F352124

General Info

Members Datasets Scaffolds Average Seq Length
239 116 478 564

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0031281|Ga0395900_0031281_2509_4512
Length 667
Sequence MAENGRARAACRLVNAGEIVAIVPPPPGSLGAGEADDGSKLAAQRRQPRPVQPSGRARSWFRVGGVGRRSVADCNHLEPRRHLLQTLASTVHGERKVNKFRWLTASALALATVPALAQNMGQFSTERLSQVDKVLSSDAFQGRGTASAIEPTVINYIAGQFKAAGVQPGGDIVNGKRSWFQNVPLLESQIVGTPQVSLNENGTVVPLQQGPDIAILAPLNGAKQVDLANAPLVFVGYGVDAPERGWNDFKGQNMHGKILVELINDPDFEASPGEPVAGKFGGKAMTYYGRWTYKYEEAARQGAAGVIIVHETAPASYPWAVVQNSNTNAQFDIVRDNPAAAHSEIESWIQRPLAVQLFQRSGLDFEQEKVAARSPNFQPVPLKATLSAHYAANPQVITSHNVVGLLPGRTHPDETVIYSAHWDHLGIGKPDATGDRIYNGAVDNGSGVSQLVEQARLFAHGPRPDRSIVFLAVTAEEKGLLGSAYYAAHPLYPAAKTVADLNVDAWLPAGPVKNFSMSGNAKLGLLDDLVAEGKREGLYFSPDPDPAAGHFYRSDHFSFAKIGVPAISVDEGRDLVNGGTARGDALAADYTAHHYHQPSDEWHSDWDWHGVAQIAYLVHQVGLQLANSREWPDWSADSEFRAARDRTAAERQGGTAPAVPPRKGERG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.42
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.09
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0031281 3300037418 Bacteria 5467
2 JGI24736J21556_1000552 3300001904 Bacteria 6943
3 JGI24741J21665_1005769 3300001915 Bacteria 2545
4 JGI24740J21852_10002043 3300001979 Bacteria 9231
5 JGI24740J21852_10004122 3300001979 Bacteria 6280
6 JGI24739J22299_10001216 3300001989 Bacteria 9652
7 JGI24738J21930_10005448 3300002075 Bacteria 3048
8 rootH2_10011295 3300003320 Bacteria 6368
9 Ga0070658_10000154 3300005327 Bacteria 60560
10 Ga0070658_10025330 3300005327 Bacteria 4757
11 Ga0070683_100001178 3300005329 Bacteria 19829
12 Ga0070683_100002352 3300005329 Bacteria 15007
13 Ga0070670_100002616 3300005331 Bacteria 14878
14 Ga0070670_100004587 3300005331 Bacteria 11596
15 Ga0070666_10000861 3300005335 Bacteria 18397
16 Ga0070666_10007771 3300005335 Bacteria 6623
17 Ga0070680_100003396 3300005336 Bacteria 11885
18 Ga0070680_100007505 3300005336 Bacteria 8317
19 Ga0070680_100022865 3300005336 Bacteria 4981
20 Ga0070682_100044392 3300005337 Bacteria 2752
21 Ga0070682_100067263 3300005337 Bacteria 2281
22 Ga0070660_100000284 3300005339 Bacteria 33712
23 Ga0070660_100091690 3300005339 Bacteria 2397
24 Ga0070661_100000195 3300005344 Bacteria 50203
25 Ga0070661_100017901 3300005344 Bacteria 5031
26 Ga0070669_100061160 3300005353 Bacteria 2767
27 Ga0070671_100030161 3300005355 Bacteria 4475
28 Ga0070673_100046173 3300005364 Bacteria 3382
29 Ga0070659_100001185 3300005366 Bacteria 19009
30 Ga0070667_100006230 3300005367 Bacteria 9926
31 Ga0070667_100009323 3300005367 Bacteria 8136
32 Ga0070713_100005382 3300005436 Bacteria 8743
33 Ga0070663_100006364 3300005455 Bacteria 7095
34 Ga0070663_100006885 3300005455 Bacteria 6881
35 Ga0070663_100032711 3300005455 Bacteria 3587
36 Ga0070662_100000049 3300005457 Bacteria 64630
37 Ga0070662_100003406 3300005457 Bacteria 9913
