914 | Unclassified | 882 |
| 108 | Ga0097620_101577762 | 3300006931 | Bacteria | 725 |
| 109 | Ga0075435_100001991 | 3300007076 | Bacteria | 13356 |
| 110 | Ga0075435_100160724 | 3300007076 | Bacteria | 1892 |
| 111 | Ga0075435_100244286 | 3300007076 | Bacteria | 1527 |
| 112 | Ga0075435_101323933 | 3300007076 | Bacteria | 631 |
| 113 | Ga0105244_10025148 | 3300009036 | Bacteria | 3241 |
| 114 | Ga0105240_10004460 | 3300009093 | Bacteria | 21332 |
| 115 | Ga0111539_10000018 | 3300009094 | Bacteria | 270743 |
| 116 | Ga0105245_10000006 | 3300009098 | Bacteria | 330960 |
| 117 | Ga0105245_10000817 | 3300009098 | Bacteria | 28373 |
| 118 | Ga0105245_10623240 | 3300009098 | Bacteria | 1107 |
| 119 | Ga0114129_10378389 | 3300009147 | Bacteria | 1870 |
| 120 | Ga0114129_10462761 | 3300009147 | Bacteria | 1662 |
| 121 | Ga0114129_11545548 | 3300009147 | Unclassified | 814 |
| 122 | Ga0105242_10000937 | 3300009176 | Bacteria | 22733 |
| 123 | Ga0105242_12092153 | 3300009176 | Unclassified | 610 |
| 124 | Ga0105248_10673159 | 3300009177 | Bacteria | 1167 |
| 125 | Ga0105238_10000118 | 3300009551 | Bacteria | 86809 |
| 126 | Ga0105239_10099914 | 3300010375 | Bacteria | 3208 |
| 127 | Ga0105246_10034458 | 3300011119 | Bacteria | 3374 |
| 128 | Ga0105246_10660581 | 3300011119 | Bacteria | 911 |
| 129 | Ga0157369_10000123 | 3300013105 | Bacteria | 110823 |
| 130 | Ga0157369_10211355 | 3300013105 | Bacteria | 2033 |
| 131 | Ga0157374_10000019 | 3300013296 | Bacteria | 280543 |
| 132 | Ga0157378_10000588 | 3300013297 | Bacteria | 34092 |
| 133 | Ga0157378_10001113 | 3300013297 | Bacteria | 24466 |
| 134 | Ga0157378_10044323 | 3300013297 | Bacteria | 3950 |
| 135 | Ga0157378_10273466 | 3300013297 | Bacteria | 1625 |
| 136 | Ga0163162_12163417 | 3300013306 | Bacteria | 638 |
| 137 | Ga0157372_10510564 | 3300013307 | Bacteria | 1401 |
| 138 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 139 | Ga0157375_10000026 | 3300013308 | Bacteria | 222518 |
| 140 | Ga0157375_10002279 | 3300013308 | Bacteria | 16593 |
| 141 | Ga0163163_11345201 | 3300014325 | Unclassified | 776 |
| 142 | Ga0157380_10000970 | 3300014326 | Bacteria | 18177 |
| 143 | Ga0157377_10000110 | 3300014745 | Bacteria | 56152 |
| 144 | Ga0157377_10000126 | 3300014745 | Bacteria | 49710 |
| 145 | Ga0157376_10000011 | 3300014969 | Bacteria | 307434 |
| 146 | Ga0157376_10235812 | 3300014969 | Bacteria | 1702 |
| 147 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 148 | Ga0213873_10004499 | 3300021358 | Bacteria | 2607 |
| 149 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 150 | Ga0213876_10000070 | 3300021384 | Bacteria | 123986 |
| 151 | Ga0213876_10276555 | 3300021384 | Bacteria | 892 |
| 152 | Ga0207655_1114248 | 3300025728 | Bacteria | 906 |
| 153 | Ga0207699_10346416 | 3300025906 | Bacteria | 1048 |
| 154 | Ga0207643_10013159 | 3300025908 | Bacteria | 4476 |
| 155 | Ga0207705_10587852 | 3300025909 | Bacteria | 866 |
| 156 | Ga0207684_10222342 | 3300025910 | Bacteria | 1629 |
| 157 | Ga0207684_10489586 | 3300025910 | Bacteria | 1054 |
| 158 | Ga0207684_10622967 | 3300025910 | Unclassified | 920 |
| 159 | Ga0207695_10023456 | 3300025913 | Bacteria | 6970 |
