F351806

General Info

Members Datasets Scaffolds Average Seq Length
239 144 239 125

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1152510|Ga0081540_11525101
Length 132
Sequence LRGSSKQVTVLIDSDILIEVSRGRNTAVVSKWIELSTSDALVLFSPVTAAELWAGARPAEYKALEALFEALVCVPADAAVGRQAGEYLRRYRKSHAVELGDALIAASTVVSGALLWTRNRKHYPMSDLTFFD

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.09
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10120561 3300005295 Bacteria 2099
2 Ga0070683_100000049 3300005329 Bacteria 93310
3 Ga0070683_100279618 3300005329 Bacteria 1588
4 Ga0070690_100143702 3300005330 Bacteria 1621
5 Ga0068869_100306433 3300005334 Bacteria 1284
6 Ga0068869_100528372 3300005334 Unclassified 988
7 Ga0068869_100821992 3300005334 Bacteria 800
8 Ga0070666_10033902 3300005335 Bacteria 3382
9 Ga0068868_100070083 3300005338 Bacteria 2795
10 Ga0070660_100815661 3300005339 Unclassified 785
11 Ga0070669_101415141 3300005353 Unclassified 603
12 Ga0070659_100451617 3300005366 Bacteria 1090
13 Ga0070667_100052210 3300005367 Bacteria 3449
14 Ga0070667_101245044 3300005367 Unclassified 697
15 Ga0070714_100110579 3300005435 Unclassified 2432
16 Ga0070710_10306664 3300005437 Unclassified 1038
17 Ga0070705_100813330 3300005440 Bacteria 744
18 Ga0070700_100342518 3300005441 Bacteria 1105
19 Ga0070694_100597605 3300005444 Unclassified 888
20 Ga0070708_100030673 3300005445 Bacteria 4648
21 Ga0070708_100039108 3300005445 Bacteria 4148
22 Ga0070681_10073431 3300005458 Bacteria 3382
23 Ga0068867_100066821 3300005459 Bacteria 2679
24 Ga0068867_100262756 3300005459 Unclassified 1408
25 Ga0068867_100332458 3300005459 Bacteria 1262
26 Ga0070706_100023366 3300005467 Bacteria 5693
27 Ga0070706_100139265 3300005467 Unclassified 2265
28 Ga0070707_100007037 3300005468 Bacteria 10436
29 Ga0070707_100223045 3300005468 Bacteria 1836
30 Ga0070679_100576431 3300005530 Unclassified 1069
31 Ga0070679_100885942 3300005530 Unclassified 836
32 Ga0070684_100000040 3300005535 Bacteria 93306
33 Ga0070684_100029124 3300005535 Bacteria 4677
34 Ga0070697_101621771 3300005536 Unclassified 578
35 Ga0068853_100170276 3300005539 Bacteria 1970
36 Ga0068853_100237205 3300005539 Unclassified 1670
37 Ga0068853_100584222 3300005539 Bacteria 1060
38 Ga0070686_100059805 3300005544 Bacteria 2456
39 Ga0070686_100909574 3300005544 Bacteria 716
40 Ga0070696_100330778 3300005546 Bacteria 1175
41 Ga0070704_100061827 3300005549 Bacteria 2682
42 Ga0068855_100051195 3300005563 Bacteria 4865
43 Ga0068855_100101531 3300005563 Unclassified 3311
44 Ga0068855_100119428 3300005563 Bacteria 3018
45 Ga0068855_100353087 3300005563 Unclassified 1619
46 Ga0070664_100368652 3300005564 Bacteria 1309
47 Ga0070664_101246516 3300005564 Bacteria 702
48 Ga0068857_100061688 3300005577 Bacteria 3331
49 Ga0068857_100285980 3300005577 Bacteria 1517
50 Ga0068856_100255839 3300005614 Unclassified 1766
51 Ga0068856_100798723 3300005614 Unclassified 963
52 Ga0068852_100017918 3300005616 Bacteria 5569
53 Ga0068859_100139180 3300005617 Bacteria 2501
54 Ga0068864_100370630 3300005618 Bacteria 1355
55 Ga0068866_10448062 3300005718 Unclassified 843
56 Ga0068866_10520639 3300005718 Unclassified 790
57 Ga0068863_100088560 3300005841 Bacteria 2934
58 Ga0068863_100160195 3300005841 Bacteria 2156
59 Ga0068863_102198231 3300005841 Unclassified 562
60 Ga0068858_100031642 3300005842 Bacteria 4915
61 Ga0068858_102436086 3300005842 Unclassified 517
62 Ga0068860_100017992 3300005843 Bacteria 6883
