F351806
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 239 | 144 | 239 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1152510|Ga0081540_11525101 |
| Length | 132 |
| Sequence | LRGSSKQVTVLIDSDILIEVSRGRNTAVVSKWIELSTSDALVLFSPVTAAELWAGARPAEYKALEALFEALVCVPADAAVGRQAGEYLRRYRKSHAVELGDALIAASTVVSGALLWTRNRKHYPMSDLTFFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 127 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 128 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 129 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 137 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 140 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 141 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 2.09 |
| Rhizosphere | 92.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10120561 | 3300005295 | Bacteria | 2099 |
| 2 | Ga0070683_100000049 | 3300005329 | Bacteria | 93310 |
| 3 | Ga0070683_100279618 | 3300005329 | Bacteria | 1588 |
| 4 | Ga0070690_100143702 | 3300005330 | Bacteria | 1621 |
| 5 | Ga0068869_100306433 | 3300005334 | Bacteria | 1284 |
| 6 | Ga0068869_100528372 | 3300005334 | Unclassified | 988 |
| 7 | Ga0068869_100821992 | 3300005334 | Bacteria | 800 |
| 8 | Ga0070666_10033902 | 3300005335 | Bacteria | 3382 |
| 9 | Ga0068868_100070083 | 3300005338 | Bacteria | 2795 |
| 10 | Ga0070660_100815661 | 3300005339 | Unclassified | 785 |
| 11 | Ga0070669_101415141 | 3300005353 | Unclassified | 603 |
| 12 | Ga0070659_100451617 | 3300005366 | Bacteria | 1090 |
| 13 | Ga0070667_100052210 | 3300005367 | Bacteria | 3449 |
| 14 | Ga0070667_101245044 | 3300005367 | Unclassified | 697 |
| 15 | Ga0070714_100110579 | 3300005435 | Unclassified | 2432 |
| 16 | Ga0070710_10306664 | 3300005437 | Unclassified | 1038 |
| 17 | Ga0070705_100813330 | 3300005440 | Bacteria | 744 |
| 18 | Ga0070700_100342518 | 3300005441 | Bacteria | 1105 |
| 19 | Ga0070694_100597605 | 3300005444 | Unclassified | 888 |
| 20 | Ga0070708_100030673 | 3300005445 | Bacteria | 4648 |
| 21 | Ga0070708_100039108 | 3300005445 | Bacteria | 4148 |
| 22 | Ga0070681_10073431 | 3300005458 | Bacteria | 3382 |
| 23 | Ga0068867_100066821 | 3300005459 | Bacteria | 2679 |
| 24 | Ga0068867_100262756 | 3300005459 | Unclassified | 1408 |
| 25 | Ga0068867_100332458 | 3300005459 | Bacteria | 1262 |
| 26 | Ga0070706_100023366 | 3300005467 | Bacteria | 5693 |
| 27 | Ga0070706_100139265 | 3300005467 | Unclassified | 2265 |
| 28 | Ga0070707_100007037 | 3300005468 | Bacteria | 10436 |
| 29 | Ga0070707_100223045 | 3300005468 | Bacteria | 1836 |
| 30 | Ga0070679_100576431 | 3300005530 | Unclassified | 1069 |
| 31 | Ga0070679_100885942 | 3300005530 | Unclassified | 836 |
| 32 | Ga0070684_100000040 | 3300005535 | Bacteria | 93306 |
| 33 | Ga0070684_100029124 | 3300005535 | Bacteria | 4677 |
| 34 | Ga0070697_101621771 | 3300005536 | Unclassified | 578 |
| 35 | Ga0068853_100170276 | 3300005539 | Bacteria | 1970 |
| 36 | Ga0068853_100237205 | 3300005539 | Unclassified | 1670 |
| 37 | Ga0068853_100584222 | 3300005539 | Bacteria | 1060 |
| 38 | Ga0070686_100059805 | 3300005544 | Bacteria | 2456 |
| 39 | Ga0070686_100909574 | 3300005544 | Bacteria | 716 |
| 40 | Ga0070696_100330778 | 3300005546 | Bacteria | 1175 |
| 41 | Ga0070704_100061827 | 3300005549 | Bacteria | 2682 |
| 42 | Ga0068855_100051195 | 3300005563 | Bacteria | 4865 |
| 43 | Ga0068855_100101531 | 3300005563 | Unclassified | 3311 |
| 44 | Ga0068855_100119428 | 3300005563 | Bacteria | 3018 |
| 45 | Ga0068855_100353087 | 3300005563 | Unclassified | 1619 |
| 46 | Ga0070664_100368652 | 3300005564 | Bacteria | 1309 |
| 47 | Ga0070664_101246516 | 3300005564 | Bacteria | 702 |
| 48 | Ga0068857_100061688 | 3300005577 | Bacteria | 3331 |
| 49 | Ga0068857_100285980 | 3300005577 | Bacteria | 1517 |
| 50 | Ga0068856_100255839 | 3300005614 | Unclassified | 1766 |
| 51 | Ga0068856_100798723 | 3300005614 | Unclassified | 963 |
| 52 | Ga0068852_100017918 | 3300005616 | Bacteria | 5569 |
| 53 | Ga0068859_100139180 | 3300005617 | Bacteria | 2501 |
| 54 | Ga0068864_100370630 | 3300005618 | Bacteria | 1355 |
| 55 | Ga0068866_10448062 | 3300005718 | Unclassified | 843 |
| 56 | Ga0068866_10520639 | 3300005718 | Unclassified | 790 |
| 57 | Ga0068863_100088560 | 3300005841 | Bacteria | 2934 |