| 160 | Ga0207660_10140843 | 3300025917 | Bacteria | 1844 |
| 161 | Ga0207660_10165733 | 3300025917 | Bacteria | 1708 |
| 162 | Ga0207662_10474910 | 3300025918 | Bacteria | 858 |
| 163 | Ga0207649_10201920 | 3300025920 | Bacteria | 1405 |
| 164 | Ga0207649_11408774 | 3300025920 | Unclassified | 552 |
| 165 | Ga0207646_10019661 | 3300025922 | Bacteria | 6271 |
| 166 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 167 | Ga0207650_10000021 | 3300025925 | Bacteria | 322394 |
| 168 | Ga0207650_10953057 | 3300025925 | Bacteria | 729 |
| 169 | Ga0207659_10000005 | 3300025926 | Bacteria | 405839 |
| 170 | Ga0207687_10000006 | 3300025927 | Bacteria | 641680 |
| 171 | Ga0207687_10278019 | 3300025927 | Bacteria | 1341 |
| 172 | Ga0207687_10870332 | 3300025927 | Bacteria | 770 |
| 173 | Ga0207690_10516740 | 3300025932 | Bacteria | 967 |
| 174 | Ga0207686_10000747 | 3300025934 | Bacteria | 20053 |
| 175 | Ga0207670_10003871 | 3300025936 | Bacteria | 7980 |
| 176 | Ga0207670_10012469 | 3300025936 | Bacteria | 4977 |
| 177 | Ga0207670_10522146 | 3300025936 | Bacteria | 967 |
| 178 | Ga0207670_10993278 | 3300025936 | Bacteria | 706 |
| 179 | Ga0207665_10999062 | 3300025939 | Unclassified | 665 |
| 180 | Ga0207691_10003526 | 3300025940 | Bacteria | 15220 |
| 181 | Ga0207689_10024368 | 3300025942 | Bacteria | 5078 |
| 182 | Ga0207689_10040731 | 3300025942 | Bacteria | 3844 |
| 183 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 184 | Ga0207661_10139970 | 3300025944 | Bacteria | 2082 |
| 185 | Ga0207661_11278409 | 3300025944 | Bacteria | 674 |
| 186 | Ga0207679_11503759 | 3300025945 | Unclassified | 617 |
| 187 | Ga0207640_10001721 | 3300025981 | Bacteria | 11740 |
| 188 | Ga0207640_10256493 | 3300025981 | Bacteria | 1360 |
| 189 | Ga0207677_10000090 | 3300026023 | Bacteria | 74352 |
| 190 | Ga0207677_10000453 | 3300026023 | Bacteria | 27603 |
| 191 | Ga0207703_10000099 | 3300026035 | Bacteria | 103567 |
| 192 | Ga0207703_11820551 | 3300026035 | Unclassified | 585 |
| 193 | Ga0207639_10000003 | 3300026041 | Bacteria | 806887 |
| 194 | Ga0207639_10271408 | 3300026041 | Bacteria | 1488 |
| 195 | Ga0207708_10000018 | 3300026075 | Bacteria | 188140 |
| 196 | Ga0207648_10185216 | 3300026089 | Bacteria | 1844 |
| 197 | Ga0207674_10118656 | 3300026116 | Bacteria | 2615 |
| 198 | Ga0207674_11079013 | 3300026116 | Bacteria | 772 |
| 199 | Ga0207675_100099201 | 3300026118 | Bacteria | 2743 |
| 200 | Ga0207683_10414086 | 3300026121 | Bacteria | 1241 |
| 201 | Ga0207698_10733603 | 3300026142 | Bacteria | 985 |
| 202 | Ga0207428_10000003 | 3300027907 | Bacteria | 799783 |
| 203 | Ga0307511_10013488 | 3300030521 | Bacteria | 7981 |
| 204 | Ga0307408_100705500 | 3300031548 | Bacteria | 907 |
| 205 | Ga0307416_101503881 | 3300032002 | Unclassified | 779 |
| 206 | Ga0307411_11871685 | 3300032005 | Bacteria | 558 |
| 207 | Ga0373932_0004637 | 3300035112 | Bacteria | 3248 |
| 208 | Ga0436365_0406526 | 3300039437 | Bacteria | 22508 |
| 209 | Ga0436365_0433983 | 3300039437 | Bacteria | 1735 |
| 210 | Ga0436365_0479738 | 3300039437 | Bacteria | 1220 |
| 211 | Ga0436365_0774883 | 3300039437 | Bacteria | 390569 |