63 Ga0068860_100048152 3300005843 Bacteria 4063
64 Ga0081540_1152510 3300005983 Bacteria 909
65 Ga0070717_10012713 3300006028 Bacteria 6425
66 Ga0070715_10195009 3300006163 Bacteria 1025
67 Ga0070716_100052951 3300006173 Bacteria 2312
68 Ga0070716_100128869 3300006173 Bacteria 1596
69 Ga0097621_100016251 3300006237 Bacteria 5620
70 Ga0097621_100266894 3300006237 Bacteria 1503
71 Ga0097621_100589462 3300006237 Unclassified 1015
72 Ga0068871_100173443 3300006358 Unclassified 1850
73 Ga0075430_100551862 3300006846 Bacteria 950
74 Ga0068865_100056758 3300006881 Bacteria 2729
75 Ga0075436_100010378 3300006914 Bacteria 6382
76 Ga0097620_100139180 3300006931 Bacteria 2501
77 Ga0075435_100123490 3300007076 Bacteria 2162
78 Ga0075435_100282452 3300007076 Unclassified 1417
79 Ga0099794_10034127 3300007265 Bacteria 2395
80 Ga0105240_10059309 3300009093 Bacteria 4776
81 Ga0105240_10106984 3300009093 Bacteria 3392
82 Ga0105240_10144840 3300009093 Bacteria 2836
83 Ga0105245_10010745 3300009098 Bacteria 7965
84 Ga0105245_10018954 3300009098 Bacteria 6023
85 Ga0105247_10143067 3300009101 Bacteria 1569
86 Ga0105247_10179258 3300009101 Unclassified 1413
87 Ga0105247_11223452 3300009101 Bacteria 599
88 Ga0105241_10129032 3300009174 Unclassified 2045
89 Ga0105241_10366895 3300009174 Unclassified 1254
90 Ga0105242_10056202 3300009176 Bacteria 3220
91 Ga0105242_10074507 3300009176 Bacteria 2824
92 Ga0105242_10210484 3300009176 Bacteria 1733
93 Ga0105248_10009850 3300009177 Bacteria 10527
94 Ga0105248_10017165 3300009177 Bacteria 7974
95 Ga0105248_10023511 3300009177 Bacteria 6845
96 Ga0105248_10219713 3300009177 Bacteria 2139
97 Ga0105248_10892749 3300009177 Unclassified 1003
98 Ga0105248_11261894 3300009177 Unclassified 835
99 Ga0105237_10078870 3300009545 Bacteria 3283
100 Ga0105237_10358542 3300009545 Bacteria 1462
101 Ga0105238_10045884 3300009551 Bacteria 4413
102 Ga0105249_10106940 3300009553 Bacteria 2640
103 Ga0105239_10133525 3300010375 Bacteria 2762
104 Ga0105239_10531455 3300010375 Bacteria 1338
105 Ga0105239_10569207 3300010375 Bacteria 1291
106 Ga0105239_11270428 3300010375 Bacteria 849
107 Ga0105246_10060253 3300011119 Bacteria 2636
108 Ga0157370_10001165 3300013104 Bacteria 32739
109 Ga0157370_10170692 3300013104 Unclassified 2022
110 Ga0157370_10182139 3300013104 Bacteria 1952
111 Ga0157369_10034038 3300013105 Bacteria 5595
112 Ga0157369_10053425 3300013105 Bacteria 4367
113 Ga0157369_11196673 3300013105 Bacteria 776
114 Ga0157374_10066004 3300013296 Bacteria 3400
115 Ga0157374_10507251 3300013296 Bacteria 1211
116 Ga0157378_10000081 3300013297 Bacteria 88506
117 Ga0157378_10059197 3300013297 Bacteria 3417
118 Ga0157378_10580266 3300013297 Bacteria 1130
119 Ga0163162_10036632 3300013306 Bacteria 4892
120 Ga0163162_10344861 3300013306 Bacteria 1622
121 Ga0157372_10161665 3300013307 Unclassified 2588
122 Ga0157372_10673190 3300013307 Unclassified 1205
123 Ga0157372_12631287 3300013307 Unclassified 577
124 Ga0157375_10201079 3300013308 Bacteria 2148
125 Ga0157375_10344689 3300013308 Bacteria 1655
126 Ga0163163_10019887 3300014325 Bacteria 6314
127 Ga0163163_10029485 3300014325 Bacteria 5278
128 Ga0163163_10898538 3300014325 Unclassified 949
129 Ga0157379_10083515 3300014968 Bacteria 2863
130 Ga0157376_10000050 3300014969 Bacteria 104192
131 Ga0157376_10078600 3300014969 Bacteria 2825
132 Ga0157376_10463252 3300014969 Bacteria 1239
133 Ga0213876_10057256 3300021384 Bacteria 2058