| 58 | Ga0068863_100160195 | 3300005841 | Bacteria | 2156 |
| 59 | Ga0068863_102198231 | 3300005841 | Unclassified | 562 |
| 60 | Ga0068858_100031642 | 3300005842 | Bacteria | 4915 |
| 61 | Ga0068858_102436086 | 3300005842 | Unclassified | 517 |
| 62 | Ga0068860_100017992 | 3300005843 | Bacteria | 6883 |
| 63 | Ga0068860_100048152 | 3300005843 | Bacteria | 4063 |
| 64 | Ga0081540_1152510 | 3300005983 | Bacteria | 909 |
| 65 | Ga0070717_10012713 | 3300006028 | Bacteria | 6425 |
| 66 | Ga0070715_10195009 | 3300006163 | Bacteria | 1025 |
| 67 | Ga0070716_100052951 | 3300006173 | Bacteria | 2312 |
| 68 | Ga0070716_100128869 | 3300006173 | Bacteria | 1596 |
| 69 | Ga0097621_100016251 | 3300006237 | Bacteria | 5620 |
| 70 | Ga0097621_100266894 | 3300006237 | Bacteria | 1503 |
| 71 | Ga0097621_100589462 | 3300006237 | Unclassified | 1015 |
| 72 | Ga0068871_100173443 | 3300006358 | Unclassified | 1850 |
| 73 | Ga0075430_100551862 | 3300006846 | Bacteria | 950 |
| 74 | Ga0068865_100056758 | 3300006881 | Bacteria | 2729 |
| 75 | Ga0075436_100010378 | 3300006914 | Bacteria | 6382 |
| 76 | Ga0097620_100139180 | 3300006931 | Bacteria | 2501 |
| 77 | Ga0075435_100123490 | 3300007076 | Bacteria | 2162 |
| 78 | Ga0075435_100282452 | 3300007076 | Unclassified | 1417 |
| 79 | Ga0099794_10034127 | 3300007265 | Bacteria | 2395 |
| 80 | Ga0105240_10059309 | 3300009093 | Bacteria | 4776 |
| 81 | Ga0105240_10106984 | 3300009093 | Bacteria | 3392 |
| 82 | Ga0105240_10144840 | 3300009093 | Bacteria | 2836 |
| 83 | Ga0105245_10010745 | 3300009098 | Bacteria | 7965 |
| 84 | Ga0105245_10018954 | 3300009098 | Bacteria | 6023 |
| 85 | Ga0105247_10143067 | 3300009101 | Bacteria | 1569 |
| 86 | Ga0105247_10179258 | 3300009101 | Unclassified | 1413 |
| 87 | Ga0105247_11223452 | 3300009101 | Bacteria | 599 |
| 88 | Ga0105241_10129032 | 3300009174 | Unclassified | 2045 |
| 89 | Ga0105241_10366895 | 3300009174 | Unclassified | 1254 |
| 90 | Ga0105242_10056202 | 3300009176 | Bacteria | 3220 |
| 91 | Ga0105242_10074507 | 3300009176 | Bacteria | 2824 |
| 92 | Ga0105242_10210484 | 3300009176 | Bacteria | 1733 |
| 93 | Ga0105248_10009850 | 3300009177 | Bacteria | 10527 |
| 94 | Ga0105248_10017165 | 3300009177 | Bacteria | 7974 |
| 95 | Ga0105248_10023511 | 3300009177 | Bacteria | 6845 |
| 96 | Ga0105248_10219713 | 3300009177 | Bacteria | 2139 |
| 97 | Ga0105248_10892749 | 3300009177 | Unclassified | 1003 |
| 98 | Ga0105248_11261894 | 3300009177 | Unclassified | 835 |
| 99 | Ga0105237_10078870 | 3300009545 | Bacteria | 3283 |
| 100 | Ga0105237_10358542 | 3300009545 | Bacteria | 1462 |
| 101 | Ga0105238_10045884 | 3300009551 | Bacteria | 4413 |
| 102 | Ga0105249_10106940 | 3300009553 | Bacteria | 2640 |
| 103 | Ga0105239_10133525 | 3300010375 | Bacteria | 2762 |
| 104 | Ga0105239_10531455 | 3300010375 | Bacteria | 1338 |
| 105 | Ga0105239_10569207 | 3300010375 | Bacteria | 1291 |
| 106 | Ga0105239_11270428 | 3300010375 | Bacteria | 849 |
| 107 | Ga0105246_10060253 | 3300011119 | Bacteria | 2636 |
| 108 | Ga0157370_10001165 | 3300013104 | Bacteria | 32739 |
| 109 | Ga0157370_10170692 | 3300013104 | Unclassified | 2022 |
| 110 | Ga0157370_10182139 | 3300013104 | Bacteria | 1952 |
| 111 | Ga0157369_10034038 | 3300013105 | Bacteria | 5595 |
| 112 | Ga0157369_10053425 | 3300013105 | Bacteria | 4367 |
| 113 | Ga0157369_11196673 | 3300013105 | Bacteria | 776 |
| 114 | Ga0157374_10066004 | 3300013296 | Bacteria | 3400 |
| 115 | Ga0157374_10507251 | 3300013296 | Bacteria | 1211 |
| 116 | Ga0157378_10000081 | 3300013297 | Bacteria | 88506 |
| 117 | Ga0157378_10059197 | 3300013297 | Bacteria | 3417 |
| 118 | Ga0157378_10580266 | 3300013297 | Bacteria | 1130 |
| 119 | Ga0163162_10036632 | 3300013306 | Bacteria | 4892 |
| 120 | Ga0163162_10344861 | 3300013306 | Bacteria | 1622 |
| 121 | Ga0157372_10161665 | 3300013307 | Unclassified | 2588 |
| 122 | Ga0157372_10673190 | 3300013307 | Unclassified | 1205 |
| 123 | Ga0157372_12631287 | 3300013307 | Unclassified | 577 |
| 124 | Ga0157375_10201079 | 3300013308 | Bacteria | 2148 |
| 125 | Ga0157375_10344689 | 3300013308 | Bacteria | 1655 |
| 126 | Ga0163163_10019887 | 3300014325 | Bacteria | 6314 |
| 127 | Ga0163163_10029485 | 3300014325 | Bacteria | 5278 |