38 Ga0070662_100034238 3300005457 Bacteria 3581
39 Ga0070685_10000461 3300005466 Bacteria 23671
40 Ga0070684_100037825 3300005535 Bacteria 4142
41 Ga0070684_100047720 3300005535 Bacteria 3712
42 Ga0068853_100000098 3300005539 Bacteria 59230
43 Ga0068853_100066755 3300005539 Bacteria 3124
44 Ga0068853_100077635 3300005539 Bacteria 2901
45 Ga0070693_100000915 3300005547 Bacteria 13124
46 Ga0070665_100000051 3300005548 Bacteria 249317
47 Ga0070665_100001431 3300005548 Bacteria 27984
48 Ga0070665_100007827 3300005548 Bacteria 10840
49 Ga0070665_100015651 3300005548 Bacteria 7620
50 Ga0068855_100107317 3300005563 Bacteria 3208
51 Ga0070664_100000162 3300005564 Bacteria 46036
52 Ga0070664_100004692 3300005564 Bacteria 10962
53 Ga0068857_100020043 3300005577 Bacteria 5879
54 Ga0068857_100027835 3300005577 Bacteria 4984
55 Ga0068854_100003269 3300005578 Bacteria 10091
56 Ga0068854_100006393 3300005578 Bacteria 7494
57 Ga0068856_100000788 3300005614 Bacteria 34349
58 Ga0068856_100065800 3300005614 Bacteria 3582
59 Ga0068852_100004326 3300005616 Bacteria 10023
60 Ga0068852_100070388 3300005616 Bacteria 3069
61 Ga0068859_100079627 3300005617 Bacteria 3317
62 Ga0068864_100006671 3300005618 Bacteria 9450
63 Ga0068864_100006927 3300005618 Bacteria 9298
64 Ga0068851_10000626 3300005834 Bacteria 15011
65 Ga0068858_100019797 3300005842 Bacteria 6291
66 Ga0068858_100043384 3300005842 Bacteria 4170
67 Ga0068862_100002973 3300005844 Bacteria 14803
68 Ga0070717_10003063 3300006028 Bacteria 11920
69 Ga0097620_100079625 3300006931 Bacteria 3317
70 Ga0105240_10001066 3300009093 Bacteria 48453
71 Ga0105240_10011074 3300009093 Bacteria 12609
72 Ga0105240_10071445 3300009093 Bacteria 4292
73 Ga0105248_10000544 3300009177 Bacteria 43036
74 Ga0105248_10007594 3300009177 Bacteria 11910
75 Ga0105237_10041575 3300009545 Bacteria 4636
76 Ga0105238_10005470 3300009551 Bacteria 12559
77 Ga0105238_10009941 3300009551 Bacteria 9540
78 Ga0105238_10031323 3300009551 Bacteria 5413
79 Ga0105238_10056274 3300009551 Bacteria 3947
80 Ga0105238_10088089 3300009551 Bacteria 3091
81 Ga0105239_10269485 3300010375 Bacteria 1915
82 Ga0157373_10004808 3300013100 Bacteria 10162
83 Ga0157371_10002518 3300013102 Bacteria 17416
84 Ga0157371_10011021 3300013102 Bacteria 7003
85 Ga0157370_10001982 3300013104 Bacteria 25168
86 Ga0157370_10191944 3300013104 Bacteria 1896
87 Ga0157370_10203824 3300013104 Bacteria 1834
88 Ga0157369_10001843 3300013105 Bacteria 25619
89 Ga0157369_10074238 3300013105 Bacteria 3647
90 Ga0157372_10007229 3300013307 Bacteria 11822
91 Ga0157372_10177073 3300013307 Bacteria 2469
92 Ga0163163_10000258 3300014325 Bacteria 53627
93 Ga0206353_10756301 3300020082 Bacteria 2204
94 Ga0209233_1004747 3300025261 Bacteria 4585
95 Ga0207656_10001414 3300025321 Bacteria 7932