| 212 | Ga0436365_1520166 | 3300039437 | Bacteria | 979 |
| 213 | Ga0436363_0548633 | 3300039450 | Bacteria | 956 |
| 214 | Ga0436363_1229498 | 3300039450 | Unclassified | 602 |
| 215 | Ga0436362_0264012 | 3300039453 | Bacteria | 5494 |
| 216 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 217 | Ga0453683_0052415 | 3300044673 | Bacteria | 2554 |
| 218 | Ga0495620_0004018 | 3300046515 | Bacteria | 8354 |
| 219 | Ga0496100_0789386 | 3300048903 | Bacteria | 744 |
| 220 | Ga0501071_1531430 | 3300049587 | Unclassified | 515 |
| 221 | Ga0501080_0066322 | 3300049742 | Bacteria | 3357 |
| 222 | Ga0501080_0576698 | 3300049742 | Bacteria | 1000 |
| 223 | Ga0501081_0700539 | 3300049743 | Bacteria | 760 |
| 224 | Ga0501035_0475007 | 3300049822 | Bacteria | 1032 |
| 225 | nmdc:mga05p37_279966_c1 | 3300050507 | Bacteria | 1989 |
| 226 | nmdc:mga05p37_419770_c1 | 3300050507 | Bacteria | 1557 |
| 227 | nmdc:mga09592_103005_c1 | 3300050508 | Bacteria | 2445 |
| 228 | nmdc:mga06r32_457382_c1 | 3300050510 | Bacteria | 1256 |
| 229 | nmdc:mga08y16_4_c1 | 3300050511 | Bacteria | 916963 |
| 230 | nmdc:mga0n895_834970_c1 | 3300050512 | Bacteria | 910 |
| 231 | nmdc:mga0rr50_205454_c1 | 3300050513 | Bacteria | 1621 |
| 232 | nmdc:mga0rr50_3026_c1 | 3300050513 | Bacteria | 9615 |
| 233 | nmdc:mga0rr50_328775_c1 | 3300050513 | Bacteria | 1283 |
| 234 | nmdc:mga0rr50_5012_c1 | 3300050513 | Bacteria | 7844 |
| 235 | nmdc:mga08x19_4522_c1 | 3300050514 | Bacteria | 8242 |
| 236 | nmdc:mga08x19_570178_c1 | 3300050514 | Unclassified | 801 |
| 237 | Ga0495655_0000026 | 3300053083 | Bacteria | 34668 |
| 238 | Ga0501082_0714808 | 3300060353 | Bacteria | 877 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100099306 | Ga0070706_1000993061 | 123 |
| 2 | 3300005518 | Ga0070699_100334393 | Ga0070699_1003343932 | 123 |
| 3 | 3300005340 | Ga0070689_100595540 | Ga0070689_1005955401 | 126 |
| 4 | 3300005364 | Ga0070673_100410638 | Ga0070673_1004106382 | 127 |
| 5 | 3300005457 | Ga0070662_101662489 | Ga0070662_1016624891 | 127 |
| 6 | 3300005467 | Ga0070706_100099444 | Ga0070706_1000994443 | 127 |
| 7 | 3300005543 | Ga0070672_100000113 | Ga0070672_10000011339 | 127 |
| 8 | 3300005615 | Ga0070702_101720348 | Ga0070702_1017203481 | 127 |
| 9 | 3300005840 | Ga0068870_10013915 | Ga0068870_100139155 | 127 |
| 10 | 3300005842 | Ga0068858_100001900 | Ga0068858_10000190019 | 127 |
| 11 | 3300009098 | Ga0105245_10000817 | Ga0105245_1000081725 | 127 |
| 12 | 3300011119 | Ga0105246_10660581 | Ga0105246_106605812 | 127 |
| 13 | 3300013297 | Ga0157378_10044323 | Ga0157378_100443232 | 127 |
| 14 | 3300013308 | Ga0157375_10000001 | Ga0157375_10000001288 | 127 |
| 15 | 3300014326 | Ga0157380_10000970 | Ga0157380_100009704 | 127 |
| 16 | 3300025908 | Ga0207643_10013159 | Ga0207643_100131595 | 127 |
| 17 | 3300025927 | Ga0207687_10278019 | Ga0207687_102780193 | 127 |
| 18 | 3300025936 | Ga0207670_10003871 | Ga0207670_100038715 | 127 |
| 19 | 3300025940 | Ga0207691_10003526 | Ga0207691_1000352611 | 127 |
| 20 | 3300026035 | Ga0207703_10000099 | Ga0207703_1000009920 | 127 |
| 21 | 3300006881 | Ga0068865_100479834 | Ga0068865_1004798341 | 128 |
