F351005

General Info

Members Datasets Scaffolds Average Seq Length
238 143 238 136

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10587852|Ga0207705_105878522
Length 137
Sequence MDKTEKLIDWEENEREDRNRNGLSDDIEPPEVDIATGSAKLAQRLREGGGSVDPSLSAGDVDASWEMAESQGDEAAGGSTPTPGQNNVQEIGEAIGVTYQDNEELRAGEKERDRDKKRWELDPASSDDYQERLRDET

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 94.54
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11139425 3300004798 Bacteria 512
2 Ga0065715_10178298 3300005293 Bacteria 1485
3 Ga0065707_10207026 3300005295 Bacteria 1283
4 Ga0065707_10288916 3300005295 Bacteria 1027
5 Ga0070658_10266353 3300005327 Bacteria 1456
6 Ga0070676_10141149 3300005328 Bacteria 1534
7 Ga0070683_100000009 3300005329 Bacteria 319830
8 Ga0070683_100141659 3300005329 Bacteria 2278
9 Ga0070690_101191466 3300005330 Bacteria 607
10 Ga0070670_100000131 3300005331 Bacteria 70778
11 Ga0070670_100494969 3300005331 Bacteria 1086
12 Ga0068869_100005907 3300005334 Bacteria 7731
13 Ga0068869_100313323 3300005334 Bacteria 1271
14 Ga0068869_100540120 3300005334 Bacteria 978
15 Ga0070680_100149565 3300005336 Bacteria 1960
16 Ga0070682_100062162 3300005337 Bacteria 2365
17 Ga0068868_100001221 3300005338 Bacteria 17666
18 Ga0068868_100001770 3300005338 Bacteria 14782
19 Ga0070689_100111021 3300005340 Bacteria 2181
20 Ga0070689_100595540 3300005340 Bacteria 957
21 Ga0070689_101067824 3300005340 Bacteria 721
22 Ga0070691_10385546 3300005341 Unclassified 786
23 Ga0070687_100292103 3300005343 Bacteria 1031
24 Ga0070687_100300072 3300005343 Bacteria 1019
25 Ga0070687_100647055 3300005343 Bacteria 732
26 Ga0070661_100310726 3300005344 Bacteria 1229
27 Ga0070661_101566152 3300005344 Unclassified 557
28 Ga0070692_10049112 3300005345 Bacteria 2188
29 Ga0070675_100000002 3300005354 Bacteria 435215
30 Ga0070675_100521523 3300005354 Bacteria 1072
31 Ga0070674_100657808 3300005356 Bacteria 891
32 Ga0070673_100372800 3300005364 Bacteria 1271
33 Ga0070673_100410638 3300005364 Bacteria 1212
34 Ga0070659_100676984 3300005366 Bacteria 891
35 Ga0070709_10341550 3300005434 Bacteria 1104
36 Ga0070713_100098313 3300005436 Bacteria 2531
37 Ga0070710_10237687 3300005437 Bacteria 1166
38 Ga0070710_10387213 3300005437 Bacteria 934
39 Ga0070701_10709634 3300005438 Bacteria 677
40 Ga0070705_100116062 3300005440 Bacteria 1720
41 Ga0070700_100000030 3300005441 Bacteria 118205
42 Ga0070708_100189043 3300005445 Bacteria 1926
43 Ga0070708_101573044 3300005445 Unclassified 612
44 Ga0070678_100599744 3300005456 Bacteria 983
45 Ga0070662_101662489 3300005457 Unclassified 551
46 Ga0068867_100054551 3300005459 Bacteria 2953
47 Ga0070706_100068300 3300005467 Bacteria 3286
48 Ga0070706_100099306 3300005467 Bacteria 2705
49 Ga0070706_100099444 3300005467 Bacteria 2703
50 Ga0070706_101321499 3300005467 Unclassified 661
51 Ga0070707_100003590 3300005468 Bacteria 14633
52 Ga0070707_100133444 3300005468 Bacteria 2415
53 Ga0070707_100604704 3300005468 Unclassified 1059
54 Ga0070698_100616573 3300005471 Bacteria 1026
55 Ga0070698_100955953 3300005471 Bacteria 803
56 Ga0070698_101207886 3300005471 Unclassified 705
57 Ga0070698_101207888 3300005471 Unclassified 705
58 Ga0070699_100016505 3300005518 Bacteria 6340
59 Ga0070699_100334393 3300005518 Bacteria 1363
60 Ga0070699_100482399 3300005518 Unclassified 1125
