F351302

General Info

Members Datasets Scaffolds Average Seq Length
238 149 476 245

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0000632|Ga0495672_0000632_13841_14659
Length 272
Sequence LAACLAGEIYAGTYAGTKEKIMAARRPLIAGNWKMYGRVADLAQISATFEAVGAGAKAVDIVFCLPAQLIALAAKDCPASALGGQXXAETAADAAQTGDISAAMLADVGAGYVIVGHSERRAKRRDDNESVRLKAEAALAAGLQPIICVGETAAERASGRAEAVVAGQVAASLPTAEGMVSVAYEPVWAIGGDRTPTLEEIAAIHRVVRQELAKRYGPAAEAVRVLYGGSVNPKNARDIFAVEGVDGALVGRASLKSADFAALIMSHPRVAV

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
145 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
146 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
147 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
148 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
149 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.42
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 2.1
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0000632 3300047320 Bacteria 39290
2 Ga0055530_10000685 3300003791 Bacteria 28722
3 Ga0055531_10004322 3300003794 Bacteria 8702
4 Ga0070670_100000037 3300005331 Bacteria 156070
5 Ga0070670_100040335 3300005331 Bacteria 4015
6 Ga0070666_10230375 3300005335 Bacteria 1308
7 Ga0070680_100025744 3300005336 Bacteria 4703
8 Ga0070660_100347043 3300005339 Bacteria 1222
9 Ga0070691_10011443 3300005341 Bacteria 4052
10 Ga0070668_100000097 3300005347 Bacteria 53800
11 Ga0070668_100018957 3300005347 Bacteria 5170
12 Ga0070669_100007690 3300005353 Bacteria 7706
13 Ga0070671_100000342 3300005355 Bacteria 32006
14 Ga0070671_100131586 3300005355 Bacteria 2107
15 Ga0070659_100000206 3300005366 Bacteria 45867
16 Ga0070659_100013775 3300005366 Bacteria 6031
17 Ga0070667_100000083 3300005367 Bacteria 118261
18 Ga0070667_100015622 3300005367 Bacteria 6277
19 Ga0070667_100286697 3300005367 Bacteria 1480
20 Ga0070681_10017736 3300005458 Bacteria 7114
21 Ga0070706_100260560 3300005467 Bacteria 1618
22 Ga0070706_100280043 3300005467 Bacteria 1556
23 Ga0070707_100406537 3300005468 Unclassified 1321
24 Ga0070698_100004235 3300005471 Bacteria 15769
25 Ga0070679_100003462 3300005530 Bacteria 14454
26 Ga0070697_100064937 3300005536 Bacteria 2981
27 Ga0068853_100074102 3300005539 Bacteria 2970
28 Ga0068853_100517171 3300005539 Bacteria 1128
29 Ga0070665_100000116 3300005548 Bacteria 150141
30 Ga0070665_100000278 3300005548 Bacteria 84248
31 Ga0070665_100000483 3300005548 Bacteria 57237
32 Ga0070665_100129119 3300005548 Bacteria 2530
33 Ga0070665_100258217 3300005548 Bacteria 1743
34 Ga0068855_100048334 3300005563 Bacteria 5021
35 Ga0068855_100051066 3300005563 Bacteria 4871
36 Ga0068855_100220141 3300005563 Bacteria 2129
37 Ga0068855_100266855 3300005563 Bacteria 1905
38 Ga0070664_100025727 3300005564 Bacteria 4880
39 Ga0068852_100120426 3300005616 Bacteria 2401
40 Ga0068852_100128448 3300005616 Bacteria 2331
41 Ga0068859_100000435 3300005617 Bacteria 41931
42 Ga0068859_100298525 3300005617 Bacteria 1704
43 Ga0068859_100317741 3300005617 Bacteria 1651
44 Ga0068864_100000786 3300005618 Bacteria 26635
45 Ga0068863_100001697 3300005841 Bacteria 21819
46 Ga0068863_100014231 3300005841 Bacteria 7665
47 Ga0068863_100172768 3300005841 Bacteria 2073
