F351998

General Info

Members Datasets Scaffolds Average Seq Length
239 140 234 281

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10092422|Ga0207705_100924223
Length 317
Sequence MIVSRVALGRRGTCGTTRSSRGRVGLMAESIAVLGTGIMGAPMARNLARAGFTVRAWNRTRSKAETLNADGVAVCATAAQAAEGAEFVLTMLGDGDAVESTMTGRSDDGGSVLDAMDRDAIWLQCSTVGIDACERLGRLAADAGVAYVDAPVLGTRKPAEEAKLNVLASGDNALRDRCSAVFAAVGQNTRWLGPAGAGSRLKLVMNSWVLAVTAAVAEAVALAEKLNLDPALFLSTLEGSQIDTPYAHIKGGAMIRRDFSTSFPAAGAAKDSGLIVDAMSSSGVNPDVARAVLAKMRRAVDAGHGDADMAAAYLVTR

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
4 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
5 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 4.6
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 5.44
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10203257 3300003320 Bacteria 2593
2 Ga0070658_10000425 3300005327 Bacteria 36618
3 Ga0070658_10044447 3300005327 Bacteria 3590
4 Ga0070658_10154637 3300005327 Bacteria 1922
5 Ga0070683_100216837 3300005329 Bacteria 1818
6 Ga0070683_100409371 3300005329 Bacteria 1293
7 Ga0070680_100051526 3300005336 Bacteria 3359
8 Ga0070680_100256820 3300005336 Bacteria 1478
9 Ga0070682_100071818 3300005337 Bacteria 2216
10 Ga0068868_100260296 3300005338 Bacteria 1463
11 Ga0070660_100088911 3300005339 Bacteria 2433
12 Ga0070660_100290737 3300005339 Bacteria 1338
13 Ga0070700_100143220 3300005441 Bacteria 1627
14 Ga0070663_100104898 3300005455 Bacteria 2115
15 Ga0070681_10289799 3300005458 Bacteria 1547
16 Ga0070679_100001761 3300005530 Bacteria 19505
17 Ga0070679_100129609 3300005530 Bacteria 2504
18 Ga0070679_100192809 3300005530 Bacteria 2006
19 Ga0070679_100205489 3300005530 Bacteria 1934
20 Ga0070684_100213380 3300005535 Bacteria 1759
21 Ga0068853_100138203 3300005539 Bacteria 2186
22 Ga0068855_100007191 3300005563 Bacteria 13508
23 Ga0068855_100019845 3300005563 Bacteria 8075
24 Ga0070664_100019627 3300005564 Bacteria 5562
25 Ga0068857_100549171 3300005577 Bacteria 1088
26 Ga0068856_100102253 3300005614 Bacteria 2859
27 Ga0068852_100043573 3300005616 Bacteria 3807
28 Ga0081455_10000425 3300005937 Bacteria 55362
29 Ga0075432_10013471 3300006058 Bacteria 2778
30 Ga0075431_100242203 3300006847 Bacteria 1834
31 Ga0075434_100068796 3300006871 Bacteria 3528
32 Ga0075436_100035863 3300006914 Bacteria 3421
33 Ga0105240_10016607 3300009093 Bacteria 9958
34 Ga0105240_10508049 3300009093 Bacteria 1339
35 Ga0111539_10092623 3300009094 Bacteria 3551
36 Ga0105245_10449807 3300009098 Unclassified 1296
37 Ga0114129_10410146 3300009147 Bacteria 1784
38 Ga0105243_10130569 3300009148 Bacteria 2131
39 Ga0105242_10118195 3300009176 Bacteria 2270
40 Ga0105249_10563630 3300009553 Bacteria 1191
41 Ga0105239_10229218 3300010375 Bacteria 2084
42 Ga0157371_10250633 3300013102 Bacteria 1275
43 Ga0157370_10029893 3300013104 Bacteria 5340
44 Ga0157370_10140081 3300013104 Bacteria 2254
45 Ga0157369_10018166 3300013105 Bacteria 7887
46 Ga0157369_10023908 3300013105 Bacteria 6801
47 Ga0157374_10552078 3300013296 Unclassified 1160
48 Ga0157372_10341450 3300013307 Bacteria 1744
49 Ga0157372_10581207 3300013307 Bacteria 1306
50 Ga0157375_10778278 3300013308 Bacteria 1107
51 Ga0157375_10939272 3300013308 Bacteria 1007
52 Ga0157380_10236725 3300014326 Bacteria 1643
53 Ga0157377_10242848 3300014745 Bacteria 1163
54 Ga0197907_10077697 3300020069 Bacteria 3285
55 Ga0206349_1088445 3300020075 Bacteria 5007
56 Ga0206351_10003697 3300020077 Bacteria 1421
57 Ga0206350_10557732 3300020080 Bacteria 1068
58 Ga0206350_10716730 3300020080 Bacteria 5470
59 Ga0206350_10738944 3300020080 Bacteria 10200
60 Ga0206353_11824581 3300020082 Bacteria 5532
61 Ga0154015_1001691 3300020610 Bacteria 1300
62 Ga0224712_10022678 3300022467 Bacteria 2168
63 Ga0224712_10045747 3300022467 Bacteria 1676
64 Ga0224712_10119291 3300022467 Bacteria 1140
65 Ga0207705_10001502 3300025909 Bacteria 18535
66 Ga0207705_10092422 3300025909 Bacteria 2217
67 Ga0207705_10401955 3300025909 Bacteria 1059
68 Ga0207695_10087913 3300025913 Bacteria 3130
69 Ga0207695_10383537 3300025913 Unclassified 1291
70 Ga0207660_10183293 3300025917 Bacteria 1627
71 Ga0207657_10065095 3300025919 Bacteria 3109
72 Ga0207652_10161912 3300025921 Bacteria 2006
73 Ga0207652_10184516 3300025921 Bacteria 1876
74 Ga0207686_10163128 3300025934 Bacteria 1564
75 Ga0207661_10233467 3300025944 Bacteria 1630
76 Ga0207679_10140737 3300025945 Bacteria 1950
77 Ga0207667_10013247 3300025949 Bacteria 9451
78 Ga0207712_10333582 3300025961 Bacteria 1255
79 Ga0207639_10034486 3300026041 Bacteria 3740
80 Ga0207678_10119076 3300026067 Bacteria 2253
81 Ga0207708_10204160 3300026075 Bacteria 1578
82 Ga0207428_10059300 3300027907 Bacteria 3035
83 Ga0268266_10011426 3300028379 Bacteria 7723
84 Ga0265325_10040377 3300031241 Bacteria 2451
85 Ga0307518_10000568 3300031838 Bacteria 28041
86 Ga0307406_10022561 3300031901 Bacteria 3736
87 Ga0307412_10143771 3300031911 Bacteria 1751
88 Ga0307409_100028195 3300031995 Bacteria 3995
89 Ga0307416_100096915 3300032002 Bacteria 2552
90 Ga0307415_100002584 3300032126 Bacteria 9047
91 Ga0307507_10006669 3300033179 Bacteria 17476
92 Ga0307507_10070641 3300033179 Bacteria 3165
93 Ga0373925_0854346 3300037068 Bacteria 750
94 Ga0395899_0033363 3300037312 Bacteria 3866
95 Ga0395898_0048029 3300037466 Bacteria 4187
96 Ga0395901_0133253 3300038443 Bacteria 2611
97 Ga0466969_0008842 3300044656 Bacteria 5341
98 Ga0466969_0045107 3300044656 Bacteria 2189
99 Ga0466972_0142603 3300044658 Bacteria 1127
100 Ga0466965_0046836 3300044683 Bacteria 2141
101 Ga0466966_0001210 3300044684 Bacteria 16559
102 Ga0466966_0013272 3300044684 Bacteria 5455
103 Ga0466966_0085151 3300044684 Bacteria 1965
104 Ga0466961_0006627 3300044693 Bacteria 7364
105 Ga0466961_0022032 3300044693 Bacteria 4100
106 Ga0466961_0246549 3300044693 Bacteria 1097
107 Ga0466963_0002257 3300044694 Bacteria 10707
108 Ga0466963_0012596 3300044694 Bacteria 5180
109 Ga0466963_0037035 3300044694 Bacteria 3184
110 Ga0466963_0043601 3300044694 Bacteria 2950
111 Ga0466963_0044329 3300044694 Bacteria 2928
112 Ga0466963_0093147 3300044694 Bacteria 2053
113 Ga0466963_0096874 3300044694 Bacteria 2015
114 Ga0466963_0156535 3300044694 Bacteria 1584
115 Ga0466963_0192879 3300044694 Bacteria 1423
116 Ga0466964_0010615 3300044706 Bacteria 3475
117 Ga0466964_0105870 3300044706 Bacteria 1247
118 Ga0466964_0125440 3300044706 Bacteria 1162
119 Ga0466971_0009799 3300044719 Bacteria 4182
120 Ga0466971_0009946 3300044719 Bacteria 4155
121 Ga0466971_0012691 3300044719 Bacteria 3695
122 Ga0466971_0040383 3300044719 Bacteria 2096
123 Ga0466970_0018788 3300044765 Bacteria 3581
124 Ga0466970_0057212 3300044765 Bacteria 2085
125 Ga0466970_0093702 3300044765 Bacteria 1632
126 Ga0466970_0191722 3300044765 Bacteria 1136
127 Ga0466957_0002465 3300044842 Bacteria 9942
128 Ga0466957_0003088 3300044842 Bacteria 9065
129 Ga0466957_0003285 3300044842 Bacteria 8857
130 Ga0466957_0115320 3300044842 Bacteria 1708
131 Ga0466957_0240033 3300044842 Bacteria 1202
132 Ga0466960_0011838 3300044901 Bacteria 3666
133 Ga0466960_0022832 3300044901 Bacteria 2801
134 Ga0466960_0025513 3300044901 Bacteria 2676
135 Ga0466960_0101787 3300044901 Bacteria 1480
136 Ga0466960_0185134 3300044901 Bacteria 1131
137 Ga0466960_0305758 3300044901 Bacteria 897
138 Ga0466959_0000571 3300045049 Bacteria 21491
139 Ga0466959_0008139 3300045049 Bacteria 7398
140 Ga0466959_0023323 3300045049 Bacteria 4579
141 Ga0466959_0029873 3300045049 Bacteria 4037
142 Ga0466959_0328752 3300045049 Bacteria 1044
143 Ga0466958_0000028 3300045836 Bacteria 41097
144 Ga0466958_0005351 3300045836 Bacteria 6897
145 Ga0466958_0023818 3300045836 Bacteria 3598
146 Ga0466958_0048831 3300045836 Bacteria 2559
147 Ga0466958_0057883 3300045836 Bacteria 2356
148 Ga0466958_0172630 3300045836 Bacteria 1369
149 Ga0466967_0002938 3300045976 Bacteria 10877
150 Ga0466967_0004646 3300045976 Bacteria 9314
151 Ga0466967_0023703 3300045976 Bacteria 5034
152 Ga0466967_0029911 3300045976 Bacteria 4564
153 Ga0466967_0062780 3300045976 Bacteria 3299
154 Ga0466967_0063461 3300045976 Bacteria 3282
155 Ga0466967_0108055 3300045976 Bacteria 2552
156 Ga0466967_0113186 3300045976 Bacteria 2496
157 Ga0466967_0448425 3300045976 Bacteria 1261
158 Ga0466967_0874549 3300045976 Bacteria 893
159 Ga0466967_1035452 3300045976 Bacteria 817
160 Ga0495606_0005125 3300046507 Bacteria 12719
161 Ga0495608_0000035 3300046511 Bacteria 133011
162 Ga0495608_0369884 3300046511 Bacteria 880
163 Ga0495630_0026947 3300046517 Bacteria 4259
164 Ga0495656_0017176 3300046615 Bacteria 2758
165 Ga0495668_0000397 3300046616 Bacteria 57230
166 Ga0495668_0251929 3300046616 Bacteria 967
167 Ga0495625_0001844 3300046660 Bacteria 24194
168 Ga0495657_0000026 3300046675 Bacteria 133011
169 Ga0495674_0203177 3300047319 Bacteria 1643
170 Ga0495683_0073642 3300047323 Bacteria 1675
171 Ga0495675_0000015 3300047444 Bacteria 133004
172 Ga0495626_0000174 3300048091 Bacteria 79833
173 Ga0496102_0284240 3300048905 Bacteria 1559
174 Ga0496102_0377324 3300048905 Bacteria 1334
175 Ga0496103_0013294 3300048906 Bacteria 4879
176 Ga0496103_0019608 3300048906 Bacteria 4060
177 Ga0496106_0018144 3300048909 Bacteria 5204
178 Ga0496106_0138854 3300048909 Bacteria 1911
179 Ga0496108_0000005 3300048911 Bacteria 535059
180 Ga0496108_0040848 3300048911 Bacteria 3869
181 Ga0496109_0000002 3300048912 Bacteria 443393
182 Ga0496109_0058221 3300048912 Bacteria 3529
183 Ga0496110_0017656 3300048913 Bacteria 5966
184 Ga0496110_0637730 3300048913 Bacteria 965
185 Ga0496113_0281141 3300048916 Bacteria 1331
186 Ga0496116_0003733 3300048919 Bacteria 14892
187 Ga0496119_0004013 3300048922 Bacteria 14881
188 Ga0496119_0072628 3300048922 Bacteria 2009
189 Ga0496120_0003288 3300048923 Bacteria 14896
190 Ga0496121_0047344 3300048924 Bacteria 3670
191 Ga0496121_0100952 3300048924 Bacteria 2227
192 Ga0501031_0029330 3300049568 Bacteria 3589
193 Ga0501032_0007193 3300049569 Bacteria 8140
194 Ga0501033_0064960 3300049570 Bacteria 2684
195 Ga0501034_0002636 3300049571 Bacteria 21263
196 Ga0501036_0006739 3300049572 Bacteria 9338
197 Ga0501038_0005695 3300049574 Bacteria 11558
198 Ga0501038_0044816 3300049574 Bacteria 3841
199 Ga0501039_0001726 3300049575 Bacteria 16112
200 Ga0501043_0001393 3300049579 Bacteria 21126
201 Ga0501043_0010324 3300049579 Bacteria 7321
202 Ga0501047_0000056 3300049581 Bacteria 143501
203 Ga0501047_0004021 3300049581 Bacteria 13822
204 Ga0501047_0258821 3300049581 Unclassified 1588
205 Ga0501047_0290352 3300049581 Bacteria 1479
206 Ga0501048_0000697 3300049582 Bacteria 24452
207 Ga0501067_0090976 3300049583 Bacteria 1694
208 Ga0501067_0166126 3300049583 Bacteria 1229
209 Ga0501069_0107571 3300049585 Bacteria 1586
210 Ga0501069_0154891 3300049585 Bacteria 1318
211 Ga0501070_0005525 3300049586 Bacteria 10780
212 Ga0501070_0049586 3300049586 Bacteria 3486
213 Ga0501070_0113681 3300049586 Bacteria 2237
214 Ga0501074_0011231 3300049590 Bacteria 6509
215 Ga0501074_0044957 3300049590 Bacteria 3196
216 Ga0501080_0064837 3300049742 Bacteria 3398
217 Ga0501080_0349741 3300049742 Bacteria 1335
218 Ga0501035_0010245 3300049822 Bacteria 8697
219 Ga0501035_0049590 3300049822 Bacteria 3761
220 Ga0501044_0027876 3300049823 Bacteria 5962
221 Ga0501044_0131443 3300049823 Bacteria 2497
222 Ga0501044_0172398 3300049823 Bacteria 2134
223 nmdc:mga05p37_125050_c1 3300050507 Bacteria 3158
224 nmdc:mga06r32_76477_c1 3300050510 Bacteria 3251
225 nmdc:mga08y16_37454_c1 3300050511 Bacteria 5093
226 nmdc:mga0a205_141094_c1 3300050515 Bacteria 2310
227 Ga0495601_0013543 3300053077 Bacteria 4905
228 Ga0495595_0000017 3300053084 Bacteria 133011
229 Ga0495619_0000101 3300053085 Bacteria 64377
230 Ga0500616_0001377 3300053153 Bacteria 23533
231 Ga0466962_0000408 3300061719 Bacteria 18589
232 Ga0466962_0002800 3300061719 Bacteria 8292
233 Ga0466962_0031539 3300061719 Bacteria 2537
234 Ga0466962_0305732 3300061719 Bacteria 787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0854346 Ga0373925_0854346_11_637 204
2 3300022467 Ga0224712_10119291 Ga0224712_101192912 212
3 3300046511 Ga0495608_0000035 Ga0495608_0000035_71358_72170 225
4 3300046675 Ga0495657_0000026 Ga0495657_0000026_60842_61654 225
5 3300047444 Ga0495675_0000015 Ga0495675_0000015_60835_61647 225
6 3300053084 Ga0495595_0000017 Ga0495595_0000017_60842_61654 225
7 3300053085 Ga0495619_0000101 Ga0495619_0000101_60842_61654 225
8 3300045976 Ga0466967_1035452 Ga0466967_1035452_16_729 232
9 3300061719 Ga0466962_0305732 Ga0466962_0305732_17_733 232
10 3300020080 Ga0206350_10716730 Ga0206350_107167303 233
11 3300005327 Ga0070658_10154637 Ga0070658_101546373 234
12 3300013105 Ga0157369_10023908 Ga0157369_100239087 234
13 3300020082 Ga0206353_11824581 Ga0206353_118245815 234
14 3300048905 Ga0496102_0284240 Ga0496102_0284240_421_1278 237
15 3300048909 Ga0496106_0138854 Ga0496106_0138854_384_1241 237
16 3300048916 Ga0496113_0281141 Ga0496113_0281141_244_1113 239
17 3300044901 Ga0466960_0101787 Ga0466960_0101787_18_857 245
18 3300048922 Ga0496119_0072628 Ga0496119_0072628_449_1360 245
19 3300048906 Ga0496103_0013294 Ga0496103_0013294_4012_4836 247
20 3300009553 Ga0105249_10563630 Ga0105249_105636302 248
21 3300046615 Ga0495656_0017176 Ga0495656_0017176_1096_1962 248
22 3300048924 Ga0496121_0047344 Ga0496121_0047344_399_1463 248
23 3300048919 Ga0496116_0003733 Ga0496116_0003733_3247_4137 249
24 3300048922 Ga0496119_0004013 Ga0496119_0004013_10746_11636 249
25 3300010375 Ga0105239_10229218 Ga0105239_102292182 251
26 3300044684 Ga0466966_0013272 Ga0466966_0013272_1499_2311 251
27 3300044693 Ga0466961_0006627 Ga0466961_0006627_511_1323 251
28 3300044719 Ga0466971_0040383 Ga0466971_0040383_921_1733 251
29 3300044765 Ga0466970_0018788 Ga0466970_0018788_795_1607 251
30 3300044842 Ga0466957_0115320 Ga0466957_0115320_483_1295 251
31 3300045836 Ga0466958_0023818 Ga0466958_0023818_1286_2098 251
32 3300005937 Ga0081455_10000425 Ga0081455_100004257 252
33 3300045049 Ga0466959_0008139 Ga0466959_0008139_557_1378 252
34 3300045836 Ga0466958_0057883 Ga0466958_0057883_387_1286 252
35 3300045976 Ga0466967_0108055 Ga0466967_0108055_960_1784 252
36 3300044694 Ga0466963_0096874 Ga0466963_0096874_18_827 253
37 3300044706 Ga0466964_0125440 Ga0466964_0125440_258_1091 254
38 3300045976 Ga0466967_0002938 Ga0466967_0002938_449_1282 254
39 3300013104 Ga0157370_10140081 Ga0157370_101400813 255
40 3300048911 Ga0496108_0000005 Ga0496108_0000005_185852_186733 255
41 3300048912 Ga0496109_0000002 Ga0496109_0000002_348359_349240 255
42 3300044901 Ga0466960_0185134 Ga0466960_0185134_267_1082 257
43 3300005338 Ga0068868_100260296 Ga0068868_1002602962 258
44 3300005441 Ga0070700_100143220 Ga0070700_1001432202 258
45 3300005455 Ga0070663_100104898 Ga0070663_1001048983 258
46 3300005564 Ga0070664_100019627 Ga0070664_1000196272 258
47 3300009148 Ga0105243_10130569 Ga0105243_101305692 258
48 3300013307 Ga0157372_10341450 Ga0157372_103414502 258
49 3300014326 Ga0157380_10236725 Ga0157380_102367252 258
50 3300014745 Ga0157377_10242848 Ga0157377_102428482 258
51 3300025944 Ga0207661_10233467 Ga0207661_102334672 258
52 3300025945 Ga0207679_10140737 Ga0207679_101407373 258
53 3300025961 Ga0207712_10333582 Ga0207712_103335822 258
54 3300026067 Ga0207678_10119076 Ga0207678_101190763 258
55 3300026075 Ga0207708_10204160 Ga0207708_102041602 258
56 3300044765 Ga0466970_0191722 Ga0466970_0191722_88_939 258
57 3300045049 Ga0466959_0029873 Ga0466959_0029873_242_1183 260
58 3300031241 Ga0265325_10040377 Ga0265325_100403772 261
59 3300045976 Ga0466967_0063461 Ga0466967_0063461_2353_3213 261
60 3300046517 Ga0495630_0026947 Ga0495630_0026947_828_1676 261
61 3300047319 Ga0495674_0203177 Ga0495674_0203177_612_1460 261
62 3300053077 Ga0495601_0013543 Ga0495601_0013543_3227_4075 261
63 3300044694 Ga0466963_0012596 Ga0466963_0012596_438_1289 262
64 3300044901 Ga0466960_0305758 Ga0466960_0305758_12_815 263
65 3300045976 Ga0466967_0023703 Ga0466967_0023703_3098_3934 263
66 3300005329 Ga0070683_100409371 Ga0070683_1004093711 264
67 3300005535 Ga0070684_100213380 Ga0070684_1002133802 264
68 3300006058 Ga0075432_10013471 Ga0075432_100134713 264
69 3300006847 Ga0075431_100242203 Ga0075431_1002422032 264
70 3300006871 Ga0075434_100068796 Ga0075434_1000687965 264
71 3300006914 Ga0075436_100035863 Ga0075436_1000358634 264
72 3300009094 Ga0111539_10092623 Ga0111539_100926233 264
73 3300009147 Ga0114129_10410146 Ga0114129_104101462 264
74 3300027907 Ga0207428_10059300 Ga0207428_100593003 264
75 3300044694 Ga0466963_0043601 Ga0466963_0043601_356_1165 264
76 3300044694 Ga0466963_0093147 Ga0466963_0093147_819_1658 264
77 3300044694 Ga0466963_0156535 Ga0466963_0156535_293_1132 264
78 3300044719 Ga0466971_0009946 Ga0466971_0009946_2198_3037 264
79 3300045836 Ga0466958_0048831 Ga0466958_0048831_330_1169 264
80 3300045976 Ga0466967_0029911 Ga0466967_0029911_2133_2972 264
81 3300045976 Ga0466967_0874549 Ga0466967_0874549_17_826 264
82 3300048924 Ga0496121_0100952 Ga0496121_0100952_925_1764 264
83 3300050507 nmdc:mga05p37_125050_c1 nmdc:mga05p37_125050_c1_1923_2777 264
84 3300050510 nmdc:mga06r32_76477_c1 nmdc:mga06r32_76477_c1_1559_2413 264
85 3300050511 nmdc:mga08y16_37454_c1 nmdc:mga08y16_37454_c1_826_1680 264
86 3300050515 nmdc:mga0a205_141094_c1 nmdc:mga0a205_141094_c1_1403_2257 264
87 3300061719 Ga0466962_0031539 Ga0466962_0031539_1057_1896 264
88 3300005336 Ga0070680_100051526 Ga0070680_1000515262 265
89 3300005530 Ga0070679_100001761 Ga0070679_10000176118 265
90 3300044656 Ga0466969_0045107 Ga0466969_0045107_1345_2154 265
91 3300049570 Ga0501033_0064960 Ga0501033_0064960_14_895 265
92 3300049571 Ga0501034_0002636 Ga0501034_0002636_11546_12427 265
93 3300049572 Ga0501036_0006739 Ga0501036_0006739_5172_6053 265
94 3300049574 Ga0501038_0044816 Ga0501038_0044816_1679_2560 265
95 3300049575 Ga0501039_0001726 Ga0501039_0001726_11729_12610 265
96 3300049579 Ga0501043_0001393 Ga0501043_0001393_3992_4873 265
97 3300049586 Ga0501070_0005525 Ga0501070_0005525_3373_4254 265
98 3300049590 Ga0501074_0011231 Ga0501074_0011231_4122_5003 265
99 3300049822 Ga0501035_0049590 Ga0501035_0049590_1790_2671 265
100 3300049823 Ga0501044_0172398 Ga0501044_0172398_136_1017 265
101 3300013296 Ga0157374_10552078 Ga0157374_105520781 266
102 3300044658 Ga0466972_0142603 Ga0466972_0142603_109_972 266
103 3300044683 Ga0466965_0046836 Ga0466965_0046836_488_1351 266
104 3300044693 Ga0466961_0246549 Ga0466961_0246549_221_1084 266
105 3300044694 Ga0466963_0037035 Ga0466963_0037035_2097_2957 266
106 3300044694 Ga0466963_0044329 Ga0466963_0044329_473_1336 266
107 3300044706 Ga0466964_0010615 Ga0466964_0010615_1788_2651 266
108 3300044765 Ga0466970_0093702 Ga0466970_0093702_458_1321 266
109 3300044842 Ga0466957_0003285 Ga0466957_0003285_3879_4742 266
110 3300044901 Ga0466960_0025513 Ga0466960_0025513_632_1495 266
111 3300045049 Ga0466959_0328752 Ga0466959_0328752_81_944 266
112 3300045976 Ga0466967_0004646 Ga0466967_0004646_1708_2571 266
113 iso_pu_bacteria 2917736166 2917741394 266
114 3300005336 Ga0070680_100256820 Ga0070680_1002568202 267
115 3300005458 Ga0070681_10289799 Ga0070681_102897991 267
116 3300005530 Ga0070679_100205489 Ga0070679_1002054892 267
117 3300005577 Ga0068857_100549171 Ga0068857_1005491711 267
118 3300013308 Ga0157375_10778278 Ga0157375_107782782 267
119 3300025917 Ga0207660_10183293 Ga0207660_101832932 267
120 3300028379 Ga0268266_10011426 Ga0268266_100114263 267
121 3300033179 Ga0307507_10006669 Ga0307507_1000666915 267
122 3300044694 Ga0466963_0192879 Ga0466963_0192879_177_1037 267
123 3300044842 Ga0466957_0240033 Ga0466957_0240033_36_902 267
124 3300045836 Ga0466958_0172630 Ga0466958_0172630_360_1220 267
125 3300048905 Ga0496102_0377324 Ga0496102_0377324_176_1033 267
126 3300048906 Ga0496103_0019608 Ga0496103_0019608_853_1710 267
127 3300048909 Ga0496106_0018144 Ga0496106_0018144_354_1211 267
128 3300048911 Ga0496108_0040848 Ga0496108_0040848_964_1821 267
129 3300048912 Ga0496109_0058221 Ga0496109_0058221_924_1781 267
130 3300048913 Ga0496110_0017656 Ga0496110_0017656_3680_4537 267
131 3300048913 Ga0496110_0637730 Ga0496110_0637730_70_927 267
132 3300048923 Ga0496120_0003288 Ga0496120_0003288_9604_10491 267
133 3300049583 Ga0501067_0090976 Ga0501067_0090976_37_885 267
134 3300049583 Ga0501067_0166126 Ga0501067_0166126_24_839 267
135 3300049585 Ga0501069_0107571 Ga0501069_0107571_66_923 267
136 3300049585 Ga0501069_0154891 Ga0501069_0154891_382_1230 267
137 3300005339 Ga0070660_100290737 Ga0070660_1002907372 268
138 3300005539 Ga0068853_100138203 Ga0068853_1001382034 268
139 3300025909 Ga0207705_10092422 Ga0207705_100924223 268
140 3300026041 Ga0207639_10034486 Ga0207639_100344862 268
141 3300031838 Ga0307518_10000568 Ga0307518_1000056816 268
142 3300031901 Ga0307406_10022561 Ga0307406_100225613 268
143 3300031911 Ga0307412_10143771 Ga0307412_101437712 268
144 3300031995 Ga0307409_100028195 Ga0307409_1000281951 268
145 3300032002 Ga0307416_100096915 Ga0307416_1000969152 268
146 3300032126 Ga0307415_100002584 Ga0307415_1000025844 268
147 3300044765 Ga0466970_0057212 Ga0466970_0057212_416_1294 268
148 3300044842 Ga0466957_0002465 Ga0466957_0002465_284_1183 268
149 3300046616 Ga0495668_0251929 Ga0495668_0251929_19_885 268
150 iso_pu_bacteria 2585427649 2586059230 268
151 iso_pu_bacteria 2622736605 2623501156 268
152 iso_pu_bacteria 2808606522 2809592015 268
153 iso_pu_bacteria 2915768154 2915774509 268
154 3300009098 Ga0105245_10449807 Ga0105245_104498072 269
155 3300009176 Ga0105242_10118195 Ga0105242_101181952 269
156 3300013102 Ga0157371_10250633 Ga0157371_102506332 269
157 3300044656 Ga0466969_0008842 Ga0466969_0008842_1133_1990 269
158 3300044684 Ga0466966_0085151 Ga0466966_0085151_725_1582 269
159 3300044693 Ga0466961_0022032 Ga0466961_0022032_837_1694 269
160 3300044719 Ga0466971_0009799 Ga0466971_0009799_1816_2673 269
161 3300045049 Ga0466959_0000571 Ga0466959_0000571_3355_4212 269
162 3300045836 Ga0466958_0005351 Ga0466958_0005351_3356_4213 269
163 3300045976 Ga0466967_0113186 Ga0466967_0113186_1335_2189 269
164 3300049568 Ga0501031_0029330 Ga0501031_0029330_2285_3157 269
165 3300049569 Ga0501032_0007193 Ga0501032_0007193_3382_4254 269
166 3300049574 Ga0501038_0005695 Ga0501038_0005695_6680_7552 269
167 3300049579 Ga0501043_0010324 Ga0501043_0010324_5409_6281 269
168 3300049581 Ga0501047_0004021 Ga0501047_0004021_6271_7143 269
169 3300049581 Ga0501047_0258821 Ga0501047_0258821_136_1035 269
170 3300049581 Ga0501047_0290352 Ga0501047_0290352_334_1206 269
171 3300049582 Ga0501048_0000697 Ga0501048_0000697_1181_2053 269
172 3300049742 Ga0501080_0349741 Ga0501080_0349741_257_1156 269
173 3300049822 Ga0501035_0010245 Ga0501035_0010245_3835_4707 269
174 3300049823 Ga0501044_0027876 Ga0501044_0027876_4729_5628 269
175 3300061719 Ga0466962_0000408 Ga0466962_0000408_4155_5012 269
176 3300005327 Ga0070658_10000425 Ga0070658_1000042529 270
177 3300005327 Ga0070658_10044447 Ga0070658_100444472 270
178 3300005329 Ga0070683_100216837 Ga0070683_1002168372 270
179 3300005337 Ga0070682_100071818 Ga0070682_1000718182 270
180 3300005339 Ga0070660_100088911 Ga0070660_1000889112 270
181 3300005530 Ga0070679_100129609 Ga0070679_1001296092 270
182 3300005530 Ga0070679_100192809 Ga0070679_1001928092 270
183 3300005563 Ga0068855_100007191 Ga0068855_1000071912 270
184 3300005563 Ga0068855_100019845 Ga0068855_1000198453 270
185 3300005614 Ga0068856_100102253 Ga0068856_1001022533 270
186 3300005616 Ga0068852_100043573 Ga0068852_1000435732 270
187 3300009093 Ga0105240_10016607 Ga0105240_100166077 270
188 3300009093 Ga0105240_10508049 Ga0105240_105080492 270
189 3300013104 Ga0157370_10029893 Ga0157370_100298934 270
190 3300013105 Ga0157369_10018166 Ga0157369_100181665 270
191 3300013307 Ga0157372_10581207 Ga0157372_105812071 270
192 3300013308 Ga0157375_10939272 Ga0157375_109392721 270
193 3300020069 Ga0197907_10077697 Ga0197907_100776976 270
194 3300020075 Ga0206349_1088445 Ga0206349_10884451 270
195 3300020077 Ga0206351_10003697 Ga0206351_100036971 270
196 3300020080 Ga0206350_10557732 Ga0206350_105577321 270
197 3300020080 Ga0206350_10738944 Ga0206350_107389448 270
198 3300020610 Ga0154015_1001691 Ga0154015_10016912 270
199 3300022467 Ga0224712_10022678 Ga0224712_100226783 270
200 3300022467 Ga0224712_10045747 Ga0224712_100457471 270
201 3300025909 Ga0207705_10001502 Ga0207705_1000150214 270
202 3300025909 Ga0207705_10401955 Ga0207705_104019552 270
203 3300025913 Ga0207695_10087913 Ga0207695_100879133 270
204 3300025913 Ga0207695_10383537 Ga0207695_103835372 270
205 3300025919 Ga0207657_10065095 Ga0207657_100650952 270
206 3300025921 Ga0207652_10161912 Ga0207652_101619122 270
207 3300025921 Ga0207652_10184516 Ga0207652_101845162 270
208 3300025934 Ga0207686_10163128 Ga0207686_101631282 270
209 3300025949 Ga0207667_10013247 Ga0207667_100132474 270
210 3300033179 Ga0307507_10070641 Ga0307507_100706413 270
211 3300037312 Ga0395899_0033363 Ga0395899_0033363_358_1242 270
212 3300037466 Ga0395898_0048029 Ga0395898_0048029_2850_3734 270
213 3300038443 Ga0395901_0133253 Ga0395901_0133253_957_1841 270
214 3300044684 Ga0466966_0001210 Ga0466966_0001210_7821_8681 270
215 3300044694 Ga0466963_0002257 Ga0466963_0002257_2377_3237 270
216 3300044706 Ga0466964_0105870 Ga0466964_0105870_47_907 270
217 3300044719 Ga0466971_0012691 Ga0466971_0012691_51_911 270
218 3300044842 Ga0466957_0003088 Ga0466957_0003088_3886_4746 270
219 3300044901 Ga0466960_0011838 Ga0466960_0011838_1410_2294 270
220 3300045049 Ga0466959_0023323 Ga0466959_0023323_930_1790 270
221 3300045836 Ga0466958_0000028 Ga0466958_0000028_22887_23747 270
222 3300045976 Ga0466967_0062780 Ga0466967_0062780_1893_2753 270
223 3300046511 Ga0495608_0369884 Ga0495608_0369884_32_856 270
224 3300049586 Ga0501070_0049586 Ga0501070_0049586_181_1050 270
225 3300049586 Ga0501070_0113681 Ga0501070_0113681_1234_2076 270
226 3300049590 Ga0501074_0044957 Ga0501074_0044957_328_1197 270
227 3300049742 Ga0501080_0064837 Ga0501080_0064837_1928_2797 270
228 3300053153 Ga0500616_0001377 Ga0500616_0001377_18684_19574 270
229 3300061719 Ga0466962_0002800 Ga0466962_0002800_3620_4480 270
230 3300003320 rootH2_10203257 rootH2_102032573 271
231 3300044901 Ga0466960_0022832 Ga0466960_0022832_729_1580 271
232 3300045976 Ga0466967_0448425 Ga0466967_0448425_25_903 271
233 3300046507 Ga0495606_0005125 Ga0495606_0005125_6700_7545 271
234 3300046616 Ga0495668_0000397 Ga0495668_0000397_24067_24912 271
235 3300046660 Ga0495625_0001844 Ga0495625_0001844_4282_5127 271
236 3300047323 Ga0495683_0073642 Ga0495683_0073642_208_1053 271
237 3300048091 Ga0495626_0000174 Ga0495626_0000174_70402_71247 271
238 3300049581 Ga0501047_0000056 Ga0501047_0000056_107462_108319 271
239 3300049823 Ga0501044_0131443 Ga0501044_0131443_1433_2290 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

30

193

0.96

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

196

316

0.95

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

31

84

0.94

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

30

117

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9603 2 270
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.958 1 269
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.9567 1 270
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9532 4 268
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.95 2 270
ID Description Score Start End Superfamily
af_Q5RKN4_340_462_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9751 153 270 1.10.1040.10
3pduA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9748 152 270 1.10.1040.10
af_Q8T079_480_601_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9724 152 269 1.10.1040.10
3pefB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9715 152 270 1.10.1040.10
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9683 148 268 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A2H5DQR3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9855 114 266 GO:0051287
AF-A0A6I5VGR9-F1-model_v4 NAD-binding protein 0.9846 2 268 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A2K4VUF6-F1-model_v4 deleted 0.9758 2 125
AF-A0A2K4VU91-F1-model_v4 deleted 0.9742 143 270
AF-A0A538J101-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9726 47 271 GO:0016054
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
96.85 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map