| 128 | Ga0163163_10898538 | 3300014325 | Unclassified | 949 |
| 129 | Ga0157379_10083515 | 3300014968 | Bacteria | 2863 |
| 130 | Ga0157376_10000050 | 3300014969 | Bacteria | 104192 |
| 131 | Ga0157376_10078600 | 3300014969 | Bacteria | 2825 |
| 132 | Ga0157376_10463252 | 3300014969 | Bacteria | 1239 |
| 133 | Ga0213876_10057256 | 3300021384 | Bacteria | 2058 |
| 134 | Ga0213875_10000006 | 3300021388 | Bacteria | 579005 |
| 135 | Ga0213875_10021755 | 3300021388 | Bacteria | 3069 |
| 136 | Ga0213875_10070182 | 3300021388 | Bacteria | 1635 |
| 137 | Ga0228598_1000054 | 3300024227 | Bacteria | 16523 |
| 138 | Ga0207642_10315018 | 3300025899 | Unclassified | 912 |
| 139 | Ga0207642_10505473 | 3300025899 | Unclassified | 740 |
| 140 | Ga0207710_10131095 | 3300025900 | Bacteria | 1204 |
| 141 | Ga0207680_10005190 | 3300025903 | Bacteria | 6211 |
| 142 | Ga0207705_10862458 | 3300025909 | Unclassified | 702 |
| 143 | Ga0207684_10020022 | 3300025910 | Bacteria | 5717 |
| 144 | Ga0207684_10446005 | 3300025910 | Unclassified | 1111 |
| 145 | Ga0207654_10035326 | 3300025911 | Bacteria | 2784 |
| 146 | Ga0207707_10369369 | 3300025912 | Bacteria | 1234 |
| 147 | Ga0207707_10460261 | 3300025912 | Unclassified | 1088 |
| 148 | Ga0207695_10110064 | 3300025913 | Bacteria | 2735 |
| 149 | Ga0207695_10112330 | 3300025913 | Bacteria | 2703 |
| 150 | Ga0207695_10949669 | 3300025913 | Bacteria | 739 |
| 151 | Ga0207671_10020860 | 3300025914 | Bacteria | 4982 |
| 152 | Ga0207693_10130085 | 3300025915 | Bacteria | 1979 |
| 153 | Ga0207660_10545093 | 3300025917 | Unclassified | 943 |
| 154 | Ga0207657_10131016 | 3300025919 | Bacteria | 2055 |
| 155 | Ga0207657_10217600 | 3300025919 | Bacteria | 1531 |
| 156 | Ga0207646_10061315 | 3300025922 | Bacteria | 3357 |
| 157 | Ga0207694_10076088 | 3300025924 | Bacteria | 2628 |
| 158 | Ga0207694_10555107 | 3300025924 | Bacteria | 964 |
| 159 | Ga0207687_10006980 | 3300025927 | Bacteria | 7440 |
| 160 | Ga0207687_10063625 | 3300025927 | Bacteria | 2612 |
| 161 | Ga0207687_10788710 | 3300025927 | Bacteria | 810 |
| 162 | Ga0207690_10824347 | 3300025932 | Bacteria | 767 |
| 163 | Ga0207686_10118938 | 3300025934 | Unclassified | 1795 |
| 164 | Ga0207686_10134698 | 3300025934 | Bacteria | 1699 |
| 165 | Ga0207686_10138141 | 3300025934 | Bacteria | 1681 |
| 166 | Ga0207704_10056402 | 3300025938 | Bacteria | 2406 |
| 167 | Ga0207665_10012926 | 3300025939 | Bacteria | 5491 |
| 168 | Ga0207711_10005672 | 3300025941 | Bacteria | 10545 |
| 169 | Ga0207711_10022577 | 3300025941 | Bacteria | 5264 |
| 170 | Ga0207711_10200300 | 3300025941 | Bacteria | 1822 |
| 171 | Ga0207711_11410396 | 3300025941 | Unclassified | 639 |
| 172 | Ga0207689_10540869 | 3300025942 | Bacteria | 978 |
| 173 | Ga0207689_11472743 | 3300025942 | Unclassified | 569 |
| 174 | Ga0207661_10000050 | 3300025944 | Bacteria | 93646 |
| 175 | Ga0207679_11116651 | 3300025945 | Bacteria | 723 |
| 176 | Ga0207667_10114582 | 3300025949 | Bacteria | 2778 |
| 177 | Ga0207667_10311585 | 3300025949 | Bacteria | 1608 |
| 178 | Ga0207667_10542191 | 3300025949 | Unclassified | 1177 |
| 179 | Ga0207667_11083562 | 3300025949 | Bacteria | 785 |
| 180 | Ga0207712_10985284 | 3300025961 | Unclassified | 747 |
| 181 | Ga0207658_10377690 | 3300025986 | Bacteria | 1240 |
| 182 | Ga0207677_10066409 | 3300026023 | Bacteria | 2522 |
| 183 | Ga0207703_10032594 | 3300026035 | Bacteria | 4124 |
| 184 | Ga0207639_10607318 | 3300026041 | Unclassified | 1009 |
| 185 | Ga0207639_10610661 | 3300026041 | Bacteria | 1006 |
| 186 | Ga0207708_10410990 | 3300026075 | Bacteria | 1121 |
| 187 | Ga0207702_10203597 | 3300026078 | Unclassified | 1836 |
| 188 | Ga0207702_10236120 | 3300026078 | Unclassified | 1711 |
| 189 | Ga0207702_10743618 | 3300026078 | Unclassified | 968 |
| 190 | Ga0207641_10026712 | 3300026088 | Bacteria | 4766 |
| 191 | Ga0207641_10104101 | 3300026088 | Bacteria | 2505 |
| 192 | Ga0207641_10761108 | 3300026088 | Bacteria | 956 |
| 193 | Ga0207648_10007528 | 3300026089 | Bacteria | 10690 |
| 194 | Ga0207676_10281920 | 3300026095 | Bacteria | 1509 |
| 195 | Ga0207674_10013533 | 3300026116 | Bacteria | 9045 |
| 196 | Ga0207674_10059137 | 3300026116 | Bacteria | 3880 |
| 197 | Ga0207675_100376881 | 3300026118 | Bacteria | 1395 |
