F351920

General Info

Members Datasets Scaffolds Average Seq Length
239 145 478 283

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10056207|Ga0105239_100562072
Length 323
Sequence MHRFDRYDPAQWNCAGFERRKPSFHALIATAQQVPDGARRALVASSSRRIDKDDSMASGSGKIRVGIGGWKFAPWRETFYPDGLAQKNELDYASRHMTAIEVNSTFYAGQKPATYAKWRSETPDGFVFSLKAPGLITQVRDAARAKRGIQAFVFGGLAELGDRLGPISWQFPPSRKFDAAEFTAFLDLLPADLDGTPLRHVLEVRHESFRCDDYVQLARERKLPTVYTDSDDYPSIADITGDFVYARLMRSRSSITTGYTKPELDRWADNAQTWAAGRAPEDLEYVSTSRAPVRKRDVFIYFISAAKERNPAAAMALRERLER

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
140 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
141 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
145 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 0
Rhizoplane 2.09
Rhizosphere 82.85
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10056207 3300010375 Bacteria 4317
2 JGI24741J21665_1001062 3300001915 Bacteria 8211
3 JGI25151J46595_10002281 3300003187 Bacteria 11760
4 rootL2_10169779 3300003322 Bacteria 3493
5 Ga0055526_1002129 3300003771 Bacteria 13590
6 Ga0055526_1004157 3300003771 Bacteria 8812
7 Ga0055537_1001272 3300003773 Bacteria 10482
8 Ga0055524_1001427 3300003775 Bacteria 13737
9 Ga0055536_1000102 3300003781 Bacteria 73767
10 Ga0055534_1000779 3300003784 Bacteria 14930
11 Ga0055534_1001355 3300003784 Bacteria 9811
12 Ga0070666_10088326 3300005335 Bacteria 2127
13 Ga0070680_100003953 3300005336 Bacteria 11089
14 Ga0070668_100050526 3300005347 Bacteria 3201
15 Ga0070671_100127713 3300005355 Bacteria 2141
16 Ga0070667_100050335 3300005367 Bacteria 3511
17 Ga0070667_100295092 3300005367 Bacteria 1459
18 Ga0070663_100000068 3300005455 Bacteria 44842
19 Ga0070663_100020652 3300005455 Bacteria 4364
20 Ga0070681_10000462 3300005458 Bacteria 33195
21 Ga0068867_100140342 3300005459 Bacteria 1888
22 Ga0070685_10007945 3300005466 Bacteria 5436
23 Ga0070679_100002596 3300005530 Bacteria 16423
24 Ga0068853_100000582 3300005539 Bacteria 24978
25 Ga0068853_100037781 3300005539 Bacteria 4110
26 Ga0068853_100326571 3300005539 Bacteria 1423
27 Ga0070672_100007516 3300005543 Bacteria 7399
28 Ga0070693_100111107 3300005547 Bacteria 1686
29 Ga0070665_100000095 3300005548 Bacteria 170459
30 Ga0070665_100203577 3300005548 Bacteria 1980
31 Ga0068856_100067904 3300005614 Bacteria 3523
32 Ga0068852_100122401 3300005616 Bacteria 2385
33 Ga0068859_100007861 3300005617 Bacteria 10823
34 Ga0068859_100516859 3300005617 Bacteria 1289
35 Ga0068864_100042958 3300005618 Bacteria 3869
36 Ga0068864_100121087 3300005618 Bacteria 2339
37 Ga0068851_10075426 3300005834 Bacteria 1752
38 Ga0068863_100015895 3300005841 Bacteria 7218
39 Ga0068863_100026586 3300005841 Bacteria 5519
40 Ga0068863_100071607 3300005841 Bacteria 3280
41 Ga0068858_100092709 3300005842 Bacteria 2811
42 Ga0068858_100103543 3300005842 Bacteria 2655
43 Ga0068858_100511803 3300005842 Unclassified 1160
44 Ga0068860_100034421 3300005843 Bacteria 4858
45 Ga0068860_100135308 3300005843 Bacteria 2366
46 Ga0068862_100000103 3300005844 Bacteria 101651
47 Ga0081540_1004239 3300005983 Bacteria 11015
48 Ga0097621_100017657 3300006237 Bacteria 5425