96 Ga0207680_10004358 3300025903 Bacteria 6706
97 Ga0207647_10000700 3300025904 Bacteria 26295
98 Ga0207647_10001961 3300025904 Bacteria 15715
99 Ga0207705_10000003 3300025909 Bacteria 709270
100 Ga0207705_10000285 3300025909 Bacteria 47658
101 Ga0207705_10029103 3300025909 Bacteria 3938
102 Ga0207705_10043587 3300025909 Bacteria 3224
103 Ga0207705_10064775 3300025909 Bacteria 2641
104 Ga0207654_10028652 3300025911 Bacteria 3038
105 Ga0207707_10019460 3300025912 Bacteria 5927
106 Ga0207695_10000007 3300025913 Bacteria 1092551
107 Ga0207695_10003916 3300025913 Bacteria 20603
108 Ga0207695_10014239 3300025913 Bacteria 9434
109 Ga0207695_10031816 3300025913 Bacteria 5781
110 Ga0207671_10023439 3300025914 Bacteria 4655
111 Ga0207660_10004794 3300025917 Bacteria 8799
112 Ga0207660_10010077 3300025917 Bacteria 6122
113 Ga0207660_10010874 3300025917 Bacteria 5917
114 Ga0207657_10001793 3300025919 Bacteria 23164
115 Ga0207657_10003186 3300025919 Bacteria 17549
116 Ga0207657_10005774 3300025919 Bacteria 12905
117 Ga0207657_10030668 3300025919 Bacteria 4878
118 Ga0207657_10038178 3300025919 Bacteria 4279
119 Ga0207649_10000128 3300025920 Bacteria 64425
120 Ga0207649_10000772 3300025920 Bacteria 20748
121 Ga0207649_10005940 3300025920 Bacteria 6618
122 Ga0207652_10042164 3300025921 Bacteria 3882
123 Ga0207652_10050644 3300025921 Bacteria 3558
124 Ga0207694_10007272 3300025924 Bacteria 8402
125 Ga0207694_10150043 3300025924 Bacteria 1877
126 Ga0207650_10004574 3300025925 Bacteria 9463
127 Ga0207690_10000045 3300025932 Bacteria 116965
128 Ga0207690_10005507 3300025932 Bacteria 7471
129 Ga0207690_10006187 3300025932 Bacteria 7088
130 Ga0207690_10022115 3300025932 Bacteria 3951
131 Ga0207690_10023262 3300025932 Bacteria 3866
132 Ga0207706_10001806 3300025933 Bacteria 21008
133 Ga0207706_10004507 3300025933 Bacteria 13081
134 Ga0207706_10006297 3300025933 Bacteria 11027
135 Ga0207711_10001709 3300025941 Bacteria 20197
136 Ga0207711_10009979 3300025941 Bacteria 7891
137 Ga0207661_10000187 3300025944 Bacteria 40098
138 Ga0207661_10036044 3300025944 Bacteria 3859
139 Ga0207679_10000823 3300025945 Bacteria 19975
140 Ga0207679_10014328 3300025945 Bacteria 5210
141 Ga0207667_10002911 3300025949 Bacteria 21255
142 Ga0207667_10006957 3300025949 Bacteria 13671
143 Ga0207667_10009104 3300025949 Bacteria 11736
144 Ga0207667_10020737 3300025949 Bacteria 7301
145 Ga0207712_10000197 3300025961 Bacteria 61066
146 Ga0207712_10056320 3300025961 Bacteria 2769
147 Ga0207640_10005300 3300025981 Bacteria 7025
148 Ga0207640_10005738 3300025981 Bacteria 6763
149 Ga0207658_10008229 3300025986 Bacteria 7105
150 Ga0207658_10020993 3300025986 Bacteria 4528
151 Ga0207703_10004129 3300026035 Bacteria 11982
152 Ga0207703_10030396 3300026035 Bacteria 4269