| 198 | Ga0268266_10579229 | 3300028379 | Unclassified | 1077 |
| 199 | Ga0268264_10017712 | 3300028381 | Bacteria | 5832 |
| 200 | Ga0268264_10022451 | 3300028381 | Bacteria | 5153 |
| 201 | Ga0265323_10003557 | 3300028653 | Bacteria | 6856 |
| 202 | Ga0265338_10130478 | 3300028800 | Bacteria | 1986 |
| 203 | Ga0265770_1046812 | 3300030878 | Bacteria | 772 |
| 204 | Ga0265330_10395784 | 3300031235 | Unclassified | 584 |
| 205 | Ga0265325_10107845 | 3300031241 | Unclassified | 1357 |
| 206 | Ga0265325_10129718 | 3300031241 | Unclassified | 1208 |
| 207 | Ga0265339_10156392 | 3300031249 | Bacteria | 1150 |
| 208 | Ga0265316_10008184 | 3300031344 | Bacteria | 9729 |
| 209 | Ga0265316_10347833 | 3300031344 | Bacteria | 1073 |
| 210 | Ga0265314_10000723 | 3300031711 | Bacteria | 39953 |
| 211 | Ga0265342_10081506 | 3300031712 | Bacteria | 1868 |
| 212 | Ga0373955_0053591 | 3300035172 | Bacteria | 2203 |
| 213 | Ga0395900_0108479 | 3300037418 | Unclassified | 2852 |
| 214 | Ga0436364_0478514 | 3300037853 | Bacteria | 578677 |
| 215 | Ga0436364_0631627 | 3300037853 | Bacteria | 4357 |
| 216 | Ga0436364_0841135 | 3300037853 | Bacteria | 3069 |
| 217 | Ga0436364_0956168 | 3300037853 | Bacteria | 1778 |
| 218 | Ga0436364_1523115 | 3300037853 | Unclassified | 692 |
| 219 | Ga0436365_0031945 | 3300039437 | Bacteria | 1880 |
| 220 | Ga0436365_0051887 | 3300039437 | Unclassified | 1552 |
| 221 | Ga0436360_1276510 | 3300039438 | Unclassified | 503 |
| 222 | Ga0436363_1247706 | 3300039450 | Unclassified | 920 |
| 223 | Ga0436362_1254778 | 3300039453 | Bacteria | 2003 |
| 224 | Ga0495580_0873770 | 3300046472 | Unclassified | 579 |
| 225 | Ga0495628_0564694 | 3300046516 | Unclassified | 816 |
| 226 | Ga0495587_0615127 | 3300046536 | Unclassified | 598 |
| 227 | Ga0495645_0303605 | 3300046543 | Unclassified | 1042 |
| 228 | Ga0495649_0352741 | 3300046694 | Unclassified | 743 |
| 229 | Ga0495674_0295084 | 3300047319 | Unclassified | 1325 |
| 230 | Ga0495684_0340752 | 3300047471 | Bacteria | 1067 |
| 231 | Ga0496102_0112612 | 3300048905 | Bacteria | 2538 |
| 232 | Ga0496103_0774508 | 3300048906 | Unclassified | 606 |
| 233 | Ga0496106_0043465 | 3300048909 | Bacteria | 3371 |
| 234 | Ga0496114_0035933 | 3300048917 | Bacteria | 4094 |
| 235 | Ga0496115_0199201 | 3300048918 | Bacteria | 1654 |
| 236 | nmdc:mga0qj67_1303101_c1 | 3300050509 | Unclassified | 563 |
| 237 | nmdc:mga0rr50_190070_c1 | 3300050513 | Bacteria | 1682 |
| 238 | nmdc:mga08x19_464_c1 | 3300050514 | Bacteria | 27378 |
| 239 | Ga0500552_032238 | 3300053733 | Unclassified | 813 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031249 | Ga0265339_10156392 | Ga0265339_101563922 | 118 |
| 2 | 3300005841 | Ga0068863_100160195 | Ga0068863_1001601952 | 121 |
| 3 | 3300009101 | Ga0105247_11223452 | Ga0105247_112234521 | 121 |
| 4 | 3300009177 | Ga0105248_11261894 | Ga0105248_112618942 | 121 |
| 5 | 3300014325 | Ga0163163_10029485 | Ga0163163_100294852 | 121 |
| 6 | 3300025941 | Ga0207711_10200300 | Ga0207711_102003002 | 121 |
| 7 | 3300026088 | Ga0207641_10104101 | Ga0207641_101041012 | 121 |
| 8 | 3300005329 | Ga0070683_100000049 | Ga0070683_10000004928 | 122 |
| 9 | 3300005329 | Ga0070683_100279618 | Ga0070683_1002796183 | 122 |
| 10 | 3300005330 | Ga0070690_100143702 | Ga0070690_1001437023 | 122 |
| 11 | 3300005334 | Ga0068869_100306433 | Ga0068869_1003064333 | 122 |
| 12 | 3300005334 | Ga0068869_100821992 | Ga0068869_1008219921 | 122 |
| 13 | 3300005335 | Ga0070666_10033902 | Ga0070666_100339022 | 122 |
| 14 | 3300005338 | Ga0068868_100070083 | Ga0068868_1000700833 | 122 |
| 15 | 3300005366 | Ga0070659_100451617 | Ga0070659_1004516171 | 122 |
| 16 | 3300005367 | Ga0070667_100052210 | Ga0070667_1000522102 | 122 |
| 17 | 3300005367 | Ga0070667_101245044 | Ga0070667_1012450442 | 122 |
| 18 | 3300005440 | Ga0070705_100813330 | Ga0070705_1008133302 | 122 |
| 19 | 3300005445 | Ga0070708_100030673 | Ga0070708_1000306734 | 122 |
| 20 | 3300005458 | Ga0070681_10073431 | Ga0070681_100734312 | 122 |
| 21 | 3300005459 | Ga0068867_100066821 | Ga0068867_1000668212 | 122 |
| 22 | 3300005459 | Ga0068867_100262756 | Ga0068867_1002627563 | 122 |
| 23 | 3300005530 | Ga0070679_100885942 | Ga0070679_1008859422 | 122 |
| 24 | 3300005535 | Ga0070684_100000040 | Ga0070684_10000004028 | 122 |