49 Ga0097621_100104166 3300006237 Bacteria 2390
50 Ga0068865_100060575 3300006881 Bacteria 2650
51 Ga0097620_100007861 3300006931 Bacteria 10823
52 Ga0097620_100516893 3300006931 Bacteria 1289
53 Ga0105240_10000617 3300009093 Bacteria 65935
54 Ga0105240_10039225 3300009093 Bacteria 6067
55 Ga0105240_10421205 3300009093 Bacteria 1500
56 Ga0105242_10106526 3300009176 Bacteria 2382
57 Ga0105242_10122125 3300009176 Bacteria 2237
58 Ga0105248_10000216 3300009177 Bacteria 66621
59 Ga0105248_10405101 3300009177 Bacteria 1536
60 Ga0105237_10001539 3300009545 Bacteria 30116
61 Ga0105237_10010519 3300009545 Bacteria 9831
62 Ga0105237_10293753 3300009545 Bacteria 1628
63 Ga0105238_10000891 3300009551 Bacteria 30711
64 Ga0105238_10054808 3300009551 Bacteria 4003
65 Ga0105249_10000175 3300009553 Bacteria 74934
66 Ga0105239_10060734 3300010375 Bacteria 4149
67 Ga0105239_10066973 3300010375 Bacteria 3945
68 Ga0105239_10099256 3300010375 Bacteria 3219
69 Ga0105239_10449084 3300010375 Bacteria 1462
70 Ga0157369_10000032 3300013105 Bacteria 202272
71 Ga0157374_10041382 3300013296 Bacteria 4246
72 Ga0163162_10018111 3300013306 Bacteria 6895
73 Ga0163162_10035231 3300013306 Bacteria 4983
74 Ga0163162_10037345 3300013306 Bacteria 4847
75 Ga0163162_10204303 3300013306 Bacteria 2105
76 Ga0157372_10009500 3300013307 Bacteria 10344
77 Ga0157372_10133086 3300013307 Bacteria 2863
78 Ga0157372_10192281 3300013307 Bacteria 2364
79 Ga0157375_10008260 3300013308 Bacteria 9113
80 Ga0157379_10028085 3300014968 Bacteria 5008
81 Ga0157379_10285219 3300014968 Bacteria 1503
82 Ga0157376_10029831 3300014969 Bacteria 4348
83 Ga0163161_10099570 3300017792 Bacteria 2162
84 Ga0209233_1015019 3300025261 Bacteria 2169
85 Ga0209565_1000778 3300025263 Bacteria 18530
86 Ga0209673_1044610 3300025273 Bacteria 1226
87 Ga0209675_1000241 3300025291 Bacteria 54674
88 Ga0209675_1000827 3300025291 Bacteria 20359
89 Ga0209676_1000036 3300025292 Bacteria 457623
90 Ga0209025_1000770 3300025294 Bacteria 53136
91 Ga0209564_1000693 3300025295 Bacteria 49337
92 Ga0209564_1001608 3300025295 Bacteria 21952
93 Ga0209256_1001969 3300025299 Bacteria 18530
94 Ga0207656_10072184 3300025321 Bacteria 1536
95 Ga0207680_10121453 3300025903 Bacteria 1709
96 Ga0207707_10000716 3300025912 Bacteria 32816
97 Ga0207695_10000032 3300025913 Bacteria 521283
98 Ga0207695_10024600 3300025913 Bacteria 6767
99 Ga0207695_10071115 3300025913 Bacteria 3554
100 Ga0207695_10463486 3300025913 Bacteria 1150
101 Ga0207671_10003960 3300025914 Bacteria 14405
102 Ga0207671_10007575 3300025914 Bacteria 9400
103 Ga0207671_10235690 3300025914 Bacteria 1437
104 Ga0207660_10000365 3300025917 Bacteria 29498
105 Ga0207652_10000682 3300025921 Bacteria 33154
106 Ga0207694_10000821 3300025924 Bacteria 27776
107 Ga0207694_10035023 3300025924 Bacteria 3850
108 Ga0207694_10175618 3300025924 Bacteria 1736
109 Ga0207686_10010133 3300025934 Bacteria 5123
110 Ga0207704_10016731 3300025938 Bacteria 3778
111 Ga0207704_10241403 3300025938 Bacteria 1350
112 Ga0207691_10008273 3300025940 Bacteria 9986
113 Ga0207711_10002476 3300025941 Bacteria 16483
114 Ga0207711_10125086 3300025941 Bacteria 2299