| 22 | 3300014969 | Ga0157376_10235812 | Ga0157376_102358122 | 128 |
| 23 | 3300005330 | Ga0070690_101191466 | Ga0070690_1011914661 | 133 |
| 24 | 3300005334 | Ga0068869_100540120 | Ga0068869_1005401201 | 133 |
| 25 | 3300005340 | Ga0070689_100111021 | Ga0070689_1001110213 | 133 |
| 26 | 3300005364 | Ga0070673_100372800 | Ga0070673_1003728001 | 133 |
| 27 | 3300005459 | Ga0068867_100054551 | Ga0068867_1000545511 | 133 |
| 28 | 3300005544 | Ga0070686_100749582 | Ga0070686_1007495822 | 133 |
| 29 | 3300006163 | Ga0070715_10654258 | Ga0070715_106542582 | 133 |
| 30 | 3300025936 | Ga0207670_10012469 | Ga0207670_100124695 | 133 |
| 31 | 3300026089 | Ga0207648_10185216 | Ga0207648_101852162 | 133 |
| 32 | 3300007076 | Ga0075435_100160724 | Ga0075435_1001607243 | 134 |
| 33 | 3300030521 | Ga0307511_10013488 | Ga0307511_1001348810 | 134 |
| 34 | 3300050513 | nmdc:mga0rr50_205454_c1 | nmdc:mga0rr50_205454_c1_762_1166 | 134 |
| 35 | 3300005329 | Ga0070683_100141659 | Ga0070683_1001416594 | 135 |
| 36 | 3300005338 | Ga0068868_100001770 | Ga0068868_10000177012 | 135 |
| 37 | 3300005343 | Ga0070687_100647055 | Ga0070687_1006470552 | 135 |
| 38 | 3300005344 | Ga0070661_100310726 | Ga0070661_1003107262 | 135 |
| 39 | 3300005354 | Ga0070675_100521523 | Ga0070675_1005215232 | 135 |
| 40 | 3300005366 | Ga0070659_100676984 | Ga0070659_1006769842 | 135 |
| 41 | 3300005436 | Ga0070713_100098313 | Ga0070713_1000983132 | 135 |
| 42 | 3300005445 | Ga0070708_100189043 | Ga0070708_1001890434 | 135 |
| 43 | 3300005547 | Ga0070693_100140100 | Ga0070693_1001401002 | 135 |
| 44 | 3300005615 | Ga0070702_100108859 | Ga0070702_1001088593 | 135 |
| 45 | 3300005842 | Ga0068858_102032687 | Ga0068858_1020326871 | 135 |
| 46 | 3300006028 | Ga0070717_10000050 | Ga0070717_1000005040 | 135 |
| 47 | 3300006173 | Ga0070716_100268625 | Ga0070716_1002686252 | 135 |
| 48 | 3300006173 | Ga0070716_100402352 | Ga0070716_1004023522 | 135 |
| 49 | 3300006914 | Ga0075436_100018227 | Ga0075436_1000182275 | 135 |
| 50 | 3300007076 | Ga0075435_100001991 | Ga0075435_1000019919 | 135 |
| 51 | 3300007076 | Ga0075435_101323933 | Ga0075435_1013239332 | 135 |
| 52 | 3300009177 | Ga0105248_10673159 | Ga0105248_106731593 | 135 |
| 53 | 3300013297 | Ga0157378_10273466 | Ga0157378_102734662 | 135 |
| 54 | 3300021384 | Ga0213876_10276555 | Ga0213876_102765551 | 135 |
| 55 | 3300025918 | Ga0207662_10474910 | Ga0207662_104749102 | 135 |
| 56 | 3300025920 | Ga0207649_10201920 | Ga0207649_102019202 | 135 |
| 57 | 3300025932 | Ga0207690_10516740 | Ga0207690_105167401 | 135 |
| 58 | 3300025944 | Ga0207661_10139970 | Ga0207661_101399702 | 135 |
| 59 | 3300026023 | Ga0207677_10000090 | Ga0207677_1000009056 | 135 |
| 60 | 3300026035 | Ga0207703_11820551 | Ga0207703_118205511 | 135 |
| 61 | 3300039437 | Ga0436365_1520166 | Ga0436365_1520166_532_939 | 135 |
| 62 | 3300048903 | Ga0496100_0789386 | Ga0496100_0789386_288_695 | 135 |
| 63 | 3300049587 | Ga0501071_1531430 | Ga0501071_1531430_64_474 | 135 |
| 64 | 3300049742 | Ga0501080_0576698 | Ga0501080_0576698_579_989 | 135 |
| 65 | 3300049743 | Ga0501081_0700539 | Ga0501081_0700539_303_713 | 135 |