| 25 | 3300005535 | Ga0070684_100029124 | Ga0070684_1000291245 | 122 |
| 26 | 3300005539 | Ga0068853_100170276 | Ga0068853_1001702761 | 122 |
| 27 | 3300005539 | Ga0068853_100237205 | Ga0068853_1002372053 | 122 |
| 28 | 3300005539 | Ga0068853_100584222 | Ga0068853_1005842223 | 122 |
| 29 | 3300005544 | Ga0070686_100909574 | Ga0070686_1009095742 | 122 |
| 30 | 3300005563 | Ga0068855_100101531 | Ga0068855_1001015312 | 122 |
| 31 | 3300005563 | Ga0068855_100119428 | Ga0068855_1001194282 | 122 |
| 32 | 3300005563 | Ga0068855_100353087 | Ga0068855_1003530874 | 122 |
| 33 | 3300005564 | Ga0070664_100368652 | Ga0070664_1003686522 | 122 |
| 34 | 3300005564 | Ga0070664_101246516 | Ga0070664_1012465162 | 122 |
| 35 | 3300005577 | Ga0068857_100061688 | Ga0068857_1000616882 | 122 |
| 36 | 3300005577 | Ga0068857_100285980 | Ga0068857_1002859802 | 122 |
| 37 | 3300005617 | Ga0068859_100139180 | Ga0068859_1001391802 | 122 |
| 38 | 3300005618 | Ga0068864_100370630 | Ga0068864_1003706302 | 122 |
| 39 | 3300005718 | Ga0068866_10520639 | Ga0068866_105206392 | 122 |
| 40 | 3300005841 | Ga0068863_100088560 | Ga0068863_1000885603 | 122 |
| 41 | 3300005841 | Ga0068863_102198231 | Ga0068863_1021982311 | 122 |
| 42 | 3300005842 | Ga0068858_100031642 | Ga0068858_1000316424 | 122 |
| 43 | 3300005842 | Ga0068858_102436086 | Ga0068858_1024360861 | 122 |
| 44 | 3300005843 | Ga0068860_100017992 | Ga0068860_1000179922 | 122 |
| 45 | 3300006163 | Ga0070715_10195009 | Ga0070715_101950092 | 122 |
| 46 | 3300006173 | Ga0070716_100128869 | Ga0070716_1001288692 | 122 |
| 47 | 3300006237 | Ga0097621_100016251 | Ga0097621_1000162512 | 122 |
| 48 | 3300006237 | Ga0097621_100266894 | Ga0097621_1002668941 | 122 |
| 49 | 3300006358 | Ga0068871_100173443 | Ga0068871_1001734433 | 122 |
| 50 | 3300006881 | Ga0068865_100056758 | Ga0068865_1000567582 | 122 |
| 51 | 3300006914 | Ga0075436_100010378 | Ga0075436_1000103783 | 122 |
| 52 | 3300006931 | Ga0097620_100139180 | Ga0097620_1001391802 | 122 |
| 53 | 3300007076 | Ga0075435_100282452 | Ga0075435_1002824522 | 122 |
| 54 | 3300007265 | Ga0099794_10034127 | Ga0099794_100341272 | 122 |
| 55 | 3300009093 | Ga0105240_10106984 | Ga0105240_101069844 | 122 |
| 56 | 3300009093 | Ga0105240_10144840 | Ga0105240_101448403 | 122 |
| 57 | 3300009098 | Ga0105245_10010745 | Ga0105245_1001074510 | 122 |
| 58 | 3300009098 | Ga0105245_10018954 | Ga0105245_100189546 | 122 |
| 59 | 3300009101 | Ga0105247_10143067 | Ga0105247_101430672 | 122 |
| 60 | 3300009174 | Ga0105241_10129032 | Ga0105241_101290323 | 122 |
| 61 | 3300009176 | Ga0105242_10074507 | Ga0105242_100745072 | 122 |
| 62 | 3300009176 | Ga0105242_10210484 | Ga0105242_102104842 | 122 |
| 63 | 3300009177 | Ga0105248_10023511 | Ga0105248_100235119 | 122 |
| 64 | 3300009177 | Ga0105248_10219713 | Ga0105248_102197132 | 122 |
| 65 | 3300009177 | Ga0105248_10892749 | Ga0105248_108927491 | 122 |
| 66 | 3300009545 | Ga0105237_10078870 | Ga0105237_100788702 | 122 |
| 67 | 3300009551 | Ga0105238_10045884 | Ga0105238_100458842 | 122 |
| 68 | 3300010375 | Ga0105239_10133525 | Ga0105239_101335252 | 122 |
| 69 | 3300010375 | Ga0105239_10531455 | Ga0105239_105314554 | 122 |
| 70 | 3300010375 | Ga0105239_11270428 | Ga0105239_112704282 | 122 |
| 71 | 3300011119 | Ga0105246_10060253 | Ga0105246_100602533 | 122 |
| 72 | 3300013104 | Ga0157370_10170692 | Ga0157370_101706922 | 122 |
| 73 | 3300013105 | Ga0157369_10034038 | Ga0157369_100340382 | 122 |
| 74 | 3300013105 | Ga0157369_11196673 | Ga0157369_111966732 | 122 |
| 75 | 3300013296 | Ga0157374_10066004 | Ga0157374_100660043 | 122 |
| 76 | 3300013296 | Ga0157374_10507251 | Ga0157374_105072513 | 122 |
| 77 | 3300013297 | Ga0157378_10059197 | Ga0157378_100591973 | 122 |
| 78 | 3300013297 | Ga0157378_10580266 | Ga0157378_105802662 | 122 |
| 79 | 3300013306 | Ga0163162_10036632 | Ga0163162_100366324 | 122 |
| 80 | 3300013306 | Ga0163162_10344861 | Ga0163162_103448612 | 122 |
| 81 | 3300013307 | Ga0157372_10673190 | Ga0157372_106731902 | 122 |
| 82 | 3300013307 | Ga0157372_12631287 | Ga0157372_126312871 | 122 |
| 83 | 3300013308 | Ga0157375_10201079 | Ga0157375_102010793 | 122 |
| 84 | 3300013308 | Ga0157375_10344689 | Ga0157375_103446892 | 122 |
| 85 | 3300014325 | Ga0163163_10019887 | Ga0163163_100198872 | 122 |