61 Ga0070684_100000074 3300005535 Bacteria 64492
62 Ga0070684_100013707 3300005535 Bacteria 6542
63 Ga0070697_100144909 3300005536 Bacteria 1999
64 Ga0070697_100376211 3300005536 Bacteria 1230
65 Ga0068853_100112083 3300005539 Bacteria 2424
66 Ga0068853_100512985 3300005539 Bacteria 1133
67 Ga0070672_100000113 3300005543 Bacteria 40820
68 Ga0070686_100118706 3300005544 Bacteria 1813
69 Ga0070686_100749582 3300005544 Bacteria 783
70 Ga0070696_101325364 3300005546 Unclassified 612
71 Ga0070693_100140100 3300005547 Bacteria 1521
72 Ga0068857_100847028 3300005577 Bacteria 875
73 Ga0068857_101288742 3300005577 Bacteria 709
74 Ga0068854_100074602 3300005578 Bacteria 2488
75 Ga0068854_100114771 3300005578 Bacteria 2037
76 Ga0070702_100108859 3300005615 Bacteria 1714
77 Ga0070702_100303209 3300005615 Bacteria 1106
78 Ga0070702_100373171 3300005615 Bacteria 1012
79 Ga0070702_100452384 3300005615 Unclassified 932
80 Ga0070702_101720348 3300005615 Unclassified 522
81 Ga0068852_100925741 3300005616 Bacteria 889
82 Ga0068859_101577829 3300005617 Bacteria 725
83 Ga0068861_100146957 3300005719 Bacteria 1930
84 Ga0068870_10013915 3300005840 Bacteria 3790
85 Ga0068858_100001900 3300005842 Bacteria 21314
86 Ga0068858_102032687 3300005842 Unclassified 568
87 Ga0070717_10000050 3300006028 Bacteria 103137
88 Ga0070717_10290502 3300006028 Bacteria 1452
89 Ga0070715_10654258 3300006163 Unclassified 622
90 Ga0070716_100268625 3300006173 Bacteria 1171
91 Ga0070716_100402352 3300006173 Bacteria 985
92 Ga0097621_100468032 3300006237 Bacteria 1138
93 Ga0068871_100181596 3300006358 Bacteria 1808
94 Ga0068871_100744526 3300006358 Bacteria 900
95 Ga0075428_100007626 3300006844 Bacteria 11996
96 Ga0075428_100218201 3300006844 Bacteria 2060
97 Ga0075431_100205645 3300006847 Bacteria 2013
98 Ga0075433_10655566 3300006852 Bacteria 920
99 Ga0075434_100557272 3300006871 Bacteria 1166
100 Ga0075434_100958802 3300006871 Bacteria 870
101 Ga0075434_101529841 3300006871 Unclassified 676
102 Ga0075434_101980880 3300006871 Bacteria 588
103 Ga0075429_100643344 3300006880 Unclassified 929
104 Ga0075429_100973562 3300006880 Bacteria 742
105 Ga0068865_100479834 3300006881 Bacteria 1033
106 Ga0075436_100018227 3300006914 Bacteria 4808
107 Ga0075436_100508444 3300006914 Unclassified 882
108 Ga0097620_101577762 3300006931 Bacteria 725
109 Ga0075435_100001991 3300007076 Bacteria 13356
110 Ga0075435_100160724 3300007076 Bacteria 1892
111 Ga0075435_100244286 3300007076 Bacteria 1527
112 Ga0075435_101323933 3300007076 Bacteria 631
113 Ga0105244_10025148 3300009036 Bacteria 3241
114 Ga0105240_10004460 3300009093 Bacteria 21332
115 Ga0111539_10000018 3300009094 Bacteria 270743
116 Ga0105245_10000006 3300009098 Bacteria 330960
117 Ga0105245_10000817 3300009098 Bacteria 28373
118 Ga0105245_10623240 3300009098 Bacteria 1107
119 Ga0114129_10378389 3300009147 Bacteria 1870
120 Ga0114129_10462761 3300009147 Bacteria 1662
121 Ga0114129_11545548 3300009147 Unclassified 814
122 Ga0105242_10000937 3300009176 Bacteria 22733
123 Ga0105242_12092153 3300009176 Unclassified 610
124 Ga0105248_10673159 3300009177 Bacteria 1167
125 Ga0105238_10000118 3300009551 Bacteria 86809
126 Ga0105239_10099914 3300010375 Bacteria 3208
127 Ga0105246_10034458 3300011119 Bacteria 3374
128 Ga0105246_10660581 3300011119 Bacteria 911