153 Ga0207639_10000446 3300026041 Bacteria 28443
154 Ga0207639_10033343 3300026041 Bacteria 3798
155 Ga0207678_10001892 3300026067 Bacteria 19098
156 Ga0207678_10005957 3300026067 Bacteria 10856
157 Ga0207678_10006499 3300026067 Bacteria 10375
158 Ga0207678_10053894 3300026067 Bacteria 3464
159 Ga0207702_10001605 3300026078 Bacteria 22360
160 Ga0207702_10004836 3300026078 Bacteria 11862
161 Ga0207702_10029074 3300026078 Bacteria 4597
162 Ga0207676_10012359 3300026095 Bacteria 6115
163 Ga0207674_10003312 3300026116 Bacteria 19806
164 Ga0207674_10007185 3300026116 Bacteria 13000
165 Ga0207674_10012225 3300026116 Bacteria 9602
166 Ga0207698_10000780 3300026142 Bacteria 18515
167 Ga0207698_10001792 3300026142 Bacteria 12531
168 Ga0207698_10004053 3300026142 Bacteria 8897
169 Ga0207698_10012203 3300026142 Bacteria 5612
170 Ga0207698_10018898 3300026142 Bacteria 4706
171 Ga0207698_10052411 3300026142 Bacteria 3126
172 Ga0268266_10000002 3300028379 Bacteria 3059047
173 Ga0268266_10000006 3300028379 Bacteria 1410021
174 Ga0268265_10143151 3300028380 Bacteria 2004
175 Ga0265327_10000280 3300031251 Bacteria 100757
176 Ga0307408_100136770 3300031548 Bacteria 1918
177 Ga0307410_10002704 3300031852 Bacteria 8656
178 Ga0307410_10019284 3300031852 Bacteria 4144
179 Ga0307411_10077800 3300032005 Bacteria 2272
180 Ga0395899_0022637 3300037312 Bacteria 4760
181 Ga0395899_0060198 3300037312 Bacteria 2797
182 Ga0395899_0117424 3300037312 Bacteria 1908
183 Ga0395900_0003200 3300037418 Bacteria 17732
184 Ga0395900_0003660 3300037418 Bacteria 16531
185 Ga0395900_0003797 3300037418 Bacteria 16176
186 Ga0395900_0005341 3300037418 Bacteria 13461
187 Ga0395900_0006793 3300037418 Bacteria 11873
188 Ga0395900_0030591 3300037418 Bacteria 5528
189 Ga0395900_0068721 3300037418 Bacteria 3641
190 Ga0395900_0098200 3300037418 Bacteria 3009
191 Ga0395898_0006157 3300037466 Bacteria 12848
192 Ga0395898_0007616 3300037466 Bacteria 11494
193 Ga0395898_0138460 3300037466 Bacteria 2330
194 Ga0395905_0006189 3300037471 Bacteria 12079
195 Ga0395905_0010769 3300037471 Bacteria 8862
196 Ga0395901_0000295 3300038443 Bacteria 61830
197 Ga0395901_0001874 3300038443 Bacteria 21681
198 Ga0395901_0044555 3300038443 Bacteria 4601
199 Ga0395901_0057299 3300038443 Bacteria 4053
200 Ga0395901_0078939 3300038443 Bacteria 3436
201 Ga0395901_0102947 3300038443 Bacteria 2996
202 Ga0395901_0121272 3300038443 Bacteria 2748
203 Ga0395901_0165445 3300038443 Bacteria 2322
204 Ga0451793_0319047 3300041452 Bacteria 8683
205 Ga0451807_1134556 3300041486 Bacteria 5624
206 Ga0466969_0005911 3300044656 Bacteria 6509
207 Ga0466966_0000010 3300044684 Bacteria 150868
208 Ga0466966_0043849 3300044684 Bacteria 2865
209 Ga0466961_0002980 3300044693 Bacteria 10518
210 Ga0466961_0022315 3300044693 Bacteria 4072