| 86 | 3300014968 | Ga0157379_10083515 | Ga0157379_100835155 | 122 |
| 87 | 3300014969 | Ga0157376_10078600 | Ga0157376_100786002 | 122 |
| 88 | 3300014969 | Ga0157376_10463252 | Ga0157376_104632521 | 122 |
| 89 | 3300021384 | Ga0213876_10057256 | Ga0213876_100572562 | 122 |
| 90 | 3300024227 | Ga0228598_1000054 | Ga0228598_10000549 | 122 |
| 91 | 3300025899 | Ga0207642_10505473 | Ga0207642_105054732 | 122 |
| 92 | 3300025900 | Ga0207710_10131095 | Ga0207710_101310952 | 122 |
| 93 | 3300025903 | Ga0207680_10005190 | Ga0207680_100051902 | 122 |
| 94 | 3300025909 | Ga0207705_10862458 | Ga0207705_108624582 | 122 |
| 95 | 3300025911 | Ga0207654_10035326 | Ga0207654_100353262 | 122 |
| 96 | 3300025912 | Ga0207707_10369369 | Ga0207707_103693691 | 122 |
| 97 | 3300025912 | Ga0207707_10460261 | Ga0207707_104602612 | 122 |
| 98 | 3300025913 | Ga0207695_10110064 | Ga0207695_101100642 | 122 |
| 99 | 3300025913 | Ga0207695_10112330 | Ga0207695_101123304 | 122 |
| 100 | 3300025913 | Ga0207695_10949669 | Ga0207695_109496691 | 122 |
| 101 | 3300025914 | Ga0207671_10020860 | Ga0207671_100208604 | 122 |
| 102 | 3300025919 | Ga0207657_10131016 | Ga0207657_101310162 | 122 |
| 103 | 3300025924 | Ga0207694_10076088 | Ga0207694_100760882 | 122 |
| 104 | 3300025924 | Ga0207694_10555107 | Ga0207694_105551072 | 122 |
| 105 | 3300025927 | Ga0207687_10006980 | Ga0207687_100069802 | 122 |
| 106 | 3300025927 | Ga0207687_10063625 | Ga0207687_100636252 | 122 |
| 107 | 3300025927 | Ga0207687_10788710 | Ga0207687_107887101 | 122 |
| 108 | 3300025932 | Ga0207690_10824347 | Ga0207690_108243471 | 122 |
| 109 | 3300025934 | Ga0207686_10134698 | Ga0207686_101346982 | 122 |
| 110 | 3300025934 | Ga0207686_10138141 | Ga0207686_101381413 | 122 |
| 111 | 3300025938 | Ga0207704_10056402 | Ga0207704_100564022 | 122 |
| 112 | 3300025941 | Ga0207711_11410396 | Ga0207711_114103962 | 122 |
| 113 | 3300025942 | Ga0207689_10540869 | Ga0207689_105408692 | 122 |
| 114 | 3300025942 | Ga0207689_11472743 | Ga0207689_114727431 | 122 |
| 115 | 3300025944 | Ga0207661_10000050 | Ga0207661_1000005071 | 122 |
| 116 | 3300025945 | Ga0207679_11116651 | Ga0207679_111166511 | 122 |
| 117 | 3300025949 | Ga0207667_10114582 | Ga0207667_101145822 | 122 |
| 118 | 3300025949 | Ga0207667_10311585 | Ga0207667_103115853 | 122 |
| 119 | 3300025949 | Ga0207667_11083562 | Ga0207667_110835621 | 122 |
| 120 | 3300025986 | Ga0207658_10377690 | Ga0207658_103776902 | 122 |
| 121 | 3300026023 | Ga0207677_10066409 | Ga0207677_100664092 | 122 |
| 122 | 3300026035 | Ga0207703_10032594 | Ga0207703_100325944 | 122 |
| 123 | 3300026041 | Ga0207639_10607318 | Ga0207639_106073183 | 122 |
| 124 | 3300026041 | Ga0207639_10610661 | Ga0207639_106106612 | 122 |
| 125 | 3300026078 | Ga0207702_10203597 | Ga0207702_102035972 | 122 |
| 126 | 3300026088 | Ga0207641_10026712 | Ga0207641_100267125 | 122 |
| 127 | 3300026088 | Ga0207641_10761108 | Ga0207641_107611081 | 122 |
| 128 | 3300026089 | Ga0207648_10007528 | Ga0207648_1000752811 | 122 |
| 129 | 3300026095 | Ga0207676_10281920 | Ga0207676_102819202 | 122 |
| 130 | 3300026116 | Ga0207674_10013533 | Ga0207674_100135332 | 122 |
| 131 | 3300026116 | Ga0207674_10059137 | Ga0207674_100591375 | 122 |
| 132 | 3300028379 | Ga0268266_10579229 | Ga0268266_105792292 | 122 |
| 133 | 3300028381 | Ga0268264_10022451 | Ga0268264_100224513 | 122 |
| 134 | 3300030878 | Ga0265770_1046812 | Ga0265770_10468122 | 122 |
| 135 | 3300031344 | Ga0265316_10008184 | Ga0265316_100081844 | 122 |
| 136 | 3300031344 | Ga0265316_10347833 | Ga0265316_103478331 | 122 |
| 137 | 3300031711 | Ga0265314_10000723 | Ga0265314_1000072329 | 122 |
| 138 | 3300031712 | Ga0265342_10081506 | Ga0265342_100815062 | 122 |
| 139 | 3300035172 | Ga0373955_0053591 | Ga0373955_0053591_874_1248 | 122 |
| 140 | 3300037853 | Ga0436364_1523115 | Ga0436364_1523115_21_395 | 122 |
| 141 | 3300039437 | Ga0436365_0031945 | Ga0436365_0031945_732_1106 | 122 |
| 142 | 3300039450 | Ga0436363_1247706 | Ga0436363_1247706_512_886 | 122 |
| 143 | 3300046472 | Ga0495580_0873770 | Ga0495580_0873770_14_388 | 122 |
| 144 | 3300046516 | Ga0495628_0564694 | Ga0495628_0564694_308_682 | 122 |
| 145 | 3300046543 | Ga0495645_0303605 | Ga0495645_0303605_118_492 | 122 |