129 Ga0157369_10000123 3300013105 Bacteria 110823
130 Ga0157369_10211355 3300013105 Bacteria 2033
131 Ga0157374_10000019 3300013296 Bacteria 280543
132 Ga0157378_10000588 3300013297 Bacteria 34092
133 Ga0157378_10001113 3300013297 Bacteria 24466
134 Ga0157378_10044323 3300013297 Bacteria 3950
135 Ga0157378_10273466 3300013297 Bacteria 1625
136 Ga0163162_12163417 3300013306 Bacteria 638
137 Ga0157372_10510564 3300013307 Bacteria 1401
138 Ga0157375_10000001 3300013308 Bacteria 696576
139 Ga0157375_10000026 3300013308 Bacteria 222518
140 Ga0157375_10002279 3300013308 Bacteria 16593
141 Ga0163163_11345201 3300014325 Unclassified 776
142 Ga0157380_10000970 3300014326 Bacteria 18177
143 Ga0157377_10000110 3300014745 Bacteria 56152
144 Ga0157377_10000126 3300014745 Bacteria 49710
145 Ga0157376_10000011 3300014969 Bacteria 307434
146 Ga0157376_10235812 3300014969 Bacteria 1702
147 Ga0213873_10000002 3300021358 Bacteria 1164195
148 Ga0213873_10004499 3300021358 Bacteria 2607
149 Ga0213876_10000001 3300021384 Bacteria 1186326
150 Ga0213876_10000070 3300021384 Bacteria 123986
151 Ga0213876_10276555 3300021384 Bacteria 892
152 Ga0207655_1114248 3300025728 Bacteria 906
153 Ga0207699_10346416 3300025906 Bacteria 1048
154 Ga0207643_10013159 3300025908 Bacteria 4476
155 Ga0207705_10587852 3300025909 Bacteria 866
156 Ga0207684_10222342 3300025910 Bacteria 1629
157 Ga0207684_10489586 3300025910 Bacteria 1054
158 Ga0207684_10622967 3300025910 Unclassified 920
159 Ga0207695_10023456 3300025913 Bacteria 6970
160 Ga0207660_10140843 3300025917 Bacteria 1844
161 Ga0207660_10165733 3300025917 Bacteria 1708
162 Ga0207662_10474910 3300025918 Bacteria 858
163 Ga0207649_10201920 3300025920 Bacteria 1405
164 Ga0207649_11408774 3300025920 Unclassified 552
165 Ga0207646_10019661 3300025922 Bacteria 6271
166 Ga0207694_10000001 3300025924 Bacteria 4078485
167 Ga0207650_10000021 3300025925 Bacteria 322394
168 Ga0207650_10953057 3300025925 Bacteria 729
169 Ga0207659_10000005 3300025926 Bacteria 405839
170 Ga0207687_10000006 3300025927 Bacteria 641680
171 Ga0207687_10278019 3300025927 Bacteria 1341
172 Ga0207687_10870332 3300025927 Bacteria 770
173 Ga0207690_10516740 3300025932 Bacteria 967
174 Ga0207686_10000747 3300025934 Bacteria 20053
175 Ga0207670_10003871 3300025936 Bacteria 7980
176 Ga0207670_10012469 3300025936 Bacteria 4977
177 Ga0207670_10522146 3300025936 Bacteria 967
178 Ga0207670_10993278 3300025936 Bacteria 706
179 Ga0207665_10999062 3300025939 Unclassified 665
180 Ga0207691_10003526 3300025940 Bacteria 15220
181 Ga0207689_10024368 3300025942 Bacteria 5078
182 Ga0207689_10040731 3300025942 Bacteria 3844
183 Ga0207661_10000007 3300025944 Bacteria 471636
184 Ga0207661_10139970 3300025944 Bacteria 2082
185 Ga0207661_11278409 3300025944 Bacteria 674
186 Ga0207679_11503759 3300025945 Unclassified 617
187 Ga0207640_10001721 3300025981 Bacteria 11740
188 Ga0207640_10256493 3300025981 Bacteria 1360
189 Ga0207677_10000090 3300026023 Bacteria 74352
190 Ga0207677_10000453 3300026023 Bacteria 27603
191 Ga0207703_10000099 3300026035 Bacteria 103567
192 Ga0207703_11820551 3300026035 Unclassified 585
193 Ga0207639_10000003 3300026041 Bacteria 806887
194 Ga0207639_10271408 3300026041 Bacteria 1488
195 Ga0207708_10000018 3300026075 Bacteria 188140
196 Ga0207648_10185216 3300026089 Bacteria 1844