115 Ga0207689_10037619 3300025942 Bacteria 4013
116 Ga0207667_10114538 3300025949 Bacteria 2779
117 Ga0207712_10000548 3300025961 Bacteria 30382
118 Ga0207668_10012479 3300025972 Bacteria 5202
119 Ga0207658_10003063 3300025986 Bacteria 11965
120 Ga0207658_10003277 3300025986 Bacteria 11499
121 Ga0207677_10066492 3300026023 Bacteria 2521
122 Ga0207677_10102169 3300026023 Bacteria 2113
123 Ga0207703_10019400 3300026035 Bacteria 5312
124 Ga0207703_10074091 3300026035 Bacteria 2818
125 Ga0207703_10609288 3300026035 Bacteria 1033
126 Ga0207639_10109455 3300026041 Bacteria 2248
127 Ga0207639_10269728 3300026041 Bacteria 1492
128 Ga0207639_10295250 3300026041 Bacteria 1430
129 Ga0207678_10006730 3300026067 Bacteria 10191
130 Ga0207641_10015099 3300026088 Bacteria 6328
131 Ga0207641_10062053 3300026088 Bacteria 3188
132 Ga0207648_10052536 3300026089 Bacteria 3563
133 Ga0207676_10061614 3300026095 Bacteria 2971
134 Ga0207676_10191888 3300026095 Bacteria 1798
135 Ga0207683_10035454 3300026121 Bacteria 4339
136 Ga0207683_10299411 3300026121 Bacteria 1471
137 Ga0207698_10005378 3300026142 Bacteria 7904
138 Ga0268266_10000001 3300028379 Bacteria 4040580
139 Ga0268266_10073363 3300028379 Bacteria 2970
140 Ga0268266_10174400 3300028379 Bacteria 1954
141 Ga0268265_10000354 3300028380 Bacteria 49786
142 Ga0268265_10036226 3300028380 Bacteria 3613
143 Ga0268264_10014391 3300028381 Bacteria 6503
144 Ga0373937_0245552 3300036401 Bacteria 1687
145 Ga0395900_0001185 3300037418 Bacteria 32334
146 Ga0395898_0000973 3300037466 Bacteria 45223
147 Ga0439452_036491 3300042010 Bacteria 1177
148 Ga0466961_0290581 3300044693 Bacteria 999
149 Ga0466963_0003251 3300044694 Bacteria 9261
150 Ga0466964_0012834 3300044706 Bacteria 3173
151 Ga0466957_0058776 3300044842 Bacteria 2355
152 Ga0466959_0000061 3300045049 Bacteria 76186
153 Ga0466959_0051303 3300045049 Bacteria 3026
154 Ga0466958_0052488 3300045836 Bacteria 2471
155 Ga0466958_0215706 3300045836 Bacteria 1223
156 Ga0466967_0091451 3300045976 Bacteria 2765
157 Ga0466967_0120021 3300045976 Bacteria 2428
158 Ga0495658_0084577 3300046683 Bacteria 1868
159 Ga0496102_0098312 3300048905 Bacteria 2716
160 Ga0496103_0125451 3300048906 Unclassified 1637
161 Ga0496104_0001153 3300048907 Bacteria 22633
162 Ga0496105_0000012 3300048908 Bacteria 261713
163 Ga0496115_0000375 3300048918 Bacteria 36924
164 Ga0496118_0001109 3300048921 Bacteria 41808
165 Ga0496118_0001923 3300048921 Bacteria 29489
166 Ga0496118_0012333 3300048921 Bacteria 8224
167 Ga0496118_0025784 3300048921 Bacteria 5029
168 Ga0496121_0075396 3300048924 Bacteria 2695
169 Ga0496122_0000129 3300048925 Bacteria 173688
170 Ga0496123_0000113 3300048926 Bacteria 163689
171 Ga0496126_0000057 3300048929 Bacteria 276781
172 Ga0496126_0021329 3300048929 Bacteria 6328
173 Ga0496126_0097070 3300048929 Bacteria 2583
174 Ga0496126_0415763 3300048929 Bacteria 1088
175 Ga0501031_0002473 3300049568 Bacteria 11788
176 Ga0501031_0090080 3300049568 Bacteria 2000
177 Ga0501031_0243242 3300049568 Bacteria 1169
178 Ga0501032_0000744 3300049569 Bacteria 26473
179 Ga0501032_0007145 3300049569 Bacteria 8177