| 146 | 3300046694 | Ga0495649_0352741 | Ga0495649_0352741_283_657 | 122 |
| 147 | 3300047319 | Ga0495674_0295084 | Ga0495674_0295084_78_452 | 122 |
| 148 | 3300047471 | Ga0495684_0340752 | Ga0495684_0340752_401_775 | 122 |
| 149 | 3300050513 | nmdc:mga0rr50_190070_c1 | nmdc:mga0rr50_190070_c1_781_1158 | 122 |
| 150 | 3300050514 | nmdc:mga08x19_464_c1 | nmdc:mga08x19_464_c1_17035_17412 | 122 |
| 151 | 3300005353 | Ga0070669_101415141 | Ga0070669_1014151412 | 123 |
| 152 | 3300005435 | Ga0070714_100110579 | Ga0070714_1001105791 | 123 |
| 153 | 3300005441 | Ga0070700_100342518 | Ga0070700_1003425182 | 123 |
| 154 | 3300005530 | Ga0070679_100576431 | Ga0070679_1005764311 | 123 |
| 155 | 3300005563 | Ga0068855_100051195 | Ga0068855_1000511952 | 123 |
| 156 | 3300005614 | Ga0068856_100255839 | Ga0068856_1002558392 | 123 |
| 157 | 3300005616 | Ga0068852_100017918 | Ga0068852_1000179183 | 123 |
| 158 | 3300005983 | Ga0081540_1152510 | Ga0081540_11525101 | 123 |
| 159 | 3300006028 | Ga0070717_10012713 | Ga0070717_100127135 | 123 |
| 160 | 3300006846 | Ga0075430_100551862 | Ga0075430_1005518621 | 123 |
| 161 | 3300013104 | Ga0157370_10001165 | Ga0157370_1000116513 | 123 |
| 162 | 3300013105 | Ga0157369_10053425 | Ga0157369_100534255 | 123 |
| 163 | 3300013307 | Ga0157372_10161665 | Ga0157372_101616652 | 123 |
| 164 | 3300021388 | Ga0213875_10000006 | Ga0213875_10000006309 | 123 |
| 165 | 3300021388 | Ga0213875_10070182 | Ga0213875_100701822 | 123 |
| 166 | 3300025917 | Ga0207660_10545093 | Ga0207660_105450932 | 123 |
| 167 | 3300025919 | Ga0207657_10217600 | Ga0207657_102176001 | 123 |
| 168 | 3300025949 | Ga0207667_10542191 | Ga0207667_105421912 | 123 |
| 169 | 3300026075 | Ga0207708_10410990 | Ga0207708_104109901 | 123 |
| 170 | 3300026078 | Ga0207702_10236120 | Ga0207702_102361202 | 123 |
| 171 | 3300028653 | Ga0265323_10003557 | Ga0265323_100035574 | 123 |
| 172 | 3300031235 | Ga0265330_10395784 | Ga0265330_103957841 | 123 |
| 173 | 3300031241 | Ga0265325_10107845 | Ga0265325_101078452 | 123 |
| 174 | 3300037418 | Ga0395900_0108479 | Ga0395900_0108479_2171_2548 | 123 |
| 175 | 3300037853 | Ga0436364_0478514 | Ga0436364_0478514_371521_371898 | 123 |
| 176 | 3300037853 | Ga0436364_0631627 | Ga0436364_0631627_3855_4232 | 123 |
| 177 | 3300037853 | Ga0436364_0956168 | Ga0436364_0956168_1077_1454 | 123 |
| 178 | 3300039437 | Ga0436365_0051887 | Ga0436365_0051887_1092_1469 | 123 |
| 179 | 3300039438 | Ga0436360_1276510 | Ga0436360_1276510_38_415 | 123 |
| 180 | 3300039453 | Ga0436362_1254778 | Ga0436362_1254778_1220_1597 | 123 |
| 181 | 3300050509 | nmdc:mga0qj67_1303101_c1 | nmdc:mga0qj67_1303101_c1_161_538 | 123 |
| 182 | 3300005295 | Ga0065707_10120561 | Ga0065707_101205613 | 124 |
| 183 | 3300005334 | Ga0068869_100528372 | Ga0068869_1005283723 | 124 |
| 184 | 3300005339 | Ga0070660_100815661 | Ga0070660_1008156611 | 124 |
| 185 | 3300005437 | Ga0070710_10306664 | Ga0070710_103066642 | 124 |
| 186 | 3300005444 | Ga0070694_100597605 | Ga0070694_1005976051 | 124 |
| 187 | 3300005445 | Ga0070708_100039108 | Ga0070708_1000391083 | 124 |
| 188 | 3300005459 | Ga0068867_100332458 | Ga0068867_1003324583 | 124 |
| 189 | 3300005467 | Ga0070706_100023366 | Ga0070706_1000233664 | 124 |
| 190 | 3300005467 | Ga0070706_100139265 | Ga0070706_1001392652 | 124 |
| 191 | 3300005468 | Ga0070707_100007037 | Ga0070707_1000070372 | 124 |
| 192 | 3300005468 | Ga0070707_100223045 | Ga0070707_1002230451 | 124 |
| 193 | 3300005536 | Ga0070697_101621771 | Ga0070697_1016217711 | 124 |
| 194 | 3300005544 | Ga0070686_100059805 | Ga0070686_1000598051 | 124 |
| 195 | 3300005546 | Ga0070696_100330778 | Ga0070696_1003307782 | 124 |
| 196 | 3300005549 | Ga0070704_100061827 | Ga0070704_1000618273 | 124 |
| 197 | 3300005614 | Ga0068856_100798723 | Ga0068856_1007987232 | 124 |
| 198 | 3300005718 | Ga0068866_10448062 | Ga0068866_104480621 | 124 |
| 199 | 3300005843 | Ga0068860_100048152 | Ga0068860_1000481524 | 124 |
| 200 | 3300006173 | Ga0070716_100052951 | Ga0070716_1000529512 | 124 |
| 201 | 3300006237 | Ga0097621_100589462 | Ga0097621_1005894622 | 124 |
| 202 | 3300007076 | Ga0075435_100123490 | Ga0075435_1001234904 | 124 |
| 203 | 3300009093 | Ga0105240_10059309 | Ga0105240_100593095 | 124 |
| 204 | 3300009101 | Ga0105247_10179258 | Ga0105247_101792582 | 124 |