211 Ga0466961_0031826 3300044693 Bacteria 3390
212 Ga0466963_0002390 3300044694 Bacteria 10497
213 Ga0466963_0006016 3300044694 Bacteria 7148
214 Ga0466963_0014279 3300044694 Bacteria 4894
215 Ga0466963_0018232 3300044694 Bacteria 4384
216 Ga0466963_0025974 3300044694 Bacteria 3741
217 Ga0466964_0008025 3300044706 Bacteria 3956
218 Ga0466957_0001324 3300044842 Bacteria 12933
219 Ga0466957_0004683 3300044842 Bacteria 7651
220 Ga0466957_0026891 3300044842 Bacteria 3415
221 Ga0466959_0003693 3300045049 Bacteria 10097
222 Ga0466959_0047987 3300045049 Bacteria 3139
223 Ga0466959_0080100 3300045049 Bacteria 2354
224 Ga0466958_0002969 3300045836 Bacteria 8688
225 Ga0466958_0005393 3300045836 Bacteria 6874
226 Ga0466958_0036243 3300045836 Bacteria 2952
227 Ga0466967_0000381 3300045976 Bacteria 20628
228 Ga0466967_0021880 3300045976 Bacteria 5204
229 Ga0495663_0008230 3300046525 Bacteria 2886
230 Ga0495598_0004936 3300046537 Bacteria 2924
231 Ga0496107_0005474 3300048910 Bacteria 8686
232 Ga0496108_0016972 3300048911 Bacteria 5951
233 Ga0496112_0015587 3300048915 Bacteria 7099
234 Ga0496116_0061523 3300048919 Bacteria 2430
235 Ga0496125_0000334 3300048928 Bacteria 90058
236 Ga0501074_0053819 3300049590 Bacteria 2903
237 Ga0501235_007026 3300049669 Bacteria 2451
238 nmdc:mga0n895_52573_c1 3300050512 Bacteria 3999
239 2941487999 2941485952 Bacteria 3591484
240 Ga0395900_0031281
241 JGI24736J21556_1000552
242 JGI24741J21665_1005769
243 JGI24740J21852_10002043
244 JGI24740J21852_10004122
245 JGI24739J22299_10001216
246 JGI24738J21930_10005448
247 rootH2_10011295
248 Ga0070658_10000154
249 Ga0070658_10025330
250 Ga0070683_100001178
251 Ga0070683_100002352
252 Ga0070670_100002616
253 Ga0070670_100004587
254 Ga0070666_10000861
255 Ga0070666_10007771
256 Ga0070680_100003396
257 Ga0070680_100007505
258 Ga0070680_100022865
259 Ga0070682_100044392
260 Ga0070682_100067263
261 Ga0070660_100000284
262 Ga0070660_100091690
263 Ga0070661_100000195
264 Ga0070661_100017901
265 Ga0070669_100061160
266 Ga0070671_100030161
267 Ga0070673_100046173
268 Ga0070659_100001185
269 Ga0070667_100006230
270 Ga0070667_100009323
271 Ga0070713_100005382
272 Ga0070663_100006364
273 Ga0070663_100006885
274 Ga0070663_100032711
275 Ga0070662_100000049
276 Ga0070662_100003406
277 Ga0070662_100034238
278 Ga0070685_10000461
279 Ga0070684_100037825
280 Ga0070684_100047720
281 Ga0068853_100000098
282 Ga0068853_100066755
283 Ga0068853_100077635
284 Ga0070693_100000915
285 Ga0070665_100000051
286 Ga0070665_100001431
287 Ga0070665_100007827
288 Ga0070665_100015651
289 Ga0068855_100107317
290 Ga0070664_100000162
291 Ga0070664_100004692
292 Ga0068857_100020043
293 Ga0068857_100027835
294 Ga0068854_100003269
295 Ga0068854_100006393
296 Ga0068856_100000788
297 Ga0068856_100065800
298 Ga0068852_100004326