180 Ga0501033_0001487 3300049570 Bacteria 20756
181 Ga0501033_0001644 3300049570 Bacteria 19591
182 Ga0501034_0003545 3300049571 Bacteria 17728
183 Ga0501034_0286117 3300049571 Bacteria 1587
184 Ga0501036_0003132 3300049572 Bacteria 13193
185 Ga0501036_0092609 3300049572 Bacteria 2553
186 Ga0501037_0000478 3300049573 Bacteria 32369
187 Ga0501037_0000566 3300049573 Bacteria 29217
188 Ga0501038_0000945 3300049574 Bacteria 25936
189 Ga0501038_0015691 3300049574 Bacteria 6884
190 Ga0501039_0014301 3300049575 Bacteria 6075
191 Ga0501043_0003348 3300049579 Bacteria 13203
192 Ga0501043_0019074 3300049579 Bacteria 5384
193 Ga0501043_0189796 3300049579 Bacteria 1598
194 Ga0501046_0000760 3300049580 Bacteria 31143
195 Ga0501046_0002431 3300049580 Bacteria 17463
196 Ga0501047_0007649 3300049581 Bacteria 10174
197 Ga0501047_0013475 3300049581 Bacteria 7749
198 Ga0501047_0164754 3300049581 Bacteria 2087
199 Ga0501048_0055470 3300049582 Bacteria 2813
200 Ga0501048_0180441 3300049582 Bacteria 1496
201 Ga0501067_0008360 3300049583 Bacteria 5745
202 Ga0501067_0109755 3300049583 Bacteria 1534
203 Ga0501068_0043150 3300049584 Bacteria 2713
204 Ga0501068_0205655 3300049584 Bacteria 1249
205 Ga0501069_0012384 3300049585 Bacteria 4532
206 Ga0501069_0063220 3300049585 Bacteria 2067
207 Ga0501070_0102373 3300049586 Bacteria 2368
208 Ga0501070_0316601 3300049586 Bacteria 1269
209 Ga0501071_0015486 3300049587 Bacteria 5236
210 Ga0501072_0013123 3300049588 Bacteria 6341
211 Ga0501073_0003128 3300049589 Bacteria 12403
212 Ga0501073_0038024 3300049589 Bacteria 3415
213 Ga0501073_0253574 3300049589 Bacteria 1214
214 Ga0501074_0015083 3300049590 Bacteria 5621
215 Ga0501074_0049590 3300049590 Bacteria 3032
216 Ga0501076_0194429 3300049592 Bacteria 1656
217 Ga0501077_0278516 3300049593 Bacteria 1064
218 Ga0501079_0097033 3300049741 Bacteria 2285
219 Ga0501080_0001573 3300049742 Bacteria 19327
220 Ga0501080_0208339 3300049742 Bacteria 1792
221 Ga0501080_0374474 3300049742 Bacteria 1283
222 Ga0501035_0004394 3300049822 Bacteria 13380
223 Ga0501035_0109771 3300049822 Bacteria 2418
224 Ga0501035_0141964 3300049822 Bacteria 2087
225 Ga0501044_0013681 3300049823 Bacteria 8768
226 Ga0501044_0047262 3300049823 Bacteria 4451
227 Ga0501044_0107364 3300049823 Bacteria 2803
228 Ga0501044_0190262 3300049823 Bacteria 2015
229 Ga0501044_0420034 3300049823 Bacteria 1247
230 nmdc:mga00v17_78372_c1 3300050491 Bacteria 1209
231 Ga0500643_002799 3300053087 Bacteria 8719
232 Ga0500651_0023358 3300053093 Bacteria 3873
233 Ga0500597_000117 3300053120 Bacteria 16212
234 Ga0500588_0094520 3300053146 Bacteria 1021
235 Ga0500620_024636 3300053155 Bacteria 1841
236 Ga0501082_0271627 3300060353 Bacteria 1476
237 Ga0466962_0062017 3300061719 Bacteria 1784
238 2525557049 2524614729 Bacteria 3091755
239 2630648645 2627854209 Bacteria 3093011
240 Ga0105239_10056207
241 JGI24741J21665_1001062
242 JGI25151J46595_10002281
243 rootL2_10169779
244 Ga0055526_1002129
245 Ga0055526_1004157
246 Ga0055537_1001272
247 Ga0055524_1001427
248 Ga0055536_1000102
249 Ga0055534_1000779
250 Ga0055534_1001355
251 Ga0070666_10088326