197 Ga0207674_10118656 3300026116 Bacteria 2615
198 Ga0207674_11079013 3300026116 Bacteria 772
199 Ga0207675_100099201 3300026118 Bacteria 2743
200 Ga0207683_10414086 3300026121 Bacteria 1241
201 Ga0207698_10733603 3300026142 Bacteria 985
202 Ga0207428_10000003 3300027907 Bacteria 799783
203 Ga0307511_10013488 3300030521 Bacteria 7981
204 Ga0307408_100705500 3300031548 Bacteria 907
205 Ga0307416_101503881 3300032002 Unclassified 779
206 Ga0307411_11871685 3300032005 Bacteria 558
207 Ga0373932_0004637 3300035112 Bacteria 3248
208 Ga0436365_0406526 3300039437 Bacteria 22508
209 Ga0436365_0433983 3300039437 Bacteria 1735
210 Ga0436365_0479738 3300039437 Bacteria 1220
211 Ga0436365_0774883 3300039437 Bacteria 390569
212 Ga0436365_1520166 3300039437 Bacteria 979
213 Ga0436363_0548633 3300039450 Bacteria 956
214 Ga0436363_1229498 3300039450 Unclassified 602
215 Ga0436362_0264012 3300039453 Bacteria 5494
216 Ga0436362_0660519 3300039453 Bacteria 832172
217 Ga0453683_0052415 3300044673 Bacteria 2554
218 Ga0495620_0004018 3300046515 Bacteria 8354
219 Ga0496100_0789386 3300048903 Bacteria 744
220 Ga0501071_1531430 3300049587 Unclassified 515
221 Ga0501080_0066322 3300049742 Bacteria 3357
222 Ga0501080_0576698 3300049742 Bacteria 1000
223 Ga0501081_0700539 3300049743 Bacteria 760
224 Ga0501035_0475007 3300049822 Bacteria 1032
225 nmdc:mga05p37_279966_c1 3300050507 Bacteria 1989
226 nmdc:mga05p37_419770_c1 3300050507 Bacteria 1557
227 nmdc:mga09592_103005_c1 3300050508 Bacteria 2445
228 nmdc:mga06r32_457382_c1 3300050510 Bacteria 1256
229 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
230 nmdc:mga0n895_834970_c1 3300050512 Bacteria 910
231 nmdc:mga0rr50_205454_c1 3300050513 Bacteria 1621
232 nmdc:mga0rr50_3026_c1 3300050513 Bacteria 9615
233 nmdc:mga0rr50_328775_c1 3300050513 Bacteria 1283
234 nmdc:mga0rr50_5012_c1 3300050513 Bacteria 7844
235 nmdc:mga08x19_4522_c1 3300050514 Bacteria 8242
236 nmdc:mga08x19_570178_c1 3300050514 Unclassified 801
237 Ga0495655_0000026 3300053083 Bacteria 34668
238 Ga0501082_0714808 3300060353 Bacteria 877

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100099306 Ga0070706_1000993061 123
2 3300005518 Ga0070699_100334393 Ga0070699_1003343932 123
3 3300005340 Ga0070689_100595540 Ga0070689_1005955401 126
4 3300005364 Ga0070673_100410638 Ga0070673_1004106382 127
5 3300005457 Ga0070662_101662489 Ga0070662_1016624891 127
6 3300005467 Ga0070706_100099444 Ga0070706_1000994443 127
7 3300005543 Ga0070672_100000113 Ga0070672_10000011339 127
8 3300005615 Ga0070702_101720348 Ga0070702_1017203481 127
9 3300005840 Ga0068870_10013915 Ga0068870_100139155 127
10 3300005842 Ga0068858_100001900 Ga0068858_10000190019 127
11 3300009098 Ga0105245_10000817 Ga0105245_1000081725 127
12 3300011119 Ga0105246_10660581 Ga0105246_106605812 127
13 3300013297 Ga0157378_10044323 Ga0157378_100443232 127
14 3300013308 Ga0157375_10000001 Ga0157375_10000001288 127
15 3300014326 Ga0157380_10000970 Ga0157380_100009704 127
16 3300025908 Ga0207643_10013159 Ga0207643_100131595 127
17 3300025927 Ga0207687_10278019 Ga0207687_102780193 127
18 3300025936 Ga0207670_10003871 Ga0207670_100038715 127
19 3300025940 Ga0207691_10003526 Ga0207691_1000352611 127
20 3300026035 Ga0207703_10000099 Ga0207703_1000009920 127
21 3300006881 Ga0068865_100479834 Ga0068865_1004798341 128