299 Ga0068852_100070388
300 Ga0068859_100079627
301 Ga0068864_100006671
302 Ga0068864_100006927
303 Ga0068851_10000626
304 Ga0068858_100019797
305 Ga0068858_100043384
306 Ga0068862_100002973
307 Ga0070717_10003063
308 Ga0097620_100079625
309 Ga0105240_10001066
310 Ga0105240_10011074
311 Ga0105240_10071445
312 Ga0105248_10000544
313 Ga0105248_10007594
314 Ga0105237_10041575
315 Ga0105238_10005470
316 Ga0105238_10009941
317 Ga0105238_10031323
318 Ga0105238_10056274
319 Ga0105238_10088089
320 Ga0105239_10269485
321 Ga0157373_10004808
322 Ga0157371_10002518
323 Ga0157371_10011021
324 Ga0157370_10001982
325 Ga0157370_10191944
326 Ga0157370_10203824
327 Ga0157369_10001843
328 Ga0157369_10074238
329 Ga0157372_10007229
330 Ga0157372_10177073
331 Ga0163163_10000258
332 Ga0206353_10756301
333 Ga0209233_1004747
334 Ga0207656_10001414
335 Ga0207680_10004358
336 Ga0207647_10000700
337 Ga0207647_10001961
338 Ga0207705_10000003
339 Ga0207705_10000285
340 Ga0207705_10029103
341 Ga0207705_10043587
342 Ga0207705_10064775
343 Ga0207654_10028652
344 Ga0207707_10019460
345 Ga0207695_10000007
346 Ga0207695_10003916
347 Ga0207695_10014239
348 Ga0207695_10031816
349 Ga0207671_10023439
350 Ga0207660_10004794
351 Ga0207660_10010077
352 Ga0207660_10010874
353 Ga0207657_10001793
354 Ga0207657_10003186
355 Ga0207657_10005774
356 Ga0207657_10030668
357 Ga0207657_10038178
358 Ga0207649_10000128
359 Ga0207649_10000772
360 Ga0207649_10005940
361 Ga0207652_10042164
362 Ga0207652_10050644
363 Ga0207694_10007272
364 Ga0207694_10150043
365 Ga0207650_10004574
366 Ga0207690_10000045
367 Ga0207690_10005507
368 Ga0207690_10006187
369 Ga0207690_10022115
370 Ga0207690_10023262
371 Ga0207706_10001806
372 Ga0207706_10004507
373 Ga0207706_10006297
374 Ga0207711_10001709
375 Ga0207711_10009979
376 Ga0207661_10000187
377 Ga0207661_10036044
378 Ga0207679_10000823
379 Ga0207679_10014328
380 Ga0207667_10002911
381 Ga0207667_10006957
382 Ga0207667_10009104
383 Ga0207667_10020737
384 Ga0207712_10000197
385 Ga0207712_10056320
386 Ga0207640_10005300
387 Ga0207640_10005738
388 Ga0207658_10008229
389 Ga0207658_10020993
390 Ga0207703_10004129
391 Ga0207703_10030396
392 Ga0207639_10000446
393 Ga0207639_10033343
394 Ga0207678_10001892
395 Ga0207678_10005957
396 Ga0207678_10006499
397 Ga0207678_10053894
398 Ga0207702_10001605
399 Ga0207702_10004836
400 Ga0207702_10029074
401 Ga0207676_10012359
402 Ga0207674_10003312
403 Ga0207674_10007185
404 Ga0207674_10012225
405 Ga0207698_10000780
406 Ga0207698_10001792
407 Ga0207698_10004053
408 Ga0207698_10012203
409 Ga0207698_10018898
410 Ga0207698_10052411
411 Ga0268266_10000002
412 Ga0268266_10000006
413 Ga0268265_10143151
414 Ga0265327_10000280
415 Ga0307408_100136770
416 Ga0307410_10002704
417 Ga0307410_10019284
418 Ga0307411_10077800