134 Ga0213875_10000006 3300021388 Bacteria 579005
135 Ga0213875_10021755 3300021388 Bacteria 3069
136 Ga0213875_10070182 3300021388 Bacteria 1635
137 Ga0228598_1000054 3300024227 Bacteria 16523
138 Ga0207642_10315018 3300025899 Unclassified 912
139 Ga0207642_10505473 3300025899 Unclassified 740
140 Ga0207710_10131095 3300025900 Bacteria 1204
141 Ga0207680_10005190 3300025903 Bacteria 6211
142 Ga0207705_10862458 3300025909 Unclassified 702
143 Ga0207684_10020022 3300025910 Bacteria 5717
144 Ga0207684_10446005 3300025910 Unclassified 1111
145 Ga0207654_10035326 3300025911 Bacteria 2784
146 Ga0207707_10369369 3300025912 Bacteria 1234
147 Ga0207707_10460261 3300025912 Unclassified 1088
148 Ga0207695_10110064 3300025913 Bacteria 2735
149 Ga0207695_10112330 3300025913 Bacteria 2703
150 Ga0207695_10949669 3300025913 Bacteria 739
151 Ga0207671_10020860 3300025914 Bacteria 4982
152 Ga0207693_10130085 3300025915 Bacteria 1979
153 Ga0207660_10545093 3300025917 Unclassified 943
154 Ga0207657_10131016 3300025919 Bacteria 2055
155 Ga0207657_10217600 3300025919 Bacteria 1531
156 Ga0207646_10061315 3300025922 Bacteria 3357
157 Ga0207694_10076088 3300025924 Bacteria 2628
158 Ga0207694_10555107 3300025924 Bacteria 964
159 Ga0207687_10006980 3300025927 Bacteria 7440
160 Ga0207687_10063625 3300025927 Bacteria 2612
161 Ga0207687_10788710 3300025927 Bacteria 810
162 Ga0207690_10824347 3300025932 Bacteria 767
163 Ga0207686_10118938 3300025934 Unclassified 1795
164 Ga0207686_10134698 3300025934 Bacteria 1699
165 Ga0207686_10138141 3300025934 Bacteria 1681
166 Ga0207704_10056402 3300025938 Bacteria 2406
167 Ga0207665_10012926 3300025939 Bacteria 5491
168 Ga0207711_10005672 3300025941 Bacteria 10545
169 Ga0207711_10022577 3300025941 Bacteria 5264
170 Ga0207711_10200300 3300025941 Bacteria 1822
171 Ga0207711_11410396 3300025941 Unclassified 639
172 Ga0207689_10540869 3300025942 Bacteria 978
173 Ga0207689_11472743 3300025942 Unclassified 569
174 Ga0207661_10000050 3300025944 Bacteria 93646
175 Ga0207679_11116651 3300025945 Bacteria 723
176 Ga0207667_10114582 3300025949 Bacteria 2778
177 Ga0207667_10311585 3300025949 Bacteria 1608
178 Ga0207667_10542191 3300025949 Unclassified 1177
179 Ga0207667_11083562 3300025949 Bacteria 785
180 Ga0207712_10985284 3300025961 Unclassified 747
181 Ga0207658_10377690 3300025986 Bacteria 1240
182 Ga0207677_10066409 3300026023 Bacteria 2522
183 Ga0207703_10032594 3300026035 Bacteria 4124
184 Ga0207639_10607318 3300026041 Unclassified 1009
185 Ga0207639_10610661 3300026041 Bacteria 1006
186 Ga0207708_10410990 3300026075 Bacteria 1121
187 Ga0207702_10203597 3300026078 Unclassified 1836
188 Ga0207702_10236120 3300026078 Unclassified 1711
189 Ga0207702_10743618 3300026078 Unclassified 968
190 Ga0207641_10026712 3300026088 Bacteria 4766
191 Ga0207641_10104101 3300026088 Bacteria 2505
192 Ga0207641_10761108 3300026088 Bacteria 956
193 Ga0207648_10007528 3300026089 Bacteria 10690
194 Ga0207676_10281920 3300026095 Bacteria 1509
195 Ga0207674_10013533 3300026116 Bacteria 9045
196 Ga0207674_10059137 3300026116 Bacteria 3880
197 Ga0207675_100376881 3300026118 Bacteria 1395
198 Ga0268266_10579229 3300028379 Unclassified 1077
199 Ga0268264_10017712 3300028381 Bacteria 5832
200 Ga0268264_10022451 3300028381 Bacteria 5153
201 Ga0265323_10003557 3300028653 Bacteria 6856
202 Ga0265338_10130478 3300028800 Bacteria 1986
203 Ga0265770_1046812 3300030878 Bacteria 772
204 Ga0265330_10395784 3300031235 Unclassified 584