48 Ga0068858_100021274 3300005842 Bacteria 6059
49 Ga0068858_100578672 3300005842 Bacteria 1088
50 Ga0068860_100000128 3300005843 Bacteria 122731
51 Ga0068860_100731772 3300005843 Bacteria 1000
52 Ga0068862_100001627 3300005844 Bacteria 20442
53 Ga0068862_100005242 3300005844 Bacteria 10873
54 Ga0068862_100007701 3300005844 Bacteria 8910
55 Ga0070717_10352215 3300006028 Bacteria 1316
56 Ga0075364_10000306 3300006051 Bacteria 23963
57 Ga0070716_100144120 3300006173 Bacteria 1523
58 Ga0075367_10015158 3300006178 Bacteria 4183
59 Ga0075369_10021117 3300006186 Bacteria 2672
60 Ga0075370_10019459 3300006353 Bacteria 3698
61 Ga0068871_100414194 3300006358 Bacteria 1202
62 Ga0068865_100005340 3300006881 Bacteria 7781
63 Ga0097620_100000435 3300006931 Bacteria 41931
64 Ga0097620_100298527 3300006931 Bacteria 1704
65 Ga0097620_100317746 3300006931 Bacteria 1651
66 Ga0105240_10066735 3300009093 Bacteria 4462
67 Ga0105240_10119671 3300009093 Bacteria 3172
68 Ga0105240_10571616 3300009093 Bacteria 1248
69 Ga0105247_10120849 3300009101 Bacteria 1697
70 Ga0105248_10007787 3300009177 Bacteria 11756
71 Ga0105248_10156746 3300009177 Bacteria 2569
72 Ga0105248_10332704 3300009177 Bacteria 1710
73 Ga0105238_10156107 3300009551 Bacteria 2257
74 Ga0105249_10010617 3300009553 Bacteria 8090
75 Ga0105239_10249639 3300010375 Bacteria 1993
76 Ga0105239_10290314 3300010375 Bacteria 1842
77 Ga0157373_10001429 3300013100 Bacteria 18213
78 Ga0157373_10008774 3300013100 Bacteria 7490
79 Ga0157370_10079389 3300013104 Bacteria 3090
80 Ga0157370_10196112 3300013104 Bacteria 1874
81 Ga0157370_10300514 3300013104 Bacteria 1482
82 Ga0157370_10544606 3300013104 Bacteria 1064
83 Ga0157369_10071812 3300013105 Bacteria 3715
84 Ga0163162_10027619 3300013306 Bacteria 5613
85 Ga0163162_10046155 3300013306 Bacteria 4367
86 Ga0163163_10014023 3300014325 Bacteria 7354
87 Ga0163163_10058081 3300014325 Bacteria 3825
88 Ga0163163_10075508 3300014325 Bacteria 3364
89 Ga0157379_10006808 3300014968 Bacteria 9879
90 Ga0157379_10007276 3300014968 Bacteria 9581
91 Ga0213872_10015402 3300021361 Bacteria 3558
92 Ga0213876_10000320 3300021384 Bacteria 42027
93 Ga0213876_10007130 3300021384 Bacteria 6091
94 Ga0213876_10120234 3300021384 Bacteria 1394
95 Ga0213875_10093728 3300021388 Bacteria 1400
96 Ga0213875_10207252 3300021388 Bacteria 923
97 Ga0209758_1001665 3300025297 Bacteria 25124
98 Ga0209050_1000101 3300025298 Bacteria 230076
99 Ga0209257_1000221 3300025304 Bacteria 134870
100 Ga0209257_1002453 3300025304 Bacteria 18398
101 Ga0207710_10047865 3300025900 Bacteria 1912
102 Ga0207680_10013441 3300025903 Bacteria 4205
103 Ga0207680_10152461 3300025903 Bacteria 1542
104 Ga0207705_10232616 3300025909 Bacteria 1402
105 Ga0207705_10270835 3300025909 Bacteria 1298
106 Ga0207684_10048196 3300025910 Bacteria 3613
107 Ga0207707_10013828 3300025912 Bacteria 7038
108 Ga0207695_10001229 3300025913 Bacteria 43850
109 Ga0207695_10040013 3300025913 Bacteria 5033
110 Ga0207695_10056250 3300025913 Bacteria 4095
111 Ga0207695_10267226 3300025913 Bacteria 1607
112 Ga0207657_10054993 3300025919 Bacteria 3439
113 Ga0207652_10165766 3300025921 Bacteria 1981
114 Ga0207652_10226356 3300025921 Bacteria 1685
115 Ga0207646_10371218 3300025922 Bacteria 1292