22 3300014969 Ga0157376_10235812 Ga0157376_102358122 128
23 3300005330 Ga0070690_101191466 Ga0070690_1011914661 133
24 3300005334 Ga0068869_100540120 Ga0068869_1005401201 133
25 3300005340 Ga0070689_100111021 Ga0070689_1001110213 133
26 3300005364 Ga0070673_100372800 Ga0070673_1003728001 133
27 3300005459 Ga0068867_100054551 Ga0068867_1000545511 133
28 3300005544 Ga0070686_100749582 Ga0070686_1007495822 133
29 3300006163 Ga0070715_10654258 Ga0070715_106542582 133
30 3300025936 Ga0207670_10012469 Ga0207670_100124695 133
31 3300026089 Ga0207648_10185216 Ga0207648_101852162 133
32 3300007076 Ga0075435_100160724 Ga0075435_1001607243 134
33 3300030521 Ga0307511_10013488 Ga0307511_1001348810 134
34 3300050513 nmdc:mga0rr50_205454_c1 nmdc:mga0rr50_205454_c1_762_1166 134
35 3300005329 Ga0070683_100141659 Ga0070683_1001416594 135
36 3300005338 Ga0068868_100001770 Ga0068868_10000177012 135
37 3300005343 Ga0070687_100647055 Ga0070687_1006470552 135
38 3300005344 Ga0070661_100310726 Ga0070661_1003107262 135
39 3300005354 Ga0070675_100521523 Ga0070675_1005215232 135
40 3300005366 Ga0070659_100676984 Ga0070659_1006769842 135
41 3300005436 Ga0070713_100098313 Ga0070713_1000983132 135
42 3300005445 Ga0070708_100189043 Ga0070708_1001890434 135
43 3300005547 Ga0070693_100140100 Ga0070693_1001401002 135
44 3300005615 Ga0070702_100108859 Ga0070702_1001088593 135
45 3300005842 Ga0068858_102032687 Ga0068858_1020326871 135
46 3300006028 Ga0070717_10000050 Ga0070717_1000005040 135
47 3300006173 Ga0070716_100268625 Ga0070716_1002686252 135
48 3300006173 Ga0070716_100402352 Ga0070716_1004023522 135
49 3300006914 Ga0075436_100018227 Ga0075436_1000182275 135
50 3300007076 Ga0075435_100001991 Ga0075435_1000019919 135
51 3300007076 Ga0075435_101323933 Ga0075435_1013239332 135
52 3300009177 Ga0105248_10673159 Ga0105248_106731593 135
53 3300013297 Ga0157378_10273466 Ga0157378_102734662 135
54 3300021384 Ga0213876_10276555 Ga0213876_102765551 135
55 3300025918 Ga0207662_10474910 Ga0207662_104749102 135
56 3300025920 Ga0207649_10201920 Ga0207649_102019202 135
57 3300025932 Ga0207690_10516740 Ga0207690_105167401 135
58 3300025944 Ga0207661_10139970 Ga0207661_101399702 135
59 3300026023 Ga0207677_10000090 Ga0207677_1000009056 135
60 3300026035 Ga0207703_11820551 Ga0207703_118205511 135
61 3300039437 Ga0436365_1520166 Ga0436365_1520166_532_939 135
62 3300048903 Ga0496100_0789386 Ga0496100_0789386_288_695 135
63 3300049587 Ga0501071_1531430 Ga0501071_1531430_64_474 135
64 3300049742 Ga0501080_0576698 Ga0501080_0576698_579_989 135
65 3300049743 Ga0501081_0700539 Ga0501081_0700539_303_713 135
66 3300049822 Ga0501035_0475007 Ga0501035_0475007_561_971 135
67 3300050513 nmdc:mga0rr50_3026_c1 nmdc:mga0rr50_3026_c1_666_1073 135
68 3300050513 nmdc:mga0rr50_328775_c1 nmdc:mga0rr50_328775_c1_710_1117 135
69 3300050514 nmdc:mga08x19_4522_c1 nmdc:mga08x19_4522_c1_3566_3973 135
70 3300053083 Ga0495655_0000026 Ga0495655_0000026_30639_31046 135
71 3300004798 Ga0058859_11139425 Ga0058859_111394251 136
72 3300005293 Ga0065715_10178298 Ga0065715_101782982 136
73 3300005295 Ga0065707_10207026 Ga0065707_102070261 136
74 3300005295 Ga0065707_10288916 Ga0065707_102889162 136
75 3300005327 Ga0070658_10266353 Ga0070658_102663532 136
76 3300005328 Ga0070676_10141149 Ga0070676_101411492 136
77 3300005329 Ga0070683_100000009 Ga0070683_10000000955 136
78 3300005331 Ga0070670_100000131 Ga0070670_1000001312 136
79 3300005331 Ga0070670_100494969 Ga0070670_1004949692 136
80 3300005334 Ga0068869_100005907 Ga0068869_1000059076 136
81 3300005334 Ga0068869_100313323 Ga0068869_1003133232 136
82 3300005336 Ga0070680_100149565 Ga0070680_1001495652 136
83 3300005337 Ga0070682_100062162 Ga0070682_1000621623 136
84 3300005338 Ga0068868_100001221 Ga0068868_1000012214 136
85 3300005340 Ga0070689_101067824 Ga0070689_1010678241 136
86 3300005341 Ga0070691_10385546 Ga0070691_103855461 136
87 3300005343 Ga0070687_100292103 Ga0070687_1002921031 136
88 3300005343 Ga0070687_100300072 Ga0070687_1003000721 136
89 3300005344 Ga0070661_101566152 Ga0070661_1015661521 136
90 3300005345 Ga0070692_10049112 Ga0070692_100491124 136
91 3300005354 Ga0070675_100000002 Ga0070675_100000002225 136
92 3300005356 Ga0070674_100657808 Ga0070674_1006578081 136
93 3300005434 Ga0070709_10341550 Ga0070709_103415502 136
94 3300005437 Ga0070710_10237687 Ga0070710_102376873 136
95 3300005437 Ga0070710_10387213 Ga0070710_103872132 136
96 3300005438 Ga0070701_10709634 Ga0070701_107096341 136
97 3300005440 Ga0070705_100116062 Ga0070705_1001160622 136
98 3300005441 Ga0070700_100000030 Ga0070700_10000003095 136
99 3300005445 Ga0070708_101573044 Ga0070708_1015730441 136
100 3300005456 Ga0070678_100599744 Ga0070678_1005997441 136
101 3300005467 Ga0070706_100068300 Ga0070706_1000683002 136
102 3300005467 Ga0070706_101321499 Ga0070706_1013214992 136
103 3300005468 Ga0070707_100003590 Ga0070707_1000035903 136
104 3300005468 Ga0070707_100133444 Ga0070707_1001334442 136
105 3300005468 Ga0070707_100604704 Ga0070707_1006047042 136
106 3300005471 Ga0070698_100616573 Ga0070698_1006165731 136
107 3300005471 Ga0070698_100955953 Ga0070698_1009559531 136
108 3300005471 Ga0070698_101207886 Ga0070698_1012078862 136
109 3300005471 Ga0070698_101207888 Ga0070698_1012078882 136
110 3300005518 Ga0070699_100016505 Ga0070699_1000165055 136
111 3300005518 Ga0070699_100482399 Ga0070699_1004823992 136
112 3300005535 Ga0070684_100000074 Ga0070684_10000007460 136
113 3300005535 Ga0070684_100013707 Ga0070684_1000137071 136
114 3300005536 Ga0070697_100144909 Ga0070697_1001449093 136
115 3300005536 Ga0070697_100376211 Ga0070697_1003762112 136
116 3300005539 Ga0068853_100112083 Ga0068853_1001120832 136
117 3300005539 Ga0068853_100512985 Ga0068853_1005129852 136
118 3300005544 Ga0070686_100118706 Ga0070686_1001187062 136
119 3300005546 Ga0070696_101325364 Ga0070696_1013253641 136
120 3300005577 Ga0068857_100847028 Ga0068857_1008470282 136
121 3300005577 Ga0068857_101288742 Ga0068857_1012887422 136
122 3300005578 Ga0068854_100074602 Ga0068854_1000746024 136
123 3300005578 Ga0068854_100114771 Ga0068854_1001147713 136
124 3300005615 Ga0070702_100303209 Ga0070702_1003032091 136
125 3300005615 Ga0070702_100373171 Ga0070702_1003731712 136
126 3300005615 Ga0070702_100452384 Ga0070702_1004523841 136
127 3300005616 Ga0068852_100925741 Ga0068852_1009257412 136
128 3300005617 Ga0068859_101577829 Ga0068859_1015778291 136
129 3300005719 Ga0068861_100146957 Ga0068861_1001469572 136
130 3300006028 Ga0070717_10290502 Ga0070717_102905022 136
131 3300006237 Ga0097621_100468032 Ga0097621_1004680321 136
132 3300006358 Ga0068871_100181596 Ga0068871_1001815962 136