205 Ga0265325_10107845 3300031241 Unclassified 1357
206 Ga0265325_10129718 3300031241 Unclassified 1208
207 Ga0265339_10156392 3300031249 Bacteria 1150
208 Ga0265316_10008184 3300031344 Bacteria 9729
209 Ga0265316_10347833 3300031344 Bacteria 1073
210 Ga0265314_10000723 3300031711 Bacteria 39953
211 Ga0265342_10081506 3300031712 Bacteria 1868
212 Ga0373955_0053591 3300035172 Bacteria 2203
213 Ga0395900_0108479 3300037418 Unclassified 2852
214 Ga0436364_0478514 3300037853 Bacteria 578677
215 Ga0436364_0631627 3300037853 Bacteria 4357
216 Ga0436364_0841135 3300037853 Bacteria 3069
217 Ga0436364_0956168 3300037853 Bacteria 1778
218 Ga0436364_1523115 3300037853 Unclassified 692
219 Ga0436365_0031945 3300039437 Bacteria 1880
220 Ga0436365_0051887 3300039437 Unclassified 1552
221 Ga0436360_1276510 3300039438 Unclassified 503
222 Ga0436363_1247706 3300039450 Unclassified 920
223 Ga0436362_1254778 3300039453 Bacteria 2003
224 Ga0495580_0873770 3300046472 Unclassified 579
225 Ga0495628_0564694 3300046516 Unclassified 816
226 Ga0495587_0615127 3300046536 Unclassified 598
227 Ga0495645_0303605 3300046543 Unclassified 1042
228 Ga0495649_0352741 3300046694 Unclassified 743
229 Ga0495674_0295084 3300047319 Unclassified 1325
230 Ga0495684_0340752 3300047471 Bacteria 1067
231 Ga0496102_0112612 3300048905 Bacteria 2538
232 Ga0496103_0774508 3300048906 Unclassified 606
233 Ga0496106_0043465 3300048909 Bacteria 3371
234 Ga0496114_0035933 3300048917 Bacteria 4094
235 Ga0496115_0199201 3300048918 Bacteria 1654
236 nmdc:mga0qj67_1303101_c1 3300050509 Unclassified 563
237 nmdc:mga0rr50_190070_c1 3300050513 Bacteria 1682
238 nmdc:mga08x19_464_c1 3300050514 Bacteria 27378
239 Ga0500552_032238 3300053733 Unclassified 813

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031249 Ga0265339_10156392 Ga0265339_101563922 118
2 3300005841 Ga0068863_100160195 Ga0068863_1001601952 121
3 3300009101 Ga0105247_11223452 Ga0105247_112234521 121
4 3300009177 Ga0105248_11261894 Ga0105248_112618942 121
5 3300014325 Ga0163163_10029485 Ga0163163_100294852 121
6 3300025941 Ga0207711_10200300 Ga0207711_102003002 121
7 3300026088 Ga0207641_10104101 Ga0207641_101041012 121
8 3300005329 Ga0070683_100000049 Ga0070683_10000004928 122
9 3300005329 Ga0070683_100279618 Ga0070683_1002796183 122
10 3300005330 Ga0070690_100143702 Ga0070690_1001437023 122
11 3300005334 Ga0068869_100306433 Ga0068869_1003064333 122
12 3300005334 Ga0068869_100821992 Ga0068869_1008219921 122
13 3300005335 Ga0070666_10033902 Ga0070666_100339022 122
14 3300005338 Ga0068868_100070083 Ga0068868_1000700833 122
15 3300005366 Ga0070659_100451617 Ga0070659_1004516171 122
16 3300005367 Ga0070667_100052210 Ga0070667_1000522102 122
17 3300005367 Ga0070667_101245044 Ga0070667_1012450442 122
18 3300005440 Ga0070705_100813330 Ga0070705_1008133302 122
19 3300005445 Ga0070708_100030673 Ga0070708_1000306734 122
20 3300005458 Ga0070681_10073431 Ga0070681_100734312 122
21 3300005459 Ga0068867_100066821 Ga0068867_1000668212 122
22 3300005459 Ga0068867_100262756 Ga0068867_1002627563 122
23 3300005530 Ga0070679_100885942 Ga0070679_1008859422 122
24 3300005535 Ga0070684_100000040 Ga0070684_10000004028 122
25 3300005535 Ga0070684_100029124 Ga0070684_1000291245 122
26 3300005539 Ga0068853_100170276 Ga0068853_1001702761 122
27 3300005539 Ga0068853_100237205 Ga0068853_1002372053 122
28 3300005539 Ga0068853_100584222 Ga0068853_1005842223 122
29 3300005544 Ga0070686_100909574 Ga0070686_1009095742 122
30 3300005563 Ga0068855_100101531 Ga0068855_1001015312 122
31 3300005563 Ga0068855_100119428 Ga0068855_1001194282 122
32 3300005563 Ga0068855_100353087 Ga0068855_1003530874 122
33 3300005564 Ga0070664_100368652 Ga0070664_1003686522 122
34 3300005564 Ga0070664_101246516 Ga0070664_1012465162 122
35 3300005577 Ga0068857_100061688 Ga0068857_1000616882 122
36 3300005577 Ga0068857_100285980 Ga0068857_1002859802 122
37 3300005617 Ga0068859_100139180 Ga0068859_1001391802 122
38 3300005618 Ga0068864_100370630 Ga0068864_1003706302 122
39 3300005718 Ga0068866_10520639 Ga0068866_105206392 122
40 3300005841 Ga0068863_100088560 Ga0068863_1000885603 122
41 3300005841 Ga0068863_102198231 Ga0068863_1021982311 122
42 3300005842 Ga0068858_100031642 Ga0068858_1000316424 122
43 3300005842 Ga0068858_102436086 Ga0068858_1024360861 122
44 3300005843 Ga0068860_100017992 Ga0068860_1000179922 122
45 3300006163 Ga0070715_10195009 Ga0070715_101950092 122
46 3300006173 Ga0070716_100128869 Ga0070716_1001288692 122
47 3300006237 Ga0097621_100016251 Ga0097621_1000162512 122
48 3300006237 Ga0097621_100266894 Ga0097621_1002668941 122
49 3300006358 Ga0068871_100173443 Ga0068871_1001734433 122
50 3300006881 Ga0068865_100056758 Ga0068865_1000567582 122
51 3300006914 Ga0075436_100010378 Ga0075436_1000103783 122
52 3300006931 Ga0097620_100139180 Ga0097620_1001391802 122
53 3300007076 Ga0075435_100282452 Ga0075435_1002824522 122
54 3300007265 Ga0099794_10034127 Ga0099794_100341272 122
55 3300009093 Ga0105240_10106984 Ga0105240_101069844 122
56 3300009093 Ga0105240_10144840 Ga0105240_101448403 122
57 3300009098 Ga0105245_10010745 Ga0105245_1001074510 122
58 3300009098 Ga0105245_10018954 Ga0105245_100189546 122
59 3300009101 Ga0105247_10143067 Ga0105247_101430672 122
60 3300009174 Ga0105241_10129032 Ga0105241_101290323 122
61 3300009176 Ga0105242_10074507 Ga0105242_100745072 122
62 3300009176 Ga0105242_10210484 Ga0105242_102104842 122
63 3300009177 Ga0105248_10023511 Ga0105248_100235119 122
64 3300009177 Ga0105248_10219713 Ga0105248_102197132 122
65 3300009177 Ga0105248_10892749 Ga0105248_108927491 122
66 3300009545 Ga0105237_10078870 Ga0105237_100788702 122
67 3300009551 Ga0105238_10045884 Ga0105238_100458842 122
68 3300010375 Ga0105239_10133525 Ga0105239_101335252 122
69 3300010375 Ga0105239_10531455 Ga0105239_105314554 122
70 3300010375 Ga0105239_11270428 Ga0105239_112704282 122
71 3300011119 Ga0105246_10060253 Ga0105246_100602533 122
72 3300013104 Ga0157370_10170692 Ga0157370_101706922 122
73 3300013105 Ga0157369_10034038 Ga0157369_100340382 122
74 3300013105 Ga0157369_11196673 Ga0157369_111966732 122
75 3300013296 Ga0157374_10066004 Ga0157374_100660043 122
76 3300013296 Ga0157374_10507251 Ga0157374_105072513 122
77 3300013297 Ga0157378_10059197 Ga0157378_100591973 122
78 3300013297 Ga0157378_10580266 Ga0157378_105802662 122
79 3300013306 Ga0163162_10036632 Ga0163162_100366324 122
80 3300013306 Ga0163162_10344861 Ga0163162_103448612 122
81 3300013307 Ga0157372_10673190 Ga0157372_106731902 122
82 3300013307 Ga0157372_12631287 Ga0157372_126312871 122
83 3300013308 Ga0157375_10201079 Ga0157375_102010793 122
84 3300013308 Ga0157375_10344689 Ga0157375_103446892 122
85 3300014325 Ga0163163_10019887 Ga0163163_100198872 122
86 3300014968 Ga0157379_10083515 Ga0157379_100835155 122
87 3300014969 Ga0157376_10078600 Ga0157376_100786002 122
88 3300014969 Ga0157376_10463252 Ga0157376_104632521 122