| 66 | 3300049822 | Ga0501035_0475007 | Ga0501035_0475007_561_971 | 135 |
| 67 | 3300050513 | nmdc:mga0rr50_3026_c1 | nmdc:mga0rr50_3026_c1_666_1073 | 135 |
| 68 | 3300050513 | nmdc:mga0rr50_328775_c1 | nmdc:mga0rr50_328775_c1_710_1117 | 135 |
| 69 | 3300050514 | nmdc:mga08x19_4522_c1 | nmdc:mga08x19_4522_c1_3566_3973 | 135 |
| 70 | 3300053083 | Ga0495655_0000026 | Ga0495655_0000026_30639_31046 | 135 |
| 71 | 3300004798 | Ga0058859_11139425 | Ga0058859_111394251 | 136 |
| 72 | 3300005293 | Ga0065715_10178298 | Ga0065715_101782982 | 136 |
| 73 | 3300005295 | Ga0065707_10207026 | Ga0065707_102070261 | 136 |
| 74 | 3300005295 | Ga0065707_10288916 | Ga0065707_102889162 | 136 |
| 75 | 3300005327 | Ga0070658_10266353 | Ga0070658_102663532 | 136 |
| 76 | 3300005328 | Ga0070676_10141149 | Ga0070676_101411492 | 136 |
| 77 | 3300005329 | Ga0070683_100000009 | Ga0070683_10000000955 | 136 |
| 78 | 3300005331 | Ga0070670_100000131 | Ga0070670_1000001312 | 136 |
| 79 | 3300005331 | Ga0070670_100494969 | Ga0070670_1004949692 | 136 |
| 80 | 3300005334 | Ga0068869_100005907 | Ga0068869_1000059076 | 136 |
| 81 | 3300005334 | Ga0068869_100313323 | Ga0068869_1003133232 | 136 |
| 82 | 3300005336 | Ga0070680_100149565 | Ga0070680_1001495652 | 136 |
| 83 | 3300005337 | Ga0070682_100062162 | Ga0070682_1000621623 | 136 |
| 84 | 3300005338 | Ga0068868_100001221 | Ga0068868_1000012214 | 136 |
| 85 | 3300005340 | Ga0070689_101067824 | Ga0070689_1010678241 | 136 |
| 86 | 3300005341 | Ga0070691_10385546 | Ga0070691_103855461 | 136 |
| 87 | 3300005343 | Ga0070687_100292103 | Ga0070687_1002921031 | 136 |
| 88 | 3300005343 | Ga0070687_100300072 | Ga0070687_1003000721 | 136 |
| 89 | 3300005344 | Ga0070661_101566152 | Ga0070661_1015661521 | 136 |
| 90 | 3300005345 | Ga0070692_10049112 | Ga0070692_100491124 | 136 |
| 91 | 3300005354 | Ga0070675_100000002 | Ga0070675_100000002225 | 136 |
| 92 | 3300005356 | Ga0070674_100657808 | Ga0070674_1006578081 | 136 |
| 93 | 3300005434 | Ga0070709_10341550 | Ga0070709_103415502 | 136 |
| 94 | 3300005437 | Ga0070710_10237687 | Ga0070710_102376873 | 136 |
| 95 | 3300005437 | Ga0070710_10387213 | Ga0070710_103872132 | 136 |
| 96 | 3300005438 | Ga0070701_10709634 | Ga0070701_107096341 | 136 |
| 97 | 3300005440 | Ga0070705_100116062 | Ga0070705_1001160622 | 136 |
| 98 | 3300005441 | Ga0070700_100000030 | Ga0070700_10000003095 | 136 |
| 99 | 3300005445 | Ga0070708_101573044 | Ga0070708_1015730441 | 136 |
| 100 | 3300005456 | Ga0070678_100599744 | Ga0070678_1005997441 | 136 |
| 101 | 3300005467 | Ga0070706_100068300 | Ga0070706_1000683002 | 136 |
| 102 | 3300005467 | Ga0070706_101321499 | Ga0070706_1013214992 | 136 |
| 103 | 3300005468 | Ga0070707_100003590 | Ga0070707_1000035903 | 136 |
| 104 | 3300005468 | Ga0070707_100133444 | Ga0070707_1001334442 | 136 |
| 105 | 3300005468 | Ga0070707_100604704 | Ga0070707_1006047042 | 136 |
| 106 | 3300005471 | Ga0070698_100616573 | Ga0070698_1006165731 | 136 |
| 107 | 3300005471 | Ga0070698_100955953 | Ga0070698_1009559531 | 136 |
| 108 | 3300005471 | Ga0070698_101207886 | Ga0070698_1012078862 | 136 |
| 109 | 3300005471 | Ga0070698_101207888 | Ga0070698_1012078882 | 136 |