116 Ga0207681_10020979 3300025923 Bacteria 4147
117 Ga0207694_10127464 3300025924 Bacteria 2037
118 Ga0207650_10000062 3300025925 Bacteria 149776
119 Ga0207650_10028294 3300025925 Bacteria 4017
120 Ga0207644_10002578 3300025931 Bacteria 11664
121 Ga0207690_10000129 3300025932 Bacteria 62350
122 Ga0207706_10654579 3300025933 Bacteria 899
123 Ga0207704_10000400 3300025938 Bacteria 19733
124 Ga0207665_10035907 3300025939 Unclassified 3293
125 Ga0207711_10192753 3300025941 Bacteria 1858
126 Ga0207679_10018430 3300025945 Bacteria 4677
127 Ga0207667_10039007 3300025949 Bacteria 5065
128 Ga0207667_10105523 3300025949 Bacteria 2907
129 Ga0207667_10136262 3300025949 Bacteria 2528
130 Ga0207667_10177018 3300025949 Bacteria 2191
131 Ga0207667_10793450 3300025949 Bacteria 944
132 Ga0207712_10001004 3300025961 Bacteria 20092
133 Ga0207668_10000028 3300025972 Bacteria 125361
134 Ga0207668_10000507 3300025972 Bacteria 24393
135 Ga0207668_10001494 3300025972 Bacteria 13660
136 Ga0207658_10000209 3300025986 Bacteria 61041
137 Ga0207658_10005903 3300025986 Bacteria 8364
138 Ga0207658_10372792 3300025986 Bacteria 1248
139 Ga0207703_10003741 3300026035 Bacteria 12658
140 Ga0207639_10033221 3300026041 Bacteria 3804
141 Ga0207641_10000341 3300026088 Bacteria 56155
142 Ga0207641_10240162 3300026088 Bacteria 1688
143 Ga0207676_10000797 3300026095 Bacteria 24574
144 Ga0207698_10561179 3300026142 Bacteria 1121
145 Ga0209813_10002036 3300027866 Bacteria 4586
146 Ga0268266_10000064 3300028379 Bacteria 249533
147 Ga0268266_10000792 3300028379 Bacteria 42146
148 Ga0268266_10001340 3300028379 Bacteria 29786
149 Ga0268265_10002811 3300028380 Bacteria 12812
150 Ga0268265_10004003 3300028380 Bacteria 10375
151 Ga0268265_10037939 3300028380 Bacteria 3540
152 Ga0268264_10000046 3300028381 Bacteria 364597
153 Ga0268264_10000059 3300028381 Bacteria 306927
154 Ga0268264_10091708 3300028381 Bacteria 2621
155 Ga0268264_10523274 3300028381 Bacteria 1160
156 Ga0265334_10010379 3300028573 Bacteria 3935
157 Ga0307517_10063398 3300028786 Bacteria 3457
158 Ga0265338_10009139 3300028800 Bacteria 11899
159 Ga0265338_10019638 3300028800 Bacteria 7153
160 Ga0265327_10000682 3300031251 Bacteria 54560
161 Ga0265327_10034801 3300031251 Bacteria 2791
162 Ga0307513_10000448 3300031456 Bacteria 59427
163 Ga0316576_10020795 3300031727 Bacteria 4527
164 Ga0316576_10043412 3300031727 Bacteria 3244
165 Ga0316576_10063715 3300031727 Bacteria 2706
166 Ga0316578_10049680 3300031728 Bacteria 2452
167 Ga0316578_10250784 3300031728 Bacteria 1062
168 Ga0307414_10033024 3300032004 Bacteria 3415
169 Ga0307414_10394014 3300032004 Bacteria 1201
170 Ga0307510_10078953 3300033180 Bacteria 3214
171 Ga0316596_1025108 3300033541 Bacteria 1532
172 Ga0373960_0031795 3300035121 Bacteria 1478
173 Ga0316574_0008955 3300035398 Bacteria 5589
174 Ga0316574_0014936 3300035398 Bacteria 4499
175 Ga0316574_0034825 3300035398 Bacteria 3073
176 Ga0316582_0242480 3300036647 Bacteria 1235
177 Ga0316584_0011355 3300036712 Bacteria 6256
178 Ga0316584_0109343 3300036712 Bacteria 2069
179 Ga0316584_0129442 3300036712 Bacteria 1885
180 Ga0395899_0023296 3300037312 Bacteria 4693
181 Ga0395900_0122448 3300037418 Bacteria 2668