89 3300021384 Ga0213876_10057256 Ga0213876_100572562 122
90 3300024227 Ga0228598_1000054 Ga0228598_10000549 122
91 3300025899 Ga0207642_10505473 Ga0207642_105054732 122
92 3300025900 Ga0207710_10131095 Ga0207710_101310952 122
93 3300025903 Ga0207680_10005190 Ga0207680_100051902 122
94 3300025909 Ga0207705_10862458 Ga0207705_108624582 122
95 3300025911 Ga0207654_10035326 Ga0207654_100353262 122
96 3300025912 Ga0207707_10369369 Ga0207707_103693691 122
97 3300025912 Ga0207707_10460261 Ga0207707_104602612 122
98 3300025913 Ga0207695_10110064 Ga0207695_101100642 122
99 3300025913 Ga0207695_10112330 Ga0207695_101123304 122
100 3300025913 Ga0207695_10949669 Ga0207695_109496691 122
101 3300025914 Ga0207671_10020860 Ga0207671_100208604 122
102 3300025919 Ga0207657_10131016 Ga0207657_101310162 122
103 3300025924 Ga0207694_10076088 Ga0207694_100760882 122
104 3300025924 Ga0207694_10555107 Ga0207694_105551072 122
105 3300025927 Ga0207687_10006980 Ga0207687_100069802 122
106 3300025927 Ga0207687_10063625 Ga0207687_100636252 122
107 3300025927 Ga0207687_10788710 Ga0207687_107887101 122
108 3300025932 Ga0207690_10824347 Ga0207690_108243471 122
109 3300025934 Ga0207686_10134698 Ga0207686_101346982 122
110 3300025934 Ga0207686_10138141 Ga0207686_101381413 122
111 3300025938 Ga0207704_10056402 Ga0207704_100564022 122
112 3300025941 Ga0207711_11410396 Ga0207711_114103962 122
113 3300025942 Ga0207689_10540869 Ga0207689_105408692 122
114 3300025942 Ga0207689_11472743 Ga0207689_114727431 122
115 3300025944 Ga0207661_10000050 Ga0207661_1000005071 122
116 3300025945 Ga0207679_11116651 Ga0207679_111166511 122
117 3300025949 Ga0207667_10114582 Ga0207667_101145822 122
118 3300025949 Ga0207667_10311585 Ga0207667_103115853 122
119 3300025949 Ga0207667_11083562 Ga0207667_110835621 122
120 3300025986 Ga0207658_10377690 Ga0207658_103776902 122
121 3300026023 Ga0207677_10066409 Ga0207677_100664092 122
122 3300026035 Ga0207703_10032594 Ga0207703_100325944 122
123 3300026041 Ga0207639_10607318 Ga0207639_106073183 122
124 3300026041 Ga0207639_10610661 Ga0207639_106106612 122
125 3300026078 Ga0207702_10203597 Ga0207702_102035972 122
126 3300026088 Ga0207641_10026712 Ga0207641_100267125 122
127 3300026088 Ga0207641_10761108 Ga0207641_107611081 122
128 3300026089 Ga0207648_10007528 Ga0207648_1000752811 122
129 3300026095 Ga0207676_10281920 Ga0207676_102819202 122
130 3300026116 Ga0207674_10013533 Ga0207674_100135332 122
131 3300026116 Ga0207674_10059137 Ga0207674_100591375 122
132 3300028379 Ga0268266_10579229 Ga0268266_105792292 122
133 3300028381 Ga0268264_10022451 Ga0268264_100224513 122
134 3300030878 Ga0265770_1046812 Ga0265770_10468122 122
135 3300031344 Ga0265316_10008184 Ga0265316_100081844 122
136 3300031344 Ga0265316_10347833 Ga0265316_103478331 122
137 3300031711 Ga0265314_10000723 Ga0265314_1000072329 122
138 3300031712 Ga0265342_10081506 Ga0265342_100815062 122
139 3300035172 Ga0373955_0053591 Ga0373955_0053591_874_1248 122
140 3300037853 Ga0436364_1523115 Ga0436364_1523115_21_395 122
141 3300039437 Ga0436365_0031945 Ga0436365_0031945_732_1106 122
142 3300039450 Ga0436363_1247706 Ga0436363_1247706_512_886 122
143 3300046472 Ga0495580_0873770 Ga0495580_0873770_14_388 122
144 3300046516 Ga0495628_0564694 Ga0495628_0564694_308_682 122
145 3300046543 Ga0495645_0303605 Ga0495645_0303605_118_492 122
146 3300046694 Ga0495649_0352741 Ga0495649_0352741_283_657 122
147 3300047319 Ga0495674_0295084 Ga0495674_0295084_78_452 122