| 110 | 3300005518 | Ga0070699_100016505 | Ga0070699_1000165055 | 136 |
| 111 | 3300005518 | Ga0070699_100482399 | Ga0070699_1004823992 | 136 |
| 112 | 3300005535 | Ga0070684_100000074 | Ga0070684_10000007460 | 136 |
| 113 | 3300005535 | Ga0070684_100013707 | Ga0070684_1000137071 | 136 |
| 114 | 3300005536 | Ga0070697_100144909 | Ga0070697_1001449093 | 136 |
| 115 | 3300005536 | Ga0070697_100376211 | Ga0070697_1003762112 | 136 |
| 116 | 3300005539 | Ga0068853_100112083 | Ga0068853_1001120832 | 136 |
| 117 | 3300005539 | Ga0068853_100512985 | Ga0068853_1005129852 | 136 |
| 118 | 3300005544 | Ga0070686_100118706 | Ga0070686_1001187062 | 136 |
| 119 | 3300005546 | Ga0070696_101325364 | Ga0070696_1013253641 | 136 |
| 120 | 3300005577 | Ga0068857_100847028 | Ga0068857_1008470282 | 136 |
| 121 | 3300005577 | Ga0068857_101288742 | Ga0068857_1012887422 | 136 |
| 122 | 3300005578 | Ga0068854_100074602 | Ga0068854_1000746024 | 136 |
| 123 | 3300005578 | Ga0068854_100114771 | Ga0068854_1001147713 | 136 |
| 124 | 3300005615 | Ga0070702_100303209 | Ga0070702_1003032091 | 136 |
| 125 | 3300005615 | Ga0070702_100373171 | Ga0070702_1003731712 | 136 |
| 126 | 3300005615 | Ga0070702_100452384 | Ga0070702_1004523841 | 136 |
| 127 | 3300005616 | Ga0068852_100925741 | Ga0068852_1009257412 | 136 |
| 128 | 3300005617 | Ga0068859_101577829 | Ga0068859_1015778291 | 136 |
| 129 | 3300005719 | Ga0068861_100146957 | Ga0068861_1001469572 | 136 |
| 130 | 3300006028 | Ga0070717_10290502 | Ga0070717_102905022 | 136 |
| 131 | 3300006237 | Ga0097621_100468032 | Ga0097621_1004680321 | 136 |
| 132 | 3300006358 | Ga0068871_100181596 | Ga0068871_1001815962 | 136 |
| 133 | 3300006358 | Ga0068871_100744526 | Ga0068871_1007445262 | 136 |
| 134 | 3300006844 | Ga0075428_100007626 | Ga0075428_1000076265 | 136 |
| 135 | 3300006844 | Ga0075428_100218201 | Ga0075428_1002182013 | 136 |
| 136 | 3300006847 | Ga0075431_100205645 | Ga0075431_1002056452 | 136 |
| 137 | 3300006852 | Ga0075433_10655566 | Ga0075433_106555662 | 136 |
| 138 | 3300006871 | Ga0075434_100557272 | Ga0075434_1005572721 | 136 |
| 139 | 3300006871 | Ga0075434_100958802 | Ga0075434_1009588022 | 136 |
| 140 | 3300006871 | Ga0075434_101529841 | Ga0075434_1015298412 | 136 |
| 141 | 3300006871 | Ga0075434_101980880 | Ga0075434_1019808801 | 136 |
| 142 | 3300006880 | Ga0075429_100643344 | Ga0075429_1006433442 | 136 |
| 143 | 3300006880 | Ga0075429_100973562 | Ga0075429_1009735622 | 136 |
| 144 | 3300006914 | Ga0075436_100508444 | Ga0075436_1005084442 | 136 |
| 145 | 3300006931 | Ga0097620_101577762 | Ga0097620_1015777621 | 136 |
| 146 | 3300007076 | Ga0075435_100244286 | Ga0075435_1002442862 | 136 |
| 147 | 3300009036 | Ga0105244_10025148 | Ga0105244_100251484 | 136 |
| 148 | 3300009093 | Ga0105240_10004460 | Ga0105240_1000446014 | 136 |
| 149 | 3300009094 | Ga0111539_10000018 | Ga0111539_100000187 | 136 |
| 150 | 3300009098 | Ga0105245_10000006 | Ga0105245_100000062 | 136 |
| 151 | 3300009098 | Ga0105245_10623240 | Ga0105245_106232402 | 136 |
| 152 | 3300009147 | Ga0114129_10378389 | Ga0114129_103783892 | 136 |
| 153 | 3300009147 | Ga0114129_10462761 | Ga0114129_104627612 | 136 |