182 Ga0395898_0102107 3300037466 Bacteria 2753
183 Ga0395905_0016382 3300037471 Bacteria 7042
184 Ga0395905_0393991 3300037471 Bacteria 1279
185 Ga0436364_0369116 3300037853 Bacteria 954
186 Ga0436364_1349678 3300037853 Bacteria 1329
187 Ga0395901_0016144 3300038443 Bacteria 7606
188 Ga0395901_0033445 3300038443 Bacteria 5309
189 Ga0436365_0629243 3300039437 Bacteria 13018
190 Ga0436365_0678918 3300039437 Bacteria 6672
191 Ga0436365_0787469 3300039437 Bacteria 3493
192 Ga0436365_1225891 3300039437 Bacteria 1954
193 Ga0436365_1465422 3300039437 Bacteria 1634
194 Ga0436365_1655540 3300039437 Bacteria 20314
195 Ga0436361_0686811 3300039447 Bacteria 1838
196 Ga0436361_1173302 3300039447 Bacteria 1453
197 Ga0436363_0577559 3300039450 Bacteria 1670
198 Ga0450901_004293 3300042533 Bacteria 1476
199 Ga0466964_0166334 3300044706 Bacteria 1035
200 Ga0495638_0004783 3300046460 Bacteria 10208
201 Ga0495642_0020031 3300046528 Bacteria 2624
202 Ga0495597_0001737 3300046542 Bacteria 15014
203 Ga0495633_0001548 3300046558 Bacteria 17646
204 Ga0495668_0044084 3300046616 Bacteria 2479
205 Ga0495625_0149041 3300046660 Bacteria 1574
206 Ga0495625_0262319 3300046660 Bacteria 1117
207 Ga0495669_0000024 3300046684 Bacteria 113943
208 Ga0495669_0000199 3300046684 Bacteria 36829
209 Ga0495649_0000538 3300046694 Bacteria 32158
210 Ga0495677_0047312 3300047445 Bacteria 1579
211 Ga0495677_0072970 3300047445 Bacteria 1280
212 Ga0496103_0066355 3300048906 Bacteria 2252
213 Ga0496106_0277296 3300048909 Bacteria 1343
214 Ga0496107_0174991 3300048910 Bacteria 1593
215 Ga0496115_0003418 3300048918 Bacteria 11405
216 Ga0496115_0101515 3300048918 Bacteria 2359
217 Ga0496123_0001713 3300048926 Bacteria 29280
218 Ga0496125_0002624 3300048928 Bacteria 23043
219 Ga0501032_0114368 3300049569 Bacteria 1785
220 Ga0501033_0055218 3300049570 Bacteria 2937
221 Ga0501070_0200914 3300049586 Bacteria 1637
222 Ga0501044_0218134 3300049823 Bacteria 1859
223 nmdc:mga00v17_423_c1 3300050491 Bacteria 23976
224 nmdc:mga06z11_15466_c1 3300050494 Bacteria 3407
225 nmdc:mga04h51_1841_c1 3300050495 Bacteria 4961
226 nmdc:mga07m45_1047_c1 3300050496 Bacteria 12323
227 Ga0500643_005940 3300053087 Bacteria 5178
228 Ga0500647_0001478 3300053091 Bacteria 8090
229 Ga0500641_0000513 3300053096 Bacteria 13949
230 Ga0500569_001981 3300053109 Bacteria 3969
231 Ga0500559_0000077 3300053136 Bacteria 76287
232 Ga0500577_0009592 3300053142 Bacteria 2816
233 Ga0500638_157765 3300053162 Bacteria 1002
234 Ga0500636_0012949 3300053177 Bacteria 4894
235 2739791365 2739367756 Bacteria 4553612
236 2928975081 2928972540 Bacteria 3058286
237 2941488495 2941485952 Bacteria 3591484
238 2977241926 2977240413 Bacteria 3191065
239 Ga0495672_0000632
240 Ga0055530_10000685
241 Ga0055531_10004322
242 Ga0070670_100000037
243 Ga0070670_100040335
244 Ga0070666_10230375
245 Ga0070680_100025744
246 Ga0070660_100347043
247 Ga0070691_10011443
248 Ga0070668_100000097
249 Ga0070668_100018957
250 Ga0070669_100007690
251 Ga0070671_100000342
252 Ga0070671_100131586
253 Ga0070659_100000206
254 Ga0070659_100013775
255 Ga0070667_100000083
256 Ga0070667_100015622
257 Ga0070667_100286697
258 Ga0070681_10017736
259 Ga0070706_100260560