148 3300047471 Ga0495684_0340752 Ga0495684_0340752_401_775 122
149 3300050513 nmdc:mga0rr50_190070_c1 nmdc:mga0rr50_190070_c1_781_1158 122
150 3300050514 nmdc:mga08x19_464_c1 nmdc:mga08x19_464_c1_17035_17412 122
151 3300005353 Ga0070669_101415141 Ga0070669_1014151412 123
152 3300005435 Ga0070714_100110579 Ga0070714_1001105791 123
153 3300005441 Ga0070700_100342518 Ga0070700_1003425182 123
154 3300005530 Ga0070679_100576431 Ga0070679_1005764311 123
155 3300005563 Ga0068855_100051195 Ga0068855_1000511952 123
156 3300005614 Ga0068856_100255839 Ga0068856_1002558392 123
157 3300005616 Ga0068852_100017918 Ga0068852_1000179183 123
158 3300005983 Ga0081540_1152510 Ga0081540_11525101 123
159 3300006028 Ga0070717_10012713 Ga0070717_100127135 123
160 3300006846 Ga0075430_100551862 Ga0075430_1005518621 123
161 3300013104 Ga0157370_10001165 Ga0157370_1000116513 123
162 3300013105 Ga0157369_10053425 Ga0157369_100534255 123
163 3300013307 Ga0157372_10161665 Ga0157372_101616652 123
164 3300021388 Ga0213875_10000006 Ga0213875_10000006309 123
165 3300021388 Ga0213875_10070182 Ga0213875_100701822 123
166 3300025917 Ga0207660_10545093 Ga0207660_105450932 123
167 3300025919 Ga0207657_10217600 Ga0207657_102176001 123
168 3300025949 Ga0207667_10542191 Ga0207667_105421912 123
169 3300026075 Ga0207708_10410990 Ga0207708_104109901 123
170 3300026078 Ga0207702_10236120 Ga0207702_102361202 123
171 3300028653 Ga0265323_10003557 Ga0265323_100035574 123
172 3300031235 Ga0265330_10395784 Ga0265330_103957841 123
173 3300031241 Ga0265325_10107845 Ga0265325_101078452 123
174 3300037418 Ga0395900_0108479 Ga0395900_0108479_2171_2548 123
175 3300037853 Ga0436364_0478514 Ga0436364_0478514_371521_371898 123
176 3300037853 Ga0436364_0631627 Ga0436364_0631627_3855_4232 123
177 3300037853 Ga0436364_0956168 Ga0436364_0956168_1077_1454 123
178 3300039437 Ga0436365_0051887 Ga0436365_0051887_1092_1469 123
179 3300039438 Ga0436360_1276510 Ga0436360_1276510_38_415 123
180 3300039453 Ga0436362_1254778 Ga0436362_1254778_1220_1597 123
181 3300050509 nmdc:mga0qj67_1303101_c1 nmdc:mga0qj67_1303101_c1_161_538 123
182 3300005295 Ga0065707_10120561 Ga0065707_101205613 124
183 3300005334 Ga0068869_100528372 Ga0068869_1005283723 124
184 3300005339 Ga0070660_100815661 Ga0070660_1008156611 124
185 3300005437 Ga0070710_10306664 Ga0070710_103066642 124
186 3300005444 Ga0070694_100597605 Ga0070694_1005976051 124
187 3300005445 Ga0070708_100039108 Ga0070708_1000391083 124
188 3300005459 Ga0068867_100332458 Ga0068867_1003324583 124
189 3300005467 Ga0070706_100023366 Ga0070706_1000233664 124
190 3300005467 Ga0070706_100139265 Ga0070706_1001392652 124
191 3300005468 Ga0070707_100007037 Ga0070707_1000070372 124
192 3300005468 Ga0070707_100223045 Ga0070707_1002230451 124
193 3300005536 Ga0070697_101621771 Ga0070697_1016217711 124
194 3300005544 Ga0070686_100059805 Ga0070686_1000598051 124
195 3300005546 Ga0070696_100330778 Ga0070696_1003307782 124
196 3300005549 Ga0070704_100061827 Ga0070704_1000618273 124
197 3300005614 Ga0068856_100798723 Ga0068856_1007987232 124
198 3300005718 Ga0068866_10448062 Ga0068866_104480621 124
199 3300005843 Ga0068860_100048152 Ga0068860_1000481524 124
200 3300006173 Ga0070716_100052951 Ga0070716_1000529512 124
201 3300006237 Ga0097621_100589462 Ga0097621_1005894622 124
202 3300007076 Ga0075435_100123490 Ga0075435_1001234904 124
203 3300009093 Ga0105240_10059309 Ga0105240_100593095 124
204 3300009101 Ga0105247_10179258 Ga0105247_101792582 124
205 3300009174 Ga0105241_10366895 Ga0105241_103668952 124
206 3300009176 Ga0105242_10056202 Ga0105242_100562022 124
207 3300009177 Ga0105248_10009850 Ga0105248_100098507 124
208 3300009177 Ga0105248_10017165 Ga0105248_100171654 124
209 3300009545 Ga0105237_10358542 Ga0105237_103585421 124
210 3300009553 Ga0105249_10106940 Ga0105249_101069403 124
211 3300010375 Ga0105239_10569207 Ga0105239_105692072 124
212 3300013104 Ga0157370_10182139 Ga0157370_101821394 124
213 3300013297 Ga0157378_10000081 Ga0157378_100000819 124
214 3300014325 Ga0163163_10898538 Ga0163163_108985381 124
215 3300014969 Ga0157376_10000050 Ga0157376_100000501 124
216 3300021388 Ga0213875_10021755 Ga0213875_100217554 124
217 3300025899 Ga0207642_10315018 Ga0207642_103150182 124
218 3300025910 Ga0207684_10020022 Ga0207684_100200225 124
219 3300025910 Ga0207684_10446005 Ga0207684_104460052 124
220 3300025915 Ga0207693_10130085 Ga0207693_101300853 124
221 3300025922 Ga0207646_10061315 Ga0207646_100613154 124
222 3300025934 Ga0207686_10118938 Ga0207686_101189383 124
223 3300025939 Ga0207665_10012926 Ga0207665_100129266 124
224 3300025941 Ga0207711_10005672 Ga0207711_100056727 124
225 3300025941 Ga0207711_10022577 Ga0207711_100225775 124
226 3300025961 Ga0207712_10985284 Ga0207712_109852841 124
227 3300026078 Ga0207702_10743618 Ga0207702_107436182 124
228 3300026118 Ga0207675_100376881 Ga0207675_1003768812 124
229 3300028381 Ga0268264_10017712 Ga0268264_100177126 124
230 3300028800 Ga0265338_10130478 Ga0265338_101304784 124
231 3300031241 Ga0265325_10129718 Ga0265325_101297182 124
232 3300037853 Ga0436364_0841135 Ga0436364_0841135_2155_2538 124
233 3300046536 Ga0495587_0615127 Ga0495587_0615127_178_558 124
234 3300048905 Ga0496102_0112612 Ga0496102_0112612_835_1218 124
235 3300048906 Ga0496103_0774508 Ga0496103_0774508_152_535 124
236 3300048909 Ga0496106_0043465 Ga0496106_0043465_2896_3279 124
237 3300048917 Ga0496114_0035933 Ga0496114_0035933_217_600 124
238 3300048918 Ga0496115_0199201 Ga0496115_0199201_669_1052 124
239 3300053733 Ga0500552_032238 Ga0500552_032238_336_716 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

10

128

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.8659 2 121
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.8646 2 122
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.8593 2 122
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.859 2 122
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.8483 2 113
ID Description Score Start End Superfamily
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9573 2 116 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9015 1 121 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8896 2 116 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.846 1 119 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8459 2 122 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A522T5Z5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9897 2 124 GO:0000287
GO:0004540
GO:0090729
AF-A0A2H6F1L5-F1-model_v4 Ribonuclease VapC19 0.9879 33 122 GO:0004518
GO:0046872
AF-A0A3B9V8Q6-F1-model_v4 PIN domain nuclease 0.9877 2 123 GO:0004518
GO:0046872
AF-A0A1F8ZK55-F1-model_v4 PIN domain-containing protein 0.9876 2 123 GO:0004518
GO:0046872
AF-A0A2I6QI87-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9865 1 123 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
93.69 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map