| 154 | 3300009147 | Ga0114129_11545548 | Ga0114129_115455482 | 136 |
| 155 | 3300009176 | Ga0105242_10000937 | Ga0105242_1000093714 | 136 |
| 156 | 3300009176 | Ga0105242_12092153 | Ga0105242_120921531 | 136 |
| 157 | 3300009551 | Ga0105238_10000118 | Ga0105238_1000011846 | 136 |
| 158 | 3300010375 | Ga0105239_10099914 | Ga0105239_100999142 | 136 |
| 159 | 3300011119 | Ga0105246_10034458 | Ga0105246_100344581 | 136 |
| 160 | 3300013105 | Ga0157369_10000123 | Ga0157369_1000012361 | 136 |
| 161 | 3300013105 | Ga0157369_10211355 | Ga0157369_102113552 | 136 |
| 162 | 3300013296 | Ga0157374_10000019 | Ga0157374_1000001939 | 136 |
| 163 | 3300013297 | Ga0157378_10000588 | Ga0157378_1000058824 | 136 |
| 164 | 3300013297 | Ga0157378_10001113 | Ga0157378_1000111322 | 136 |
| 165 | 3300013306 | Ga0163162_12163417 | Ga0163162_121634171 | 136 |
| 166 | 3300013307 | Ga0157372_10510564 | Ga0157372_105105642 | 136 |
| 167 | 3300013308 | Ga0157375_10000026 | Ga0157375_10000026123 | 136 |
| 168 | 3300013308 | Ga0157375_10002279 | Ga0157375_1000227911 | 136 |
| 169 | 3300014325 | Ga0163163_11345201 | Ga0163163_113452011 | 136 |
| 170 | 3300014745 | Ga0157377_10000110 | Ga0157377_1000011018 | 136 |
| 171 | 3300014745 | Ga0157377_10000126 | Ga0157377_1000012612 | 136 |
| 172 | 3300014969 | Ga0157376_10000011 | Ga0157376_10000011147 | 136 |
| 173 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002567 | 136 |
| 174 | 3300021358 | Ga0213873_10004499 | Ga0213873_100044992 | 136 |
| 175 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001650 | 136 |
| 176 | 3300021384 | Ga0213876_10000070 | Ga0213876_10000070103 | 136 |
| 177 | 3300025728 | Ga0207655_1114248 | Ga0207655_11142482 | 136 |
| 178 | 3300025906 | Ga0207699_10346416 | Ga0207699_103464161 | 136 |
| 179 | 3300025909 | Ga0207705_10587852 | Ga0207705_105878522 | 136 |
| 180 | 3300025910 | Ga0207684_10222342 | Ga0207684_102223423 | 136 |
| 181 | 3300025910 | Ga0207684_10489586 | Ga0207684_104895862 | 136 |
| 182 | 3300025910 | Ga0207684_10622967 | Ga0207684_106229672 | 136 |
| 183 | 3300025913 | Ga0207695_10023456 | Ga0207695_100234563 | 136 |
| 184 | 3300025917 | Ga0207660_10140843 | Ga0207660_101408432 | 136 |
| 185 | 3300025917 | Ga0207660_10165733 | Ga0207660_101657332 | 136 |
| 186 | 3300025920 | Ga0207649_11408774 | Ga0207649_114087741 | 136 |
| 187 | 3300025922 | Ga0207646_10019661 | Ga0207646_100196614 | 136 |
| 188 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001994 | 136 |
| 189 | 3300025925 | Ga0207650_10000021 | Ga0207650_10000021180 | 136 |
| 190 | 3300025925 | Ga0207650_10953057 | Ga0207650_109530572 | 136 |
| 191 | 3300025926 | Ga0207659_10000005 | Ga0207659_10000005304 | 136 |
| 192 | 3300025927 | Ga0207687_10000006 | Ga0207687_10000006436 | 136 |
| 193 | 3300025927 | Ga0207687_10870332 | Ga0207687_108703321 | 136 |
| 194 | 3300025934 | Ga0207686_10000747 | Ga0207686_100007479 | 136 |
| 195 | 3300025936 | Ga0207670_10522146 | Ga0207670_105221461 | 136 |
| 196 | 3300025936 | Ga0207670_10993278 | Ga0207670_109932781 | 136 |
| 197 | 3300025939 | Ga0207665_10999062 | Ga0207665_109990622 | 136 |