252 Ga0070680_100003953
253 Ga0070668_100050526
254 Ga0070671_100127713
255 Ga0070667_100050335
256 Ga0070667_100295092
257 Ga0070663_100000068
258 Ga0070663_100020652
259 Ga0070681_10000462
260 Ga0068867_100140342
261 Ga0070685_10007945
262 Ga0070679_100002596
263 Ga0068853_100000582
264 Ga0068853_100037781
265 Ga0068853_100326571
266 Ga0070672_100007516
267 Ga0070693_100111107
268 Ga0070665_100000095
269 Ga0070665_100203577
270 Ga0068856_100067904
271 Ga0068852_100122401
272 Ga0068859_100007861
273 Ga0068859_100516859
274 Ga0068864_100042958
275 Ga0068864_100121087
276 Ga0068851_10075426
277 Ga0068863_100015895
278 Ga0068863_100026586
279 Ga0068863_100071607
280 Ga0068858_100092709
281 Ga0068858_100103543
282 Ga0068858_100511803
283 Ga0068860_100034421
284 Ga0068860_100135308
285 Ga0068862_100000103
286 Ga0081540_1004239
287 Ga0097621_100017657
288 Ga0097621_100104166
289 Ga0068865_100060575
290 Ga0097620_100007861
291 Ga0097620_100516893
292 Ga0105240_10000617
293 Ga0105240_10039225
294 Ga0105240_10421205
295 Ga0105242_10106526
296 Ga0105242_10122125
297 Ga0105248_10000216
298 Ga0105248_10405101
299 Ga0105237_10001539
300 Ga0105237_10010519
301 Ga0105237_10293753
302 Ga0105238_10000891
303 Ga0105238_10054808
304 Ga0105249_10000175
305 Ga0105239_10060734
306 Ga0105239_10066973
307 Ga0105239_10099256
308 Ga0105239_10449084
309 Ga0157369_10000032
310 Ga0157374_10041382
311 Ga0163162_10018111
312 Ga0163162_10035231
313 Ga0163162_10037345
314 Ga0163162_10204303
315 Ga0157372_10009500
316 Ga0157372_10133086
317 Ga0157372_10192281
318 Ga0157375_10008260
319 Ga0157379_10028085
320 Ga0157379_10285219
321 Ga0157376_10029831
322 Ga0163161_10099570
323 Ga0209233_1015019
324 Ga0209565_1000778
325 Ga0209673_1044610
326 Ga0209675_1000241
327 Ga0209675_1000827
328 Ga0209676_1000036
329 Ga0209025_1000770
330 Ga0209564_1000693
331 Ga0209564_1001608
332 Ga0209256_1001969
333 Ga0207656_10072184
334 Ga0207680_10121453
335 Ga0207707_10000716
336 Ga0207695_10000032
337 Ga0207695_10024600
338 Ga0207695_10071115
339 Ga0207695_10463486
340 Ga0207671_10003960
341 Ga0207671_10007575
342 Ga0207671_10235690
343 Ga0207660_10000365
344 Ga0207652_10000682
345 Ga0207694_10000821
346 Ga0207694_10035023
347 Ga0207694_10175618
348 Ga0207686_10010133
349 Ga0207704_10016731
350 Ga0207704_10241403
351 Ga0207691_10008273
352 Ga0207711_10002476
353 Ga0207711_10125086
354 Ga0207689_10037619
355 Ga0207667_10114538
356 Ga0207712_10000548
357 Ga0207668_10012479
358 Ga0207658_10003063
359 Ga0207658_10003277
360 Ga0207677_10066492
361 Ga0207677_10102169
362 Ga0207703_10019400
363 Ga0207703_10074091
364 Ga0207703_10609288
365 Ga0207639_10109455
366 Ga0207639_10269728
367 Ga0207639_10295250
368 Ga0207678_10006730
369 Ga0207641_10015099
370 Ga0207641_10062053
371 Ga0207648_10052536
372 Ga0207676_10061614
373 Ga0207676_10191888
374 Ga0207683_10035454
375 Ga0207683_10299411
376 Ga0207698_10005378
377 Ga0268266_10000001
378 Ga0268266_10073363
379 Ga0268266_10174400
380 Ga0268265_10000354
381 Ga0268265_10036226
382 Ga0268264_10014391
383 Ga0373937_0245552
384 Ga0395900_0001185
385 Ga0395898_0000973
386 Ga0439452_036491
387 Ga0466961_0290581
388 Ga0466963_0003251
389 Ga0466964_0012834
390 Ga0466957_0058776
391 Ga0466959_0000061
392 Ga0466959_0051303
393 Ga0466958_0052488
394 Ga0466958_0215706
395 Ga0466967_0091451
396 Ga0466967_0120021
397 Ga0495658_0084577
398 Ga0496102_0098312
399 Ga0496103_0125451
400 Ga0496104_0001153
401 Ga0496105_0000012
402 Ga0496115_0000375
403 Ga0496118_0001109
404 Ga0496118_0001923
405 Ga0496118_0012333
406 Ga0496118_0025784
407 Ga0496121_0075396
408 Ga0496122_0000129
409 Ga0496123_0000113
410 Ga0496126_0000057
411 Ga0496126_0021329
412 Ga0496126_0097070
413 Ga0496126_0415763
414 Ga0501031_0002473
415 Ga0501031_0090080
416 Ga0501031_0243242
417 Ga0501032_0000744
418 Ga0501032_0007145
419 Ga0501033_0001487
420 Ga0501033_0001644
421 Ga0501034_0003545
422 Ga0501034_0286117
423 Ga0501036_0003132
424 Ga0501036_0092609
425 Ga0501037_0000478
426 Ga0501037_0000566
427 Ga0501038_0000945
428 Ga0501038_0015691
429 Ga0501039_0014301
430 Ga0501043_0003348
431 Ga0501043_0019074
432 Ga0501043_0189796
433 Ga0501046_0000760
434 Ga0501046_0002431
435 Ga0501047_0007649
436 Ga0501047_0013475
437 Ga0501047_0164754
438 Ga0501048_0055470
439 Ga0501048_0180441
440 Ga0501067_0008360
441 Ga0501067_0109755
442 Ga0501068_0043150
443 Ga0501068_0205655
444 Ga0501069_0012384
445 Ga0501069_0063220
446 Ga0501070_0102373
447 Ga0501070_0316601
448 Ga0501071_0015486
449 Ga0501072_0013123
450 Ga0501073_0003128
451 Ga0501073_0038024
452 Ga0501073_0253574
453 Ga0501074_0015083
454 Ga0501074_0049590
455 Ga0501076_0194429
456 Ga0501077_0278516
457 Ga0501079_0097033
458 Ga0501080_0001573
459 Ga0501080_0208339
460 Ga0501080_0374474
461 Ga0501035_0004394
462 Ga0501035_0109771
463 Ga0501035_0141964
464 Ga0501044_0013681
465 Ga0501044_0047262
466 Ga0501044_0107364
467 Ga0501044_0190262
468 Ga0501044_0420034
469 nmdc:mga00v17_78372_c1
470 Ga0500643_002799
471 Ga0500651_0023358
472 Ga0500597_000117
473 Ga0500588_0094520
474 Ga0500620_024636
475 Ga0501082_0271627
476 Ga0466962_0062017
477 2525557049
478 2630648645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

80

320

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7423 20 276
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7169 20 276
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7142 20 279
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.6819 20 277
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.6759 20 279
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7423 20 276 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7384 20 279 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7235 20 279 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7169 20 276 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7151 20 279 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A375DYH5-F1-model_v4 DUF72 domain-containing protein 0.9932 20 279
AF-A0A375H4P7-F1-model_v4 DUF72 domain-containing protein 0.9929 19 279
AF-A0A511Q0C2-F1-model_v4 deleted 0.9929 20 279
AF-A0A4Q7RX37-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9922 18 279
AF-A0A1W7A0H9-F1-model_v4 DUF72 domain-containing protein 0.9914 20 280

Map