260 Ga0070706_100280043
261 Ga0070707_100406537
262 Ga0070698_100004235
263 Ga0070679_100003462
264 Ga0070697_100064937
265 Ga0068853_100074102
266 Ga0068853_100517171
267 Ga0070665_100000116
268 Ga0070665_100000278
269 Ga0070665_100000483
270 Ga0070665_100129119
271 Ga0070665_100258217
272 Ga0068855_100048334
273 Ga0068855_100051066
274 Ga0068855_100220141
275 Ga0068855_100266855
276 Ga0070664_100025727
277 Ga0068852_100120426
278 Ga0068852_100128448
279 Ga0068859_100000435
280 Ga0068859_100298525
281 Ga0068859_100317741
282 Ga0068864_100000786
283 Ga0068863_100001697
284 Ga0068863_100014231
285 Ga0068863_100172768
286 Ga0068858_100021274
287 Ga0068858_100578672
288 Ga0068860_100000128
289 Ga0068860_100731772
290 Ga0068862_100001627
291 Ga0068862_100005242
292 Ga0068862_100007701
293 Ga0070717_10352215
294 Ga0075364_10000306
295 Ga0070716_100144120
296 Ga0075367_10015158
297 Ga0075369_10021117
298 Ga0075370_10019459
299 Ga0068871_100414194
300 Ga0068865_100005340
301 Ga0097620_100000435
302 Ga0097620_100298527
303 Ga0097620_100317746
304 Ga0105240_10066735
305 Ga0105240_10119671
306 Ga0105240_10571616
307 Ga0105247_10120849
308 Ga0105248_10007787
309 Ga0105248_10156746
310 Ga0105248_10332704
311 Ga0105238_10156107
312 Ga0105249_10010617
313 Ga0105239_10249639
314 Ga0105239_10290314
315 Ga0157373_10001429
316 Ga0157373_10008774
317 Ga0157370_10079389
318 Ga0157370_10196112
319 Ga0157370_10300514
320 Ga0157370_10544606
321 Ga0157369_10071812
322 Ga0163162_10027619
323 Ga0163162_10046155
324 Ga0163163_10014023
325 Ga0163163_10058081
326 Ga0163163_10075508
327 Ga0157379_10006808
328 Ga0157379_10007276
329 Ga0213872_10015402
330 Ga0213876_10000320
331 Ga0213876_10007130
332 Ga0213876_10120234
333 Ga0213875_10093728
334 Ga0213875_10207252
335 Ga0209758_1001665
336 Ga0209050_1000101
337 Ga0209257_1000221
338 Ga0209257_1002453
339 Ga0207710_10047865
340 Ga0207680_10013441
341 Ga0207680_10152461
342 Ga0207705_10232616
343 Ga0207705_10270835
344 Ga0207684_10048196
345 Ga0207707_10013828
346 Ga0207695_10001229
347 Ga0207695_10040013
348 Ga0207695_10056250
349 Ga0207695_10267226
350 Ga0207657_10054993
351 Ga0207652_10165766
352 Ga0207652_10226356
353 Ga0207646_10371218
354 Ga0207681_10020979
355 Ga0207694_10127464
356 Ga0207650_10000062
357 Ga0207650_10028294
358 Ga0207644_10002578
359 Ga0207690_10000129
360 Ga0207706_10654579
361 Ga0207704_10000400
362 Ga0207665_10035907
363 Ga0207711_10192753
364 Ga0207679_10018430
365 Ga0207667_10039007
366 Ga0207667_10105523
367 Ga0207667_10136262
368 Ga0207667_10177018
369 Ga0207667_10793450
370 Ga0207712_10001004
371 Ga0207668_10000028
372 Ga0207668_10000507
373 Ga0207668_10001494
374 Ga0207658_10000209
375 Ga0207658_10005903
376 Ga0207658_10372792
377 Ga0207703_10003741
378 Ga0207639_10033221
379 Ga0207641_10000341
380 Ga0207641_10240162
381 Ga0207676_10000797
382 Ga0207698_10561179
383 Ga0209813_10002036
384 Ga0268266_10000064
385 Ga0268266_10000792
386 Ga0268266_10001340
387 Ga0268265_10002811
388 Ga0268265_10004003
389 Ga0268265_10037939
390 Ga0268264_10000046
391 Ga0268264_10000059
392 Ga0268264_10091708
393 Ga0268264_10523274
394 Ga0265334_10010379
395 Ga0307517_10063398
396 Ga0265338_10009139
397 Ga0265338_10019638
398 Ga0265327_10000682
399 Ga0265327_10034801
400 Ga0307513_10000448
401 Ga0316576_10020795
402 Ga0316576_10043412
403 Ga0316576_10063715
404 Ga0316578_10049680
405 Ga0316578_10250784
406 Ga0307414_10033024
407 Ga0307414_10394014
408 Ga0307510_10078953
409 Ga0316596_1025108
410 Ga0373960_0031795
411 Ga0316574_0008955
412 Ga0316574_0014936
413 Ga0316574_0034825
414 Ga0316582_0242480
415 Ga0316584_0011355
416 Ga0316584_0109343
417 Ga0316584_0129442
418 Ga0395899_0023296
419 Ga0395900_0122448
420 Ga0395898_0102107
421 Ga0395905_0016382
422 Ga0395905_0393991
423 Ga0436364_0369116
424 Ga0436364_1349678
425 Ga0395901_0016144
426 Ga0395901_0033445
427 Ga0436365_0629243
428 Ga0436365_0678918
429 Ga0436365_0787469
430 Ga0436365_1225891
431 Ga0436365_1465422
432 Ga0436365_1655540
433 Ga0436361_0686811
434 Ga0436361_1173302
435 Ga0436363_0577559
436 Ga0450901_004293
437 Ga0466964_0166334
438 Ga0495638_0004783
439 Ga0495642_0020031
440 Ga0495597_0001737
441 Ga0495633_0001548
442 Ga0495668_0044084
443 Ga0495625_0149041
444 Ga0495625_0262319
445 Ga0495669_0000024
446 Ga0495669_0000199
447 Ga0495649_0000538
448 Ga0495677_0047312
449 Ga0495677_0072970
450 Ga0496103_0066355
451 Ga0496106_0277296
452 Ga0496107_0174991
453 Ga0496115_0003418
454 Ga0496115_0101515
455 Ga0496123_0001713
456 Ga0496125_0002624
457 Ga0501032_0114368
458 Ga0501033_0055218
459 Ga0501070_0200914
460 Ga0501044_0218134
461 nmdc:mga00v17_423_c1
462 nmdc:mga06z11_15466_c1
463 nmdc:mga04h51_1841_c1
464 nmdc:mga07m45_1047_c1
465 Ga0500643_005940
466 Ga0500647_0001478
467 Ga0500641_0000513
468 Ga0500569_001981
469 Ga0500559_0000077
470 Ga0500577_0009592
471 Ga0500638_157765
472 Ga0500636_0012949
473 2739791365
474 2928975081
475 2941488495
476 2977241926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

27

267

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nvt-assembly2.cif.gz_B crystal structure of triosephosphate isomerase from brucella melitensis 0.9598 6 246
3kxq-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9582 6 246
3kxq-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution 0.9543 6 246
4y9a-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from streptomyces coelicolor 0.9501 5 246
4nvt-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from brucella melitensis 0.9497 6 246
ID Description Score Start End Superfamily
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9738 6 246 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9544 4 246 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9489 3 246 3.20.20.70
4nvtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9468 6 246 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9372 4 246 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A435EAS4-F1-model_v4 deleted 0.9809 45 246
AF-V4Q861-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9805 4 246 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7T8Y0K9-F1-model_v4 deleted 0.9799 2 247
AF-A0A3M2E7I9-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9799 4 247 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A0P1E0U1-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9797 2 246 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map