| 198 | 3300025942 | Ga0207689_10024368 | Ga0207689_100243682 | 136 |
| 199 | 3300025942 | Ga0207689_10040731 | Ga0207689_100407312 | 136 |
| 200 | 3300025944 | Ga0207661_10000007 | Ga0207661_10000007391 | 136 |
| 201 | 3300025944 | Ga0207661_11278409 | Ga0207661_112784091 | 136 |
| 202 | 3300025945 | Ga0207679_11503759 | Ga0207679_115037591 | 136 |
| 203 | 3300025981 | Ga0207640_10001721 | Ga0207640_100017217 | 136 |
| 204 | 3300025981 | Ga0207640_10256493 | Ga0207640_102564933 | 136 |
| 205 | 3300026023 | Ga0207677_10000453 | Ga0207677_100004537 | 136 |
| 206 | 3300026041 | Ga0207639_10000003 | Ga0207639_10000003337 | 136 |
| 207 | 3300026041 | Ga0207639_10271408 | Ga0207639_102714083 | 136 |
| 208 | 3300026075 | Ga0207708_10000018 | Ga0207708_1000001875 | 136 |
| 209 | 3300026116 | Ga0207674_10118656 | Ga0207674_101186566 | 136 |
| 210 | 3300026116 | Ga0207674_11079013 | Ga0207674_110790131 | 136 |
| 211 | 3300026118 | Ga0207675_100099201 | Ga0207675_1000992012 | 136 |
| 212 | 3300026121 | Ga0207683_10414086 | Ga0207683_104140862 | 136 |
| 213 | 3300026142 | Ga0207698_10733603 | Ga0207698_107336032 | 136 |
| 214 | 3300027907 | Ga0207428_10000003 | Ga0207428_10000003456 | 136 |
| 215 | 3300031548 | Ga0307408_100705500 | Ga0307408_1007055001 | 136 |
| 216 | 3300032002 | Ga0307416_101503881 | Ga0307416_1015038812 | 136 |
| 217 | 3300032005 | Ga0307411_11871685 | Ga0307411_118716851 | 136 |
| 218 | 3300035112 | Ga0373932_0004637 | Ga0373932_0004637_232_642 | 136 |
| 219 | 3300039437 | Ga0436365_0406526 | Ga0436365_0406526_13638_14048 | 136 |
| 220 | 3300039437 | Ga0436365_0433983 | Ga0436365_0433983_949_1362 | 136 |
| 221 | 3300039437 | Ga0436365_0479738 | Ga0436365_0479738_547_960 | 136 |
| 222 | 3300039437 | Ga0436365_0774883 | Ga0436365_0774883_126167_126580 | 136 |
| 223 | 3300039450 | Ga0436363_0548633 | Ga0436363_0548633_22_432 | 136 |
| 224 | 3300039450 | Ga0436363_1229498 | Ga0436363_1229498_12_425 | 136 |
| 225 | 3300039453 | Ga0436362_0264012 | Ga0436362_0264012_2055_2465 | 136 |
| 226 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_356701_357114 | 136 |
| 227 | 3300044673 | Ga0453683_0052415 | Ga0453683_0052415_364_780 | 136 |
| 228 | 3300046515 | Ga0495620_0004018 | Ga0495620_0004018_2128_2538 | 136 |
| 229 | 3300049742 | Ga0501080_0066322 | Ga0501080_0066322_2653_3063 | 136 |
| 230 | 3300050507 | nmdc:mga05p37_279966_c1 | nmdc:mga05p37_279966_c1_952_1368 | 136 |
| 231 | 3300050507 | nmdc:mga05p37_419770_c1 | nmdc:mga05p37_419770_c1_273_686 | 136 |
| 232 | 3300050508 | nmdc:mga09592_103005_c1 | nmdc:mga09592_103005_c1_1738_2151 | 136 |
| 233 | 3300050510 | nmdc:mga06r32_457382_c1 | nmdc:mga06r32_457382_c1_387_797 | 136 |
| 234 | 3300050511 | nmdc:mga08y16_4_c1 | nmdc:mga08y16_4_c1_335747_336157 | 136 |
| 235 | 3300050512 | nmdc:mga0n895_834970_c1 | nmdc:mga0n895_834970_c1_100_516 | 136 |
| 236 | 3300050513 | nmdc:mga0rr50_5012_c1 | nmdc:mga0rr50_5012_c1_471_881 | 136 |
| 237 | 3300050514 | nmdc:mga08x19_570178_c1 | nmdc:mga08x19_570178_c1_374_784 | 136 |
| 238 | 3300060353 | Ga0501082_0714808 | Ga0501082_0714808_231_653 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar