F352056

General Info

Members Datasets Scaffolds Average Seq Length
239 145 238 290

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10000584|Ga0265338_1000058428
Length 334
Sequence MTHPARAGRLQAPGWRFAPRRRWDPGDIPLTSVRAGEEVGNAGAGSGGRVIEFSGRDGNHLAADVAGAPGDPPVVLLHGGGQTRHSWGTTLGALAGRGWRAYAVDLRGHGESEWAADGDYTLDAFAGDVLAVAHALGTPPALVGASLGGIASLAAIGEHPDEEVARALVLVDVAPRMEEQGRMRIGAFMAEHMNDGFASLDDVADAIQAYNPHRPRPTDLGGLAKNLRHGDDGRWYWHWDPAFIGGRLGGTDETRASLVDPVRLKQAALGLTLPTLLVRGRVSDLLSEEGAQELLQLVPHAQMVDVAGAGHMVAGDRNDLFNDAVVTFLETVHG

Samples

Sample ID Description Type Environment
1 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
67 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
68 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
69 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 7.11
Rhizosphere 87.45
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10019607 3300003320 Bacteria 3147
2 JGI25407J50210_10000128 3300003373 Bacteria 11210
3 Ga0070676_10215213 3300005328 Bacteria 1266
4 Ga0070683_100338677 3300005329 Bacteria 1432
5 Ga0068868_100303873 3300005338 Bacteria 1356
6 Ga0070671_100077162 3300005355 Bacteria 2784
7 Ga0070673_100059821 3300005364 Bacteria 3017
8 Ga0070705_100101225 3300005440 Bacteria 1820
9 Ga0070693_100124272 3300005547 Bacteria 1604
10 Ga0068859_100000069 3300005617 Bacteria 96098
11 Ga0068859_100005733 3300005617 Bacteria 12631
12 Ga0068858_100000789 3300005842 Bacteria 33040
13 Ga0068858_100257278 3300005842 Bacteria 1659
14 Ga0068860_100014910 3300005843 Bacteria 7600
15 Ga0068862_100000109 3300005844 Bacteria 98348
16 Ga0068862_100006169 3300005844 Bacteria 9980
17 Ga0081455_10001211 3300005937 Bacteria 32318
18 Ga0081455_10002240 3300005937 Bacteria 23025
19 Ga0081538_10000479 3300005981 Bacteria 44929
20 Ga0081538_10005781 3300005981 Bacteria 11037
21 Ga0075363_100038653 3300006048 Bacteria 2510
22 Ga0075364_10014349 3300006051 Bacteria 4895
23 Ga0070716_100307879 3300006173 Bacteria 1105
24 Ga0075367_10046914 3300006178 Bacteria 2540
25 Ga0075428_100014964 3300006844 Bacteria 8622
26 Ga0075430_100011545 3300006846 Bacteria 7509
27 Ga0075430_100016142 3300006846 Bacteria 6360
28 Ga0075430_100142015 3300006846 Bacteria 1999
29 Ga0075431_100019125 3300006847 Bacteria 6979
30 Ga0075431_100192435 3300006847 Bacteria 2090
31 Ga0075431_100212103 3300006847 Bacteria 1978
32 Ga0075429_100000927 3300006880 Bacteria 23245
33 Ga0075429_100122503 3300006880 Bacteria 2273
34 Ga0075429_100292661 3300006880 Bacteria 1426
35 Ga0075429_100505662 3300006880 Bacteria 1059
36 Ga0097620_100000069 3300006931 Bacteria 96098
37 Ga0097620_100005733 3300006931 Bacteria 12631
38 Ga0075435_100247896 3300007076 Bacteria 1516
39 Ga0105240_10446772 3300009093 Unclassified 1448
40 Ga0111539_10001380 3300009094 Bacteria 32281
41 Ga0111539_10133745 3300009094 Bacteria 2904
42 Ga0105245_10038530 3300009098 Bacteria 4253
43 Ga0105245_10207425 3300009098 Bacteria 1884
44 Ga0105247_10000894 3300009101 Bacteria 22422
45 Ga0114129_10000293 3300009147 Bacteria 57817
46 Ga0114129_10038336 3300009147 Bacteria 6761
47 Ga0114129_10245992 3300009147 Bacteria 2403
48 Ga0114129_10504144 3300009147 Bacteria 1580
49 Ga0105243_10180431 3300009148 Bacteria 1835
50 Ga0105241_10058693 3300009174 Bacteria 2956
51 Ga0105242_10214859 3300009176 Bacteria 1715
52 Ga0105248_10439539 3300009177 Bacteria 1469
53 Ga0105248_10556052 3300009177 Bacteria 1295
54 Ga0105249_10000782 3300009553 Bacteria 28538
55 Ga0105249_10020712 3300009553 Bacteria 5881
56 Ga0105246_10142155 3300011119 Bacteria 1806
57 Ga0157379_10010510 3300014968 Bacteria 8068
58 Ga0157379_10305351 3300014968 Bacteria 1451
59 Ga0207687_10004944 3300025927 Bacteria 8847
60 Ga0207687_10008864 3300025927 Bacteria 6576
61 Ga0207700_10053272 3300025928 Bacteria 3031
62 Ga0207644_10000659 3300025931 Bacteria 21832
63 Ga0207686_10170973 3300025934 Bacteria 1532
64 Ga0207665_10209333 3300025939 Bacteria 1424
65 Ga0207711_10323630 3300025941 Bacteria 1425
66 Ga0207661_10209691 3300025944 Bacteria 1717
67 Ga0207712_10002249 3300025961 Bacteria 12540
68 Ga0207712_10155862 3300025961 Bacteria 1769
69 Ga0207703_10000015 3300026035 Bacteria 287079
70 Ga0207703_10221035 3300026035 Bacteria 1693
71 Ga0207683_10190648 3300026121 Bacteria 1861
72 Ga0268266_10202390 3300028379 Bacteria 1818
73 Ga0268265_10000259 3300028380 Bacteria 60056
74 Ga0268265_10061767 3300028380 Bacteria 2876
75 Ga0268264_10010360 3300028381 Bacteria 7710
76 Ga0265322_10064147 3300028654 Bacteria 1042
77 Ga0265338_10000584 3300028800 Bacteria 64255
78 Ga0265325_10000425 3300031241 Bacteria 30293
79 Ga0265339_10002369 3300031249 Bacteria 13526
80 Ga0265327_10089630 3300031251 Bacteria 1502
81 Ga0265316_10064849 3300031344 Bacteria 2829
82 Ga0265313_10002333 3300031595 Bacteria 16610
83 Ga0307409_100134958 3300031995 Bacteria 2116
84 Ga0307415_100061017 3300032126 Bacteria 2609
85 Ga0307415_100240776 3300032126 Bacteria 1463
86 Ga0373947_0268794 3300035725 Bacteria 1131
87 Ga0373937_0300811 3300036401 Bacteria 1516
88 Ga0451793_0181360 3300041452 Bacteria 1272
89 Ga0439448_0009361 3300042005 Bacteria 2887
90 Ga0439450_000757 3300042008 Bacteria 4388
91 Ga0439463_000851 3300042016 Bacteria 8365
92 Ga0439444_0007387 3300042437 Bacteria 1686
93 Ga0439460_0001290 3300042461 Bacteria 5877
94 Ga0439440_0008718 3300042993 Bacteria 2087
95 Ga0495629_0176260 3300046459 Bacteria 1483
96 Ga0495629_0260519 3300046459 Bacteria 1192
97 Ga0495638_0000581 3300046460 Bacteria 41303
98 Ga0495638_0001074 3300046460 Bacteria 26654
99 Ga0495653_0181536 3300046463 Bacteria 1444
100 Ga0495584_0004284 3300046491 Bacteria 7695
101 Ga0495607_0157804 3300046501 Bacteria 1155
102 Ga0495628_0200741 3300046516 Bacteria 1503
103 Ga0495630_0032477 3300046517 Bacteria 3890
104 Ga0495630_0457474 3300046517 Bacteria 978
105 Ga0495666_0070604 3300046526 Bacteria 1661
106 Ga0495640_0085974 3300046533 Bacteria 2083
107 Ga0495586_0017881 3300046535 Bacteria 3771
108 Ga0495634_0165219 3300046642 Bacteria 1393
109 Ga0495613_0015843 3300046689 Bacteria 5612
110 Ga0495671_0003645 3300046692 Bacteria 9382
111 Ga0495604_0280099 3300047317 Bacteria 1127
112 Ga0495674_0314400 3300047319 Bacteria 1277
113 Ga0495681_0000071 3300047470 Bacteria 94222
114 Ga0495602_0255577 3300048088 Bacteria 1303
115 Ga0495614_0004708 3300048089 Bacteria 6153
116 Ga0496102_0000276 3300048905 Bacteria 65515
117 Ga0496103_0000030 3300048906 Bacteria 211729
118 Ga0496103_0089583 3300048906 Bacteria 1941
119 Ga0496104_0061808 3300048907 Bacteria 3551
120 Ga0496104_0161449 3300048907 Bacteria 2149
121 Ga0496104_0309739 3300048907 Bacteria 1492
122 Ga0496105_0069054 3300048908 Bacteria 2920
123 Ga0496105_0368003 3300048908 Bacteria 1146
124 Ga0496107_0127453 3300048910 Bacteria 1878
125 Ga0496109_0049179 3300048912 Bacteria 3837
126 Ga0496110_0152500 3300048913 Bacteria 2093
127 Ga0496110_0198611 3300048913 Bacteria 1822
128 Ga0496112_0002983 3300048915 Bacteria 13811
129 Ga0496112_0062541 3300048915 Bacteria 3672
130 Ga0496112_0073968 3300048915 Bacteria 3369
131 Ga0496112_0260450 3300048915 Bacteria 1684
132 Ga0496119_0019234 3300048922 Bacteria 5043
133 Ga0496119_0033017 3300048922 Bacteria 3441
134 Ga0496120_0097677 3300048923 Bacteria 1558
135 Ga0496121_0054310 3300048924 Bacteria 3349
136 Ga0496126_0071960 3300048929 Bacteria 3077
137 Ga0501031_0039859 3300049568 Bacteria 3066
138 Ga0501031_0062858 3300049568 Bacteria 2419
139 Ga0501032_0043691 3300049569 Bacteria 3033
140 Ga0501032_0102553 3300049569 Bacteria 1896
141 Ga0501033_0013818 3300049570 Bacteria 6143
142 Ga0501033_0197780 3300049570 Bacteria 1437
143 Ga0501034_0028572 3300049571 Bacteria 5676
144 Ga0501034_0089813 3300049571 Bacteria 3070
145 Ga0501034_0149937 3300049571 Bacteria 2308
146 Ga0501036_0014084 3300049572 Bacteria 6647
147 Ga0501036_0019449 3300049572 Bacteria 5702
148 Ga0501036_0033324 3300049572 Bacteria 4356
149 Ga0501036_0318682 3300049572 Bacteria 1299
150 Ga0501036_0440009 3300049572 Bacteria 1086
151 Ga0501037_0023645 3300049573 Bacteria 4543
152 Ga0501038_0006734 3300049574 Bacteria 10616
153 Ga0501039_0015788 3300049575 Bacteria 5780
154 Ga0501039_0070704 3300049575 Bacteria 2711
155 Ga0501039_0227182 3300049575 Bacteria 1467
156 Ga0501040_0023549 3300049576 Bacteria 4129
157 Ga0501040_0033604 3300049576 Bacteria 3475
158 Ga0501040_0187769 3300049576 Bacteria 1466
159 Ga0501041_0024411 3300049577 Bacteria 3629
160 Ga0501041_0029365 3300049577 Bacteria 3317
161 Ga0501042_0012946 3300049578 Bacteria 5666
162 Ga0501042_0019984 3300049578 Bacteria 4658
163 Ga0501042_0192088 3300049578 Bacteria 1473
164 Ga0501043_0014175 3300049579 Bacteria 6237
165 Ga0501043_0033539 3300049579 Bacteria 4040
166 Ga0501043_0070587 3300049579 Bacteria 2744
167 Ga0501046_0004567 3300049580 Bacteria 12532
168 Ga0501046_0008037 3300049580 Bacteria 9220
169 Ga0501046_0012088 3300049580 Bacteria 7361
170 Ga0501047_0008545 3300049581 Bacteria 9660
171 Ga0501047_0577837 3300049581 Bacteria 947
172 Ga0501048_0022785 3300049582 Bacteria 4579
173 Ga0501048_0160906 3300049582 Bacteria 1589
174 Ga0501048_0376728 3300049582 Bacteria 1013
175 Ga0501067_0016129 3300049583 Bacteria 4131
176 Ga0501068_0028390 3300049584 Bacteria 3309
177 Ga0501069_0024361 3300049585 Bacteria 3300
178 Ga0501070_0065851 3300049586 Bacteria 3000
179 Ga0501070_0099916 3300049586 Bacteria 2400
180 Ga0501070_0294998 3300049586 Bacteria 1321
181 Ga0501071_0006036 3300049587 Bacteria 7846
182 Ga0501071_0029169 3300049587 Bacteria 3892
183 Ga0501071_0099636 3300049587 Bacteria 2141
184 Ga0501071_0111681 3300049587 Bacteria 2020
185 Ga0501072_0024662 3300049588 Bacteria 4681
186 Ga0501072_0479470 3300049588 Bacteria 984
187 Ga0501073_0023372 3300049589 Bacteria 4439
188 Ga0501074_0091541 3300049590 Bacteria 2178
189 Ga0501074_0138280 3300049590 Bacteria 1742
190 Ga0501074_0246486 3300049590 Bacteria 1270
191 Ga0501074_0283643 3300049590 Bacteria 1177
192 Ga0501075_0013573 3300049591 Bacteria 5817
193 Ga0501075_0277862 3300049591 Bacteria 1276
194 Ga0501076_0016993 3300049592 Bacteria 5524
195 Ga0501076_0204788 3300049592 Bacteria 1611
196 Ga0501076_0209996 3300049592 Bacteria 1590
197 Ga0501077_0004944 3300049593 Bacteria 8090
198 Ga0501077_0011734 3300049593 Bacteria 5477
199 Ga0501079_0017673 3300049741 Bacteria 5448
200 Ga0501079_0018578 3300049741 Bacteria 5310
201 Ga0501079_0031085 3300049741 Bacteria 4103
202 Ga0501079_0087876 3300049741 Bacteria 2406
203 Ga0501080_0005924 3300049742 Bacteria 10952
204 Ga0501080_0618729 3300049742 Bacteria 960
205 Ga0501081_0000899 3300049743 Bacteria 17638
206 Ga0501081_0014086 3300049743 Bacteria 5269
207 Ga0501083_0209608 3300049744 Bacteria 1270
208 Ga0501035_0249955 3300049822 Bacteria 1506
209 Ga0501044_0095456 3300049823 Bacteria 2996
210 Ga0501044_0184516 3300049823 Bacteria 2052
211 Ga0501045_0107281 3300049824 Bacteria 2069
212 nmdc:mga03n38_53356_c1 3300050490 Bacteria 1812
213 nmdc:mga00v17_1735_c1 3300050491 Bacteria 11322
214 nmdc:mga06z11_247504_c1 3300050494 Bacteria 1049
215 nmdc:mga05p37_227_c1 3300050507 Bacteria 57142
216 nmdc:mga05p37_278213_c1 3300050507 Bacteria 1997
217 nmdc:mga05p37_889152_c1 3300050507 Bacteria 962
218 nmdc:mga09592_313697_c1 3300050508 Bacteria 1359
219 nmdc:mga09592_545177_c1 3300050508 Bacteria 996
220 nmdc:mga09592_578_c1 3300050508 Bacteria 27739
221 nmdc:mga0qj67_1917_c1 3300050509 Bacteria 14765
222 nmdc:mga0qj67_207098_c1 3300050509 Bacteria 1593
223 nmdc:mga06r32_119872_c1 3300050510 Bacteria 2594
224 nmdc:mga06r32_57057_c1 3300050510 Bacteria 3751
225 nmdc:mga06r32_833_c1 3300050510 Bacteria 27340
226 nmdc:mga08y16_77424_c1 3300050511 Bacteria 3468
227 Ga0495619_0094155 3300053085 Bacteria 2032
228 Ga0500616_0013368 3300053153 Bacteria 4768
229 Ga0501084_0000104 3300054114 Bacteria 62893
230 Ga0501084_0013991 3300054114 Bacteria 6641
231 Ga0501084_0017201 3300054114 Bacteria 6007
232 Ga0501084_0341650 3300054114 Bacteria 1264
233 Ga0501082_0007500 3300060353 Bacteria 9413
234 Ga0501082_0020202 3300060353 Bacteria 5740
235 Ga0501082_0318024 3300060353 Bacteria 1356
236 Ga0530510_0000541 3300061734 Bacteria 24260
237 Ga0530510_0016128 3300061734 Bacteria 5283
238 Ga0530510_0158194 3300061734 Bacteria 1675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0577837 Ga0501047_0577837_20_787 237
2 3300032126 Ga0307415_100061017 Ga0307415_1000610172 256
3 3300032126 Ga0307415_100240776 Ga0307415_1002407762 256
4 3300049571 Ga0501034_0028572 Ga0501034_0028572_4360_5280 262
5 3300049823 Ga0501044_0184516 Ga0501044_0184516_669_1589 262
6 3300005617 Ga0068859_100000069 Ga0068859_10000006951 263
7 3300005617 Ga0068859_100005733 Ga0068859_1000057337 263
8 3300005842 Ga0068858_100000789 Ga0068858_1000007893 263
9 3300005844 Ga0068862_100000109 Ga0068862_10000010953 263
10 3300006931 Ga0097620_100000069 Ga0097620_10000006951 263
11 3300006931 Ga0097620_100005733 Ga0097620_10000573311 263
12 3300009101 Ga0105247_10000894 Ga0105247_1000089416 263
13 3300009177 Ga0105248_10439539 Ga0105248_104395392 263
14 3300009553 Ga0105249_10020712 Ga0105249_100207126 263
15 3300014968 Ga0157379_10010510 Ga0157379_100105108 263
16 3300025941 Ga0207711_10323630 Ga0207711_103236303 263
17 3300025961 Ga0207712_10002249 Ga0207712_100022493 263
18 3300026035 Ga0207703_10000015 Ga0207703_10000015167 263
19 3300028380 Ga0268265_10000259 Ga0268265_1000025917 263
20 3300048905 Ga0496102_0000276 Ga0496102_0000276_25011_25862 263
21 3300048906 Ga0496103_0000030 Ga0496103_0000030_69365_70216 263
22 3300048907 Ga0496104_0161449 Ga0496104_0161449_1250_2101 263
23 3300048922 Ga0496119_0019234 Ga0496119_0019234_589_1440 263
24 3300048922 Ga0496119_0033017 Ga0496119_0033017_828_1679 263
25 3300048923 Ga0496120_0097677 Ga0496120_0097677_120_971 263
26 3300048924 Ga0496121_0054310 Ga0496121_0054310_525_1376 263
27 3300048929 Ga0496126_0071960 Ga0496126_0071960_2023_2874 263
28 iso_pu_bacteria 2937843397 2937847293 263
29 3300009553 Ga0105249_10000782 Ga0105249_1000078218 267
30 3300049589 Ga0501073_0023372 Ga0501073_0023372_2281_3135 268
31 3300006178 Ga0075367_10046914 Ga0075367_100469141 269
32 3300006844 Ga0075428_100014964 Ga0075428_1000149644 269
33 3300006846 Ga0075430_100011545 Ga0075430_1000115456 269
34 3300006847 Ga0075431_100019125 Ga0075431_1000191252 269
35 3300006880 Ga0075429_100000927 Ga0075429_10000092721 269
36 3300009147 Ga0114129_10000293 Ga0114129_1000029348 269
37 3300050494 nmdc:mga06z11_247504_c1 nmdc:mga06z11_247504_c1_84_962 269
38 3300050507 nmdc:mga05p37_227_c1 nmdc:mga05p37_227_c1_20423_21313 269
39 3300050508 nmdc:mga09592_578_c1 nmdc:mga09592_578_c1_5198_6088 269
40 3300050509 nmdc:mga0qj67_1917_c1 nmdc:mga0qj67_1917_c1_4067_4957 269
41 3300050510 nmdc:mga06r32_833_c1 nmdc:mga06r32_833_c1_14844_15734 269
42 3300005844 Ga0068862_100006169 Ga0068862_1000061696 270
43 3300028380 Ga0268265_10061767 Ga0268265_100617672 270
44 3300009177 Ga0105248_10556052 Ga0105248_105560522 271
45 3300009093 Ga0105240_10446772 Ga0105240_104467722 272
46 3300048915 Ga0496112_0062541 Ga0496112_0062541_1855_2703 272
47 3300005328 Ga0070676_10215213 Ga0070676_102152132 273
48 3300005981 Ga0081538_10005781 Ga0081538_100057812 273
49 3300006880 Ga0075429_100505662 Ga0075429_1005056621 273
50 3300009094 Ga0111539_10001380 Ga0111539_1000138030 273
51 3300009147 Ga0114129_10504144 Ga0114129_105041442 273
52 3300046460 Ga0495638_0000581 Ga0495638_0000581_11321_12196 273
53 3300046460 Ga0495638_0001074 Ga0495638_0001074_14437_15312 273
54 3300046491 Ga0495584_0004284 Ga0495584_0004284_5190_6065 273
55 3300046501 Ga0495607_0157804 Ga0495607_0157804_212_1087 273
56 3300046692 Ga0495671_0003645 Ga0495671_0003645_7968_8843 273
57 3300047470 Ga0495681_0000071 Ga0495681_0000071_39642_40517 273
58 3300050507 nmdc:mga05p37_889152_c1 nmdc:mga05p37_889152_c1_42_902 273
59 3300050508 nmdc:mga09592_545177_c1 nmdc:mga09592_545177_c1_47_907 273
60 3300050511 nmdc:mga08y16_77424_c1 nmdc:mga08y16_77424_c1_640_1500 273
61 3300003373 JGI25407J50210_10000128 JGI25407J50210_100001286 274
62 3300005937 Ga0081455_10001211 Ga0081455_100012116 274
63 3300005937 Ga0081455_10002240 Ga0081455_1000224024 274
64 3300005981 Ga0081538_10000479 Ga0081538_1000047927 274
65 3300006880 Ga0075429_100292661 Ga0075429_1002926612 274
66 3300009094 Ga0111539_10133745 Ga0111539_101337453 274
67 3300009098 Ga0105245_10038530 Ga0105245_100385303 274
68 3300009147 Ga0114129_10245992 Ga0114129_102459922 274
69 3300009174 Ga0105241_10058693 Ga0105241_100586932 274
70 3300009176 Ga0105242_10214859 Ga0105242_102148592 274
71 3300011119 Ga0105246_10142155 Ga0105246_101421552 274
72 3300025927 Ga0207687_10004944 Ga0207687_100049444 274
73 3300025934 Ga0207686_10170973 Ga0207686_101709732 274
74 3300031251 Ga0265327_10089630 Ga0265327_100896302 274
75 3300042005 Ga0439448_0009361 Ga0439448_0009361_199_1065 274
76 3300042008 Ga0439450_000757 Ga0439450_000757_2995_3861 274
77 3300042016 Ga0439463_000851 Ga0439463_000851_3155_4021 274
78 3300042437 Ga0439444_0007387 Ga0439444_0007387_805_1671 274
79 3300042461 Ga0439460_0001290 Ga0439460_0001290_2314_3180 274
80 3300042993 Ga0439440_0008718 Ga0439440_0008718_357_1223 274
81 3300046459 Ga0495629_0176260 Ga0495629_0176260_561_1433 274
82 3300048089 Ga0495614_0004708 Ga0495614_0004708_853_1725 274
83 3300049568 Ga0501031_0039859 Ga0501031_0039859_1403_2281 274
84 3300049569 Ga0501032_0102553 Ga0501032_0102553_1008_1886 274
85 3300049570 Ga0501033_0013818 Ga0501033_0013818_2681_3559 274
86 3300049572 Ga0501036_0019449 Ga0501036_0019449_1699_2577 274
87 3300049572 Ga0501036_0440009 Ga0501036_0440009_13_879 274
88 3300049575 Ga0501039_0015788 Ga0501039_0015788_1056_1934 274
89 3300049576 Ga0501040_0033604 Ga0501040_0033604_1404_2282 274
90 3300049576 Ga0501040_0187769 Ga0501040_0187769_381_1247 274
91 3300049577 Ga0501041_0029365 Ga0501041_0029365_1922_2800 274
92 3300049578 Ga0501042_0012946 Ga0501042_0012946_3935_4813 274
93 3300049578 Ga0501042_0192088 Ga0501042_0192088_174_1040 274
94 3300049579 Ga0501043_0070587 Ga0501043_0070587_910_1788 274
95 3300049580 Ga0501046_0012088 Ga0501046_0012088_5913_6791 274
96 3300049582 Ga0501048_0022785 Ga0501048_0022785_1319_2197 274
97 3300049582 Ga0501048_0160906 Ga0501048_0160906_362_1228 274
98 3300049584 Ga0501068_0028390 Ga0501068_0028390_773_1651 274
99 3300049587 Ga0501071_0029169 Ga0501071_0029169_2468_3346 274
100 3300049588 Ga0501072_0024662 Ga0501072_0024662_3152_4030 274
101 3300049590 Ga0501074_0091541 Ga0501074_0091541_349_1227 274
102 3300049590 Ga0501074_0283643 Ga0501074_0283643_185_1051 274
103 3300049591 Ga0501075_0013573 Ga0501075_0013573_4028_4906 274
104 3300049591 Ga0501075_0277862 Ga0501075_0277862_388_1254 274
105 3300049592 Ga0501076_0016993 Ga0501076_0016993_3941_4819 274
106 3300049592 Ga0501076_0204788 Ga0501076_0204788_682_1548 274
107 3300049593 Ga0501077_0011734 Ga0501077_0011734_3216_4094 274
108 3300049741 Ga0501079_0018578 Ga0501079_0018578_3900_4778 274
109 3300049741 Ga0501079_0087876 Ga0501079_0087876_1166_2032 274
110 3300049743 Ga0501081_0014086 Ga0501081_0014086_505_1383 274
111 3300050507 nmdc:mga05p37_278213_c1 nmdc:mga05p37_278213_c1_492_1358 274
112 3300050508 nmdc:mga09592_313697_c1 nmdc:mga09592_313697_c1_480_1346 274
113 3300054114 Ga0501084_0013991 Ga0501084_0013991_5251_6129 274
114 3300060353 Ga0501082_0020202 Ga0501082_0020202_1001_1879 274
115 3300061734 Ga0530510_0000541 Ga0530510_0000541_20686_21564 274
116 3300061734 Ga0530510_0016128 Ga0530510_0016128_3986_4852 274
117 3300005329 Ga0070683_100338677 Ga0070683_1003386771 275
118 3300005338 Ga0068868_100303873 Ga0068868_1003038732 275
119 3300005355 Ga0070671_100077162 Ga0070671_1000771623 275
120 3300005440 Ga0070705_100101225 Ga0070705_1001012252 275
121 3300005547 Ga0070693_100124272 Ga0070693_1001242721 275
122 3300005842 Ga0068858_100257278 Ga0068858_1002572782 275
123 3300006048 Ga0075363_100038653 Ga0075363_1000386533 275
124 3300006051 Ga0075364_10014349 Ga0075364_100143493 275
125 3300007076 Ga0075435_100247896 Ga0075435_1002478962 275
126 3300009148 Ga0105243_10180431 Ga0105243_101804314 275
127 3300025927 Ga0207687_10008864 Ga0207687_100088643 275
128 3300025931 Ga0207644_10000659 Ga0207644_1000065910 275
129 3300025944 Ga0207661_10209691 Ga0207661_102096912 275
130 3300025961 Ga0207712_10155862 Ga0207712_101558622 275
131 3300026035 Ga0207703_10221035 Ga0207703_102210352 275
132 3300026121 Ga0207683_10190648 Ga0207683_101906482 275
133 3300028379 Ga0268266_10202390 Ga0268266_102023901 275
134 3300035725 Ga0373947_0268794 Ga0373947_0268794_221_1081 275
135 3300036401 Ga0373937_0300811 Ga0373937_0300811_642_1502 275
136 3300041452 Ga0451793_0181360 Ga0451793_0181360_254_1129 275
137 3300046459 Ga0495629_0260519 Ga0495629_0260519_25_885 275
138 3300046463 Ga0495653_0181536 Ga0495653_0181536_69_929 275
139 3300046516 Ga0495628_0200741 Ga0495628_0200741_332_1192 275
140 3300046517 Ga0495630_0457474 Ga0495630_0457474_62_937 275
141 3300046526 Ga0495666_0070604 Ga0495666_0070604_674_1534 275
142 3300046533 Ga0495640_0085974 Ga0495640_0085974_558_1427 275
143 3300046535 Ga0495586_0017881 Ga0495586_0017881_1140_2009 275
144 3300046642 Ga0495634_0165219 Ga0495634_0165219_92_961 275
145 3300046689 Ga0495613_0015843 Ga0495613_0015843_4205_5074 275
146 3300047319 Ga0495674_0314400 Ga0495674_0314400_201_1061 275
147 3300048088 Ga0495602_0255577 Ga0495602_0255577_254_1129 275
148 3300048915 Ga0496112_0260450 Ga0496112_0260450_183_1043 275
149 3300050490 nmdc:mga03n38_53356_c1 nmdc:mga03n38_53356_c1_14_889 275
150 3300053085 Ga0495619_0094155 Ga0495619_0094155_267_1142 275
151 3300006847 Ga0075431_100212103 Ga0075431_1002121032 276
152 3300009098 Ga0105245_10207425 Ga0105245_102074252 276
153 3300028654 Ga0265322_10064147 Ga0265322_100641471 276
154 3300047317 Ga0495604_0280099 Ga0495604_0280099_168_1031 276
155 3300049568 Ga0501031_0062858 Ga0501031_0062858_860_1753 276
156 3300049569 Ga0501032_0043691 Ga0501032_0043691_1342_2214 276
157 3300049570 Ga0501033_0197780 Ga0501033_0197780_223_1095 276
158 3300049571 Ga0501034_0089813 Ga0501034_0089813_1871_2749 276
159 3300049571 Ga0501034_0149937 Ga0501034_0149937_471_1343 276
160 3300049572 Ga0501036_0033324 Ga0501036_0033324_2845_3738 276
161 3300049572 Ga0501036_0318682 Ga0501036_0318682_401_1273 276
162 3300049573 Ga0501037_0023645 Ga0501037_0023645_2809_3681 276
163 3300049574 Ga0501038_0006734 Ga0501038_0006734_3110_3982 276
164 3300049575 Ga0501039_0227182 Ga0501039_0227182_71_964 276
165 3300049579 Ga0501043_0014175 Ga0501043_0014175_1277_2149 276
166 3300049579 Ga0501043_0033539 Ga0501043_0033539_3027_3905 276
167 3300049580 Ga0501046_0004567 Ga0501046_0004567_2172_3050 276
168 3300049581 Ga0501047_0008545 Ga0501047_0008545_8596_9474 276
169 3300049582 Ga0501048_0376728 Ga0501048_0376728_104_982 276
170 3300049585 Ga0501069_0024361 Ga0501069_0024361_464_1321 276
171 3300049586 Ga0501070_0065851 Ga0501070_0065851_1801_2679 276
172 3300049586 Ga0501070_0099916 Ga0501070_0099916_847_1719 276
173 3300049586 Ga0501070_0294998 Ga0501070_0294998_179_1036 276
174 3300049587 Ga0501071_0099636 Ga0501071_0099636_697_1554 276
175 3300049587 Ga0501071_0111681 Ga0501071_0111681_324_1217 276
176 3300049590 Ga0501074_0138280 Ga0501074_0138280_514_1386 276
177 3300049590 Ga0501074_0246486 Ga0501074_0246486_227_1105 276
178 3300049741 Ga0501079_0017673 Ga0501079_0017673_4307_5164 276
179 3300049742 Ga0501080_0005924 Ga0501080_0005924_9107_9985 276
180 3300049742 Ga0501080_0618729 Ga0501080_0618729_12_884 276
181 3300049744 Ga0501083_0209608 Ga0501083_0209608_236_1093 276
182 3300049822 Ga0501035_0249955 Ga0501035_0249955_448_1341 276
183 3300049823 Ga0501044_0095456 Ga0501044_0095456_1168_2040 276
184 3300049824 Ga0501045_0107281 Ga0501045_0107281_413_1306 276
185 3300054114 Ga0501084_0017201 Ga0501084_0017201_4406_5263 276
186 3300060353 Ga0501082_0318024 Ga0501082_0318024_248_1111 276
187 3300006173 Ga0070716_100307879 Ga0070716_1003078792 277
188 3300006846 Ga0075430_100142015 Ga0075430_1001420152 277
189 3300006847 Ga0075431_100192435 Ga0075431_1001924352 277
190 3300014968 Ga0157379_10305351 Ga0157379_103053512 277
191 3300025928 Ga0207700_10053272 Ga0207700_100532723 277
192 3300025939 Ga0207665_10209333 Ga0207665_102093332 277
193 3300048906 Ga0496103_0089583 Ga0496103_0089583_173_1051 277
194 3300048907 Ga0496104_0061808 Ga0496104_0061808_1242_2120 277
195 3300048908 Ga0496105_0069054 Ga0496105_0069054_1255_2133 277
196 3300048908 Ga0496105_0368003 Ga0496105_0368003_16_897 277
197 3300048910 Ga0496107_0127453 Ga0496107_0127453_16_894 277
198 3300048915 Ga0496112_0002983 Ga0496112_0002983_7668_8534 277
199 3300049572 Ga0501036_0014084 Ga0501036_0014084_5150_6046 277
200 3300049575 Ga0501039_0070704 Ga0501039_0070704_156_1052 277
201 3300049576 Ga0501040_0023549 Ga0501040_0023549_970_1866 277
202 3300049577 Ga0501041_0024411 Ga0501041_0024411_65_961 277
203 3300049578 Ga0501042_0019984 Ga0501042_0019984_474_1370 277
204 3300049580 Ga0501046_0008037 Ga0501046_0008037_5010_5906 277
205 3300049587 Ga0501071_0006036 Ga0501071_0006036_2736_3632 277
206 3300049592 Ga0501076_0209996 Ga0501076_0209996_404_1300 277
207 3300049593 Ga0501077_0004944 Ga0501077_0004944_4316_5212 277
208 3300049741 Ga0501079_0031085 Ga0501079_0031085_904_1800 277
209 3300049743 Ga0501081_0000899 Ga0501081_0000899_13831_14727 277
210 3300050509 nmdc:mga0qj67_207098_c1 nmdc:mga0qj67_207098_c1_427_1305 277
211 3300050510 nmdc:mga06r32_119872_c1 nmdc:mga06r32_119872_c1_1093_1971 277
212 3300054114 Ga0501084_0341650 Ga0501084_0341650_124_1020 277
213 3300060353 Ga0501082_0007500 Ga0501082_0007500_88_984 277
214 3300061734 Ga0530510_0158194 Ga0530510_0158194_650_1546 277
215 3300031995 Ga0307409_100134958 Ga0307409_1001349582 278
216 3300048907 Ga0496104_0309739 Ga0496104_0309739_466_1335 278
217 3300048912 Ga0496109_0049179 Ga0496109_0049179_558_1427 278
218 3300048913 Ga0496110_0198611 Ga0496110_0198611_343_1212 278
219 3300049583 Ga0501067_0016129 Ga0501067_0016129_1306_2175 278
220 3300049588 Ga0501072_0479470 Ga0501072_0479470_20_889 278
221 3300050491 nmdc:mga00v17_1735_c1 nmdc:mga00v17_1735_c1_7756_8676 278
222 3300054114 Ga0501084_0000104 Ga0501084_0000104_35909_36778 278
223 3300005843 Ga0068860_100014910 Ga0068860_1000149107 279
224 3300028381 Ga0268264_10010360 Ga0268264_100103607 279
225 3300028800 Ga0265338_10000584 Ga0265338_1000058428 279
226 3300031241 Ga0265325_10000425 Ga0265325_1000042521 279
227 3300031249 Ga0265339_10002369 Ga0265339_100023692 279
228 3300031344 Ga0265316_10064849 Ga0265316_100648492 279
229 3300031595 Ga0265313_10002333 Ga0265313_100023334 279
230 3300005364 Ga0070673_100059821 Ga0070673_1000598212 280
231 3300006846 Ga0075430_100016142 Ga0075430_1000161424 280
232 3300006880 Ga0075429_100122503 Ga0075429_1001225031 280
233 3300009147 Ga0114129_10038336 Ga0114129_100383363 280
234 3300046517 Ga0495630_0032477 Ga0495630_0032477_2905_3792 280
235 3300048913 Ga0496110_0152500 Ga0496110_0152500_185_1072 280
236 3300048915 Ga0496112_0073968 Ga0496112_0073968_1379_2257 280
237 3300050510 nmdc:mga06r32_57057_c1 nmdc:mga06r32_57057_c1_367_1251 280
238 3300053153 Ga0500616_0013368 Ga0500616_0013368_1444_2319 280
239 3300003320 rootH2_10019607 rootH2_100196074 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

69

209

0.8

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

72

317

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

74

324

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.8924 2 276
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.892 1 104
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.88 2 276
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8772 1 97
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8565 2 97
ID Description Score Start End Superfamily
af_O06575_15_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9573 2 277 3.40.50.1820
af_O06338_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9504 27 279 3.40.50.1820
af_O06338_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.929 27 279 3.40.50.1820
af_O06575_15_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9245 2 277 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9062 1 126 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2E4H5J3-F1-model_v4 Alpha/beta hydrolase 0.983 2 125 GO:0016787
AF-A0A1F3ZR12-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9793 2 279 GO:0003824
AF-A0A2Z4RU26-F1-model_v4 Alpha/beta hydrolase 0.9791 2 282 GO:0016787
AF-A0A661GRT8-F1-model_v4 Alpha/beta hydrolase 0.978 2 277 GO:0016787
AF-A0A2D9RND8-F1-model_v4 Alpha/beta hydrolase 0.9732 4 282 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.75 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map