419 Ga0395899_0022637
420 Ga0395899_0060198
421 Ga0395899_0117424
422 Ga0395900_0003200
423 Ga0395900_0003660
424 Ga0395900_0003797
425 Ga0395900_0005341
426 Ga0395900_0006793
427 Ga0395900_0030591
428 Ga0395900_0068721
429 Ga0395900_0098200
430 Ga0395898_0006157
431 Ga0395898_0007616
432 Ga0395898_0138460
433 Ga0395905_0006189
434 Ga0395905_0010769
435 Ga0395901_0000295
436 Ga0395901_0001874
437 Ga0395901_0044555
438 Ga0395901_0057299
439 Ga0395901_0078939
440 Ga0395901_0102947
441 Ga0395901_0121272
442 Ga0395901_0165445
443 Ga0451793_0319047
444 Ga0451807_1134556
445 Ga0466969_0005911
446 Ga0466966_0000010
447 Ga0466966_0043849
448 Ga0466961_0002980
449 Ga0466961_0022315
450 Ga0466961_0031826
451 Ga0466963_0002390
452 Ga0466963_0006016
453 Ga0466963_0014279
454 Ga0466963_0018232
455 Ga0466963_0025974
456 Ga0466964_0008025
457 Ga0466957_0001324
458 Ga0466957_0004683
459 Ga0466957_0026891
460 Ga0466959_0003693
461 Ga0466959_0047987
462 Ga0466959_0080100
463 Ga0466958_0002969
464 Ga0466958_0005393
465 Ga0466958_0036243
466 Ga0466967_0000381
467 Ga0466967_0021880
468 Ga0495663_0008230
469 Ga0495598_0004936
470 Ga0496107_0005474
471 Ga0496108_0016972
472 Ga0496112_0015587
473 Ga0496116_0061523
474 Ga0496125_0000334
475 Ga0501074_0053819
476 Ga0501235_007026
477 nmdc:mga0n895_52573_c1
478 2941487999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

401

622

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ica-assembly3.cif.gz_C the crystal structure of legionella pneumophila lapa aminopeptidase 0.7928 303 534
6ica-assembly2.cif.gz_B the crystal structure of legionella pneumophila lapa aminopeptidase 0.7902 303 534
6esl-assembly1.cif.gz_A crystal structure of the legionella pneumoppila lapa 0.7856 303 532
6ica-assembly1.cif.gz_A the crystal structure of legionella pneumophila lapa aminopeptidase 0.7844 303 532
6esl-assembly1.cif.gz_B crystal structure of the legionella pneumoppila lapa 0.7797 303 532
ID Description Score Start End Superfamily
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7762 19 535 3.40.630.10
af_P37302_266_505_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7702 299 534 3.40.630.10
1xjoA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.751 301 531 3.40.630.10
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.746 19 535 3.40.630.10
af_Q5AA00_122_414_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7348 303 532 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A525J9E3-F1-model_v4 M28 family peptidase 0.9695 303 558 GO:0006508
GO:0008235
AF-A0A259JBB5-F1-model_v4 deleted 0.9692 322 556
AF-A0A4Q3SHX5-F1-model_v4 M28 family peptidase 0.9663 211 556 GO:0006508
GO:0008235
AF-L8FUV1-F1-model_v4 PA domain-containing protein 0.9635 150 284
AF-A0A7X5SBD9-F1-model_v4 Peptidase M20 0.9624 111 312

Map