133 3300006358 Ga0068871_100744526 Ga0068871_1007445262 136
134 3300006844 Ga0075428_100007626 Ga0075428_1000076265 136
135 3300006844 Ga0075428_100218201 Ga0075428_1002182013 136
136 3300006847 Ga0075431_100205645 Ga0075431_1002056452 136
137 3300006852 Ga0075433_10655566 Ga0075433_106555662 136
138 3300006871 Ga0075434_100557272 Ga0075434_1005572721 136
139 3300006871 Ga0075434_100958802 Ga0075434_1009588022 136
140 3300006871 Ga0075434_101529841 Ga0075434_1015298412 136
141 3300006871 Ga0075434_101980880 Ga0075434_1019808801 136
142 3300006880 Ga0075429_100643344 Ga0075429_1006433442 136
143 3300006880 Ga0075429_100973562 Ga0075429_1009735622 136
144 3300006914 Ga0075436_100508444 Ga0075436_1005084442 136
145 3300006931 Ga0097620_101577762 Ga0097620_1015777621 136
146 3300007076 Ga0075435_100244286 Ga0075435_1002442862 136
147 3300009036 Ga0105244_10025148 Ga0105244_100251484 136
148 3300009093 Ga0105240_10004460 Ga0105240_1000446014 136
149 3300009094 Ga0111539_10000018 Ga0111539_100000187 136
150 3300009098 Ga0105245_10000006 Ga0105245_100000062 136
151 3300009098 Ga0105245_10623240 Ga0105245_106232402 136
152 3300009147 Ga0114129_10378389 Ga0114129_103783892 136
153 3300009147 Ga0114129_10462761 Ga0114129_104627612 136
154 3300009147 Ga0114129_11545548 Ga0114129_115455482 136
155 3300009176 Ga0105242_10000937 Ga0105242_1000093714 136
156 3300009176 Ga0105242_12092153 Ga0105242_120921531 136
157 3300009551 Ga0105238_10000118 Ga0105238_1000011846 136
158 3300010375 Ga0105239_10099914 Ga0105239_100999142 136
159 3300011119 Ga0105246_10034458 Ga0105246_100344581 136
160 3300013105 Ga0157369_10000123 Ga0157369_1000012361 136
161 3300013105 Ga0157369_10211355 Ga0157369_102113552 136
162 3300013296 Ga0157374_10000019 Ga0157374_1000001939 136
163 3300013297 Ga0157378_10000588 Ga0157378_1000058824 136
164 3300013297 Ga0157378_10001113 Ga0157378_1000111322 136
165 3300013306 Ga0163162_12163417 Ga0163162_121634171 136
166 3300013307 Ga0157372_10510564 Ga0157372_105105642 136
167 3300013308 Ga0157375_10000026 Ga0157375_10000026123 136
168 3300013308 Ga0157375_10002279 Ga0157375_1000227911 136
169 3300014325 Ga0163163_11345201 Ga0163163_113452011 136
170 3300014745 Ga0157377_10000110 Ga0157377_1000011018 136
171 3300014745 Ga0157377_10000126 Ga0157377_1000012612 136
172 3300014969 Ga0157376_10000011 Ga0157376_10000011147 136
173 3300021358 Ga0213873_10000002 Ga0213873_10000002567 136
174 3300021358 Ga0213873_10004499 Ga0213873_100044992 136
175 3300021384 Ga0213876_10000001 Ga0213876_10000001650 136
176 3300021384 Ga0213876_10000070 Ga0213876_10000070103 136
177 3300025728 Ga0207655_1114248 Ga0207655_11142482 136
178 3300025906 Ga0207699_10346416 Ga0207699_103464161 136
179 3300025909 Ga0207705_10587852 Ga0207705_105878522 136
180 3300025910 Ga0207684_10222342 Ga0207684_102223423 136
181 3300025910 Ga0207684_10489586 Ga0207684_104895862 136
182 3300025910 Ga0207684_10622967 Ga0207684_106229672 136
183 3300025913 Ga0207695_10023456 Ga0207695_100234563 136
184 3300025917 Ga0207660_10140843 Ga0207660_101408432 136
185 3300025917 Ga0207660_10165733 Ga0207660_101657332 136
186 3300025920 Ga0207649_11408774 Ga0207649_114087741 136
187 3300025922 Ga0207646_10019661 Ga0207646_100196614 136
188 3300025924 Ga0207694_10000001 Ga0207694_10000001994 136
189 3300025925 Ga0207650_10000021 Ga0207650_10000021180 136
190 3300025925 Ga0207650_10953057 Ga0207650_109530572 136
191 3300025926 Ga0207659_10000005 Ga0207659_10000005304 136
192 3300025927 Ga0207687_10000006 Ga0207687_10000006436 136
193 3300025927 Ga0207687_10870332 Ga0207687_108703321 136
194 3300025934 Ga0207686_10000747 Ga0207686_100007479 136
195 3300025936 Ga0207670_10522146 Ga0207670_105221461 136
196 3300025936 Ga0207670_10993278 Ga0207670_109932781 136
197 3300025939 Ga0207665_10999062 Ga0207665_109990622 136
198 3300025942 Ga0207689_10024368 Ga0207689_100243682 136
199 3300025942 Ga0207689_10040731 Ga0207689_100407312 136
200 3300025944 Ga0207661_10000007 Ga0207661_10000007391 136
201 3300025944 Ga0207661_11278409 Ga0207661_112784091 136
202 3300025945 Ga0207679_11503759 Ga0207679_115037591 136
203 3300025981 Ga0207640_10001721 Ga0207640_100017217 136
204 3300025981 Ga0207640_10256493 Ga0207640_102564933 136
205 3300026023 Ga0207677_10000453 Ga0207677_100004537 136
206 3300026041 Ga0207639_10000003 Ga0207639_10000003337 136
207 3300026041 Ga0207639_10271408 Ga0207639_102714083 136
208 3300026075 Ga0207708_10000018 Ga0207708_1000001875 136
209 3300026116 Ga0207674_10118656 Ga0207674_101186566 136
210 3300026116 Ga0207674_11079013 Ga0207674_110790131 136
211 3300026118 Ga0207675_100099201 Ga0207675_1000992012 136
212 3300026121 Ga0207683_10414086 Ga0207683_104140862 136
213 3300026142 Ga0207698_10733603 Ga0207698_107336032 136
214 3300027907 Ga0207428_10000003 Ga0207428_10000003456 136
215 3300031548 Ga0307408_100705500 Ga0307408_1007055001 136
216 3300032002 Ga0307416_101503881 Ga0307416_1015038812 136
217 3300032005 Ga0307411_11871685 Ga0307411_118716851 136
218 3300035112 Ga0373932_0004637 Ga0373932_0004637_232_642 136
219 3300039437 Ga0436365_0406526 Ga0436365_0406526_13638_14048 136
220 3300039437 Ga0436365_0433983 Ga0436365_0433983_949_1362 136
221 3300039437 Ga0436365_0479738 Ga0436365_0479738_547_960 136
222 3300039437 Ga0436365_0774883 Ga0436365_0774883_126167_126580 136
223 3300039450 Ga0436363_0548633 Ga0436363_0548633_22_432 136
224 3300039450 Ga0436363_1229498 Ga0436363_1229498_12_425 136
225 3300039453 Ga0436362_0264012 Ga0436362_0264012_2055_2465 136
226 3300039453 Ga0436362_0660519 Ga0436362_0660519_356701_357114 136
227 3300044673 Ga0453683_0052415 Ga0453683_0052415_364_780 136
228 3300046515 Ga0495620_0004018 Ga0495620_0004018_2128_2538 136
229 3300049742 Ga0501080_0066322 Ga0501080_0066322_2653_3063 136
230 3300050507 nmdc:mga05p37_279966_c1 nmdc:mga05p37_279966_c1_952_1368 136
231 3300050507 nmdc:mga05p37_419770_c1 nmdc:mga05p37_419770_c1_273_686 136
232 3300050508 nmdc:mga09592_103005_c1 nmdc:mga09592_103005_c1_1738_2151 136
233 3300050510 nmdc:mga06r32_457382_c1 nmdc:mga06r32_457382_c1_387_797 136
234 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_335747_336157 136
235 3300050512 nmdc:mga0n895_834970_c1 nmdc:mga0n895_834970_c1_100_516 136
236 3300050513 nmdc:mga0rr50_5012_c1 nmdc:mga0rr50_5012_c1_471_881 136
237 3300050514 nmdc:mga08x19_570178_c1 nmdc:mga08x19_570178_c1_374_784 136
238 3300060353 Ga0501082_0714808 Ga0501082_0714808_231_653 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19861

DUF6335

Family of unknown function (DUF6335)

8

133

0.93

Feature Viewer

pLDDT pTM Quality
58.14 0.22 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map