| 205 | 3300009174 | Ga0105241_10366895 | Ga0105241_103668952 | 124 |
| 206 | 3300009176 | Ga0105242_10056202 | Ga0105242_100562022 | 124 |
| 207 | 3300009177 | Ga0105248_10009850 | Ga0105248_100098507 | 124 |
| 208 | 3300009177 | Ga0105248_10017165 | Ga0105248_100171654 | 124 |
| 209 | 3300009545 | Ga0105237_10358542 | Ga0105237_103585421 | 124 |
| 210 | 3300009553 | Ga0105249_10106940 | Ga0105249_101069403 | 124 |
| 211 | 3300010375 | Ga0105239_10569207 | Ga0105239_105692072 | 124 |
| 212 | 3300013104 | Ga0157370_10182139 | Ga0157370_101821394 | 124 |
| 213 | 3300013297 | Ga0157378_10000081 | Ga0157378_100000819 | 124 |
| 214 | 3300014325 | Ga0163163_10898538 | Ga0163163_108985381 | 124 |
| 215 | 3300014969 | Ga0157376_10000050 | Ga0157376_100000501 | 124 |
| 216 | 3300021388 | Ga0213875_10021755 | Ga0213875_100217554 | 124 |
| 217 | 3300025899 | Ga0207642_10315018 | Ga0207642_103150182 | 124 |
| 218 | 3300025910 | Ga0207684_10020022 | Ga0207684_100200225 | 124 |
| 219 | 3300025910 | Ga0207684_10446005 | Ga0207684_104460052 | 124 |
| 220 | 3300025915 | Ga0207693_10130085 | Ga0207693_101300853 | 124 |
| 221 | 3300025922 | Ga0207646_10061315 | Ga0207646_100613154 | 124 |
| 222 | 3300025934 | Ga0207686_10118938 | Ga0207686_101189383 | 124 |
| 223 | 3300025939 | Ga0207665_10012926 | Ga0207665_100129266 | 124 |
| 224 | 3300025941 | Ga0207711_10005672 | Ga0207711_100056727 | 124 |
| 225 | 3300025941 | Ga0207711_10022577 | Ga0207711_100225775 | 124 |
| 226 | 3300025961 | Ga0207712_10985284 | Ga0207712_109852841 | 124 |
| 227 | 3300026078 | Ga0207702_10743618 | Ga0207702_107436182 | 124 |
| 228 | 3300026118 | Ga0207675_100376881 | Ga0207675_1003768812 | 124 |
| 229 | 3300028381 | Ga0268264_10017712 | Ga0268264_100177126 | 124 |
| 230 | 3300028800 | Ga0265338_10130478 | Ga0265338_101304784 | 124 |
| 231 | 3300031241 | Ga0265325_10129718 | Ga0265325_101297182 | 124 |
| 232 | 3300037853 | Ga0436364_0841135 | Ga0436364_0841135_2155_2538 | 124 |
| 233 | 3300046536 | Ga0495587_0615127 | Ga0495587_0615127_178_558 | 124 |
| 234 | 3300048905 | Ga0496102_0112612 | Ga0496102_0112612_835_1218 | 124 |
| 235 | 3300048906 | Ga0496103_0774508 | Ga0496103_0774508_152_535 | 124 |
| 236 | 3300048909 | Ga0496106_0043465 | Ga0496106_0043465_2896_3279 | 124 |
| 237 | 3300048917 | Ga0496114_0035933 | Ga0496114_0035933_217_600 | 124 |
| 238 | 3300048918 | Ga0496115_0199201 | Ga0496115_0199201_669_1052 | 124 |
| 239 | 3300053733 | Ga0500552_032238 | Ga0500552_032238_336_716 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ecw-assembly1.cif.gz_A | structure of the shigella flexneri vapc mutant d7a | 0.8659 | 2 | 121 |
| 5ed0-assembly2.cif.gz_B | structure of the shigella flexneri vapc mutant d7n | 0.8646 | 2 | 122 |
| 6sd6-assembly1.cif.gz_C | structure of vapbc from shigella sonnei | 0.8593 | 2 | 122 |
| 3tnd-assembly1.cif.gz_G | crystal structure of shigella flexneri vapbc toxin-antitoxin complex | 0.859 | 2 | 122 |
| 4chg-assembly3.cif.gz_E | crystal structure of vapbc15 complex from mycobacterium tuberculosis | 0.8483 | 2 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WF93_1_123_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9573 | 2 | 116 | 3.40.50.1010 |
| af_P9WFA7_1_124_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9015 | 1 | 121 | 3.40.50.1010 |
| af_P9WF93_1_123_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8896 | 2 | 116 | 3.40.50.1010 |
| af_P9WF69_2_135_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.846 | 1 | 119 | 3.40.50.1010 |
| 3zvkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8459 | 2 | 122 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522T5Z5-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9897 | 2 | 124 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A2H6F1L5-F1-model_v4 | Ribonuclease VapC19 | 0.9879 | 33 | 122 |
GO:0004518
GO:0046872 |
| AF-A0A3B9V8Q6-F1-model_v4 | PIN domain nuclease | 0.9877 | 2 | 123 |
GO:0004518
GO:0046872 |
| AF-A0A1F8ZK55-F1-model_v4 | PIN domain-containing protein | 0.9876 | 2 | 123 |
GO:0004518
GO:0046872 |
| AF-A0A2I6QI87-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9865 | 1 | 123 |
GO:0000287
GO:0004540 GO:0090729 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar