F352256

General Info

Members Datasets Scaffolds Average Seq Length
239 144 478 389

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0018210|Ga0495686_0018210_500_1723
Length 397
Sequence MNDFQPTLRCVSKLNAHAETVEHRFGDYGGQYVPETLMPALQELEEAWVSARDDADFHSELHTLLCDYAGRPTSLYLAERLSDHIGYPVYLKREDLLHTGAHKINNALGQALIAKRIGKRRIIAETGAGQHGVATATACARLDLECEIFMGEEDMRRQAPNVARMGLLGAKVIPVTAGSKTLKEAVSAAIRNWVETVADTHYILGSAVGPAPFPAMVRDLQRVIGDEARGQICQMSGRLPARVIACVGAGSNAIGTFKAFEDDSSELIGVEAGGHGLSSXXXXATLTRSSVLQDEDGQILEAHSISAGLDYPGVGPEHSYLRDIGRVKYYSATDAEALEALQLVCKLEGIIPALESSHAIAWMLDNPGGDMDLVTLSGRGDKDLDEILRLTGRNDTV

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 11.3
Rhizosphere 74.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0018210 3300047472 Bacteria 4718
2 JGI25406J46586_10002762 3300003203 Bacteria 8250
3 Ga0070683_100025028 3300005329 Bacteria 5354
4 Ga0070683_100052857 3300005329 Bacteria 3764
5 Ga0070683_100089920 3300005329 Bacteria 2882
6 Ga0070683_100224410 3300005329 Bacteria 1786
7 Ga0070683_100306571 3300005329 Bacteria 1511
8 Ga0070680_100001012 3300005336 Bacteria 20047
9 Ga0070682_100009080 3300005337 Bacteria 5621
10 Ga0070682_100175419 3300005337 Bacteria 1493
11 Ga0070692_10059521 3300005345 Bacteria 2008
12 Ga0070659_100025119 3300005366 Bacteria 4573
13 Ga0070714_100010420 3300005435 Bacteria 7347
14 Ga0070713_100144699 3300005436 Bacteria 2109
15 Ga0070713_100275679 3300005436 Bacteria 1541
16 Ga0070710_10008052 3300005437 Bacteria 5122
17 Ga0070701_10030746 3300005438 Bacteria 2659
18 Ga0070711_100071698 3300005439 Bacteria 2442
19 Ga0070681_10005635 3300005458 Bacteria 12099
20 Ga0070679_100000204 3300005530 Bacteria 48597
21 Ga0070684_100022008 3300005535 Bacteria 5312
22 Ga0070684_100237216 3300005535 Bacteria 1666
23 Ga0070684_100307429 3300005535 Bacteria 1455
24 Ga0068854_100006276 3300005578 Bacteria 7556
25 Ga0068854_100044694 3300005578 Bacteria 3146
26 Ga0068856_100018427 3300005614 Bacteria 6767
27 Ga0068856_100053570 3300005614 Bacteria 3978
28 Ga0070702_100002774 3300005615 Bacteria 7679
29 Ga0068852_100009176 3300005616 Bacteria 7328
30 Ga0068851_10000126 3300005834 Bacteria 41437
31 Ga0068851_10125853 3300005834 Bacteria 1382
32 Ga0068863_100026859 3300005841 Bacteria 5491
33 Ga0081455_10005423 3300005937 Bacteria 13991
34 Ga0081538_10001795 3300005981 Bacteria 21667
35 Ga0081538_10007931 3300005981 Bacteria 9088
36 Ga0081538_10022624 3300005981 Bacteria 4549
37 Ga0081540_1047655 3300005983 Bacteria 2153
38 Ga0081539_10004464 3300005985 Bacteria 15425
39 Ga0070717_10015040 3300006028 Bacteria 5964
40 Ga0070717_10031766 3300006028 Bacteria 4251
41 Ga0075365_10000342 3300006038 Bacteria 16642
42 Ga0075365_10002261 3300006038 Bacteria 9336
43 Ga0075365_10013269 3300006038 Bacteria 4918
44 Ga0075365_10195035 3300006038 Bacteria 1418
45 Ga0075428_100076709 3300006844 Bacteria 3649
46 Ga0075431_100002725 3300006847 Bacteria 17141
47 Ga0111539_10017607 3300009094 Bacteria 8843
48 Ga0105245_10000201 3300009098 Bacteria 57152
49 Ga0105245_10007008 3300009098 Bacteria 9888
50 Ga0105245_10007551 3300009098 Bacteria 9527
51 Ga0105245_10019375 3300009098 Bacteria 5959
52 Ga0114129_10105969 3300009147 Bacteria 3884
53 Ga0114129_10176676 3300009147 Bacteria 2908
54 Ga0114129_10254745 3300009147 Bacteria 2355
55 Ga0105243_10100003 3300009148 Bacteria 2405
56 Ga0105242_10095993 3300009176 Bacteria 2503
57 Ga0105238_10019985 3300009551 Bacteria 6817
58 Ga0105249_10000050 3300009553 Bacteria 169617
59 Ga0157370_10036948 3300013104 Bacteria 4737
60 Ga0157377_10046153 3300014745 Bacteria 2435
61 Ga0206353_11601920 3300020082 Bacteria 8750
62 Ga0213874_10000224 3300021377 Bacteria 10546
63 Ga0213876_10010890 3300021384 Bacteria 4872
64 Ga0213876_10018563 3300021384 Bacteria 3673
65 Ga0213876_10048941 3300021384 Bacteria 2232
66 Ga0213875_10018301 3300021388 Bacteria 3378
67 Ga0213875_10051260 3300021388 Bacteria 1933
68 Ga0207426_1024187 3300025302 Bacteria 2064
69 Ga0207656_10003059 3300025321 Bacteria 5716
70 Ga0207682_10000018 3300025893 Bacteria 66215
71 Ga0207707_10010279 3300025912 Bacteria 8122
72 Ga0207693_10000942 3300025915 Bacteria 26110
73 Ga0207663_10162710 3300025916 Bacteria 1577
74 Ga0207657_10236960 3300025919 Bacteria 1458
75 Ga0207652_10015879 3300025921 Bacteria 6135
76 Ga0207687_10000020 3300025927 Bacteria 228407
77 Ga0207687_10000851 3300025927 Bacteria 20636
78 Ga0207700_10128942 3300025928 Bacteria 2062
79 Ga0207664_10015670 3300025929 Bacteria 5510
80 Ga0207664_10026775 3300025929 Bacteria 4362
81 Ga0207686_10054552 3300025934 Bacteria 2504
82 Ga0207704_10129705 3300025938 Bacteria 1743
83 Ga0207665_10040968 3300025939 Bacteria 3092
84 Ga0207661_10000787 3300025944 Bacteria 20667
85 Ga0207712_10000019 3300025961 Bacteria 317060
86 Ga0207640_10006888 3300025981 Bacteria 6250
87 Ga0207639_10022175 3300026041 Bacteria 4571
88 Ga0207678_10246818 3300026067 Bacteria 1529
89 Ga0207708_10027974 3300026075 Bacteria 4269
90 Ga0207702_10010875 3300026078 Bacteria 7590
91 Ga0207702_10242676 3300026078 Bacteria 1689
92 Ga0207641_10013041 3300026088 Bacteria 6817
93 Ga0207648_10218877 3300026089 Bacteria 1692
94 Ga0207428_10022667 3300027907 Bacteria 5296
95 Ga0207428_10041685 3300027907 Bacteria 3715
96 Ga0268266_10026375 3300028379 Bacteria 4943
97 Ga0265319_1000014 3300028563 Bacteria 177623
98 Ga0265318_10003151 3300028577 Bacteria 8437
99 Ga0265322_10029703 3300028654 Bacteria 1562
100 Ga0265338_10000185 3300028800 Bacteria 116333
101 Ga0265338_10032091 3300028800 Bacteria 5133
102 Ga0265320_10025488 3300031240 Bacteria 3107
103 Ga0265316_10106908 3300031344 Bacteria 2122
104 Ga0307406_10155580 3300031901 Bacteria 1637
105 Ga0307409_100130266 3300031995 Bacteria 2148
106 Ga0307415_100125937 3300032126 Bacteria 1931
107 Ga0373923_0051274 3300035111 Bacteria 1731
108 Ga0373941_0023479 3300035115 Bacteria 1761
109 Ga0395898_0002434 3300037466 Bacteria 21997
110 Ga0395898_0003507 3300037466 Bacteria 17499
111 Ga0395898_0182815 3300037466 Bacteria 2004
112 Ga0395905_0115596 3300037471 Bacteria 2521
113 Ga0436364_0023304 3300037853 Bacteria 14882
114 Ga0436364_0306250 3300037853 Bacteria 3006
115 Ga0436364_0453611 3300037853 Bacteria 18573
116 Ga0436364_1186703 3300037853 Bacteria 9290
117 Ga0436364_1279568 3300037853 Bacteria 8397
118 Ga0395901_0013568 3300038443 Bacteria 8287
119 Ga0395901_0186907 3300038443 Bacteria 2173
120 Ga0436365_0603548 3300039437 Bacteria 6269
121 Ga0436365_0669928 3300039437 Bacteria 11910
122 Ga0436365_0921224 3300039437 Bacteria 16349
123 Ga0436365_1019895 3300039437 Bacteria 2500
124 Ga0436365_1063845 3300039437 Bacteria 2051
125 Ga0436365_1128146 3300039437 Bacteria 12263
126 Ga0436365_1734079 3300039437 Bacteria 9502
127 Ga0436365_1748676 3300039437 Bacteria 11932
128 Ga0436363_0023518 3300039450 Bacteria 29320
129 Ga0436363_0868947 3300039450 Bacteria 10771
130 Ga0436363_1395526 3300039450 Bacteria 1268
131 Ga0436363_1448547 3300039450 Bacteria 6106
132 Ga0436362_0859919 3300039453 Bacteria 5102
133 Ga0436362_0996344 3300039453 Bacteria 1488
134 Ga0466966_0026689 3300044684 Bacteria 3770
135 Ga0466966_0027990 3300044684 Bacteria 3673
136 Ga0466961_0137046 3300044693 Bacteria 1533
137 Ga0466963_0000127 3300044694 Bacteria 28865
138 Ga0466963_0006735 3300044694 Bacteria 6827
139 Ga0466963_0017407 3300044694 Bacteria 4480
140 Ga0466963_0021929 3300044694 Bacteria 4038
141 Ga0466963_0023442 3300044694 Bacteria 3921
142 Ga0466963_0036052 3300044694 Bacteria 3224
143 Ga0466963_0060160 3300044694 Bacteria 2536
144 Ga0466968_0054149 3300044735 Bacteria 1720
145 Ga0466959_0095182 3300045049 Bacteria 2136
146 Ga0466967_0012960 3300045976 Bacteria 6413
147 Ga0466967_0015203 3300045976 Bacteria 6027
148 Ga0466967_0018386 3300045976 Bacteria 5582
149 Ga0466967_0020376 3300045976 Bacteria 5358
150 Ga0466967_0028985 3300045976 Bacteria 4628
151 Ga0466967_0044749 3300045976 Bacteria 3842
152 Ga0466967_0230896 3300045976 Bacteria 1762
153 Ga0466967_0368483 3300045976 Bacteria 1393
154 Ga0466967_0428506 3300045976 Bacteria 1290
155 Ga0495629_0268561 3300046459 Bacteria 1172
156 Ga0495641_0000278 3300046461 Bacteria 40927
157 Ga0495641_0041089 3300046461 Bacteria 2149
158 Ga0495594_0087964 3300046499 Bacteria 1739
159 Ga0495644_0014057 3300046523 Bacteria 3068
160 Ga0495652_0046971 3300046529 Bacteria 3705
161 Ga0495640_0016698 3300046533 Bacteria 5490
162 Ga0495667_0017989 3300046559 Bacteria 4774
163 Ga0495656_0018237 3300046615 Bacteria 2691
164 Ga0495646_0038533 3300046680 Bacteria 2951
165 Ga0495658_0007538 3300046683 Bacteria 5392
166 Ga0495674_0037928 3300047319 Bacteria 4329
167 Ga0495676_0037720 3300047321 Bacteria 4019
168 Ga0495684_0050501 3300047471 Bacteria 3175
169 Ga0495686_0000008 3300047472 Bacteria 727479
170 Ga0495686_0012972 3300047472 Bacteria 5807
171 Ga0495686_0171741 3300047472 Bacteria 1260
172 Ga0496100_0005942 3300048903 Bacteria 6618
173 Ga0496102_0014116 3300048905 Bacteria 6939
174 Ga0496102_0077035 3300048905 Bacteria 3069
175 Ga0496104_0000024 3300048907 Bacteria 229913
176 Ga0496104_0077933 3300048907 Bacteria 3158
177 Ga0496104_0193001 3300048907 Bacteria 1948
178 Ga0496105_0000013 3300048908 Bacteria 229894
179 Ga0496105_0112561 3300048908 Bacteria 2246
180 Ga0496106_0095338 3300048909 Bacteria 2301
181 Ga0496108_0000006 3300048911 Bacteria 469473
182 Ga0496108_0000232 3300048911 Bacteria 49846
183 Ga0496108_0005533 3300048911 Bacteria 10220
184 Ga0496108_0183612 3300048911 Bacteria 1812
185 Ga0496109_0000004 3300048912 Bacteria 404818
186 Ga0496109_0000044 3300048912 Bacteria 133779
187 Ga0496109_0006643 3300048912 Bacteria 9741
188 Ga0496109_0032585 3300048912 Bacteria 4684
189 Ga0496109_0159965 3300048912 Bacteria 2110
190 Ga0496109_0465282 3300048912 Bacteria 1194
191 Ga0496111_0104574 3300048914 Bacteria 2083
192 Ga0496112_0038279 3300048915 Bacteria 4683
193 Ga0496112_0060919 3300048915 Bacteria 3719
194 Ga0496112_0090552 3300048915 Bacteria 3028
195 Ga0496113_0047073 3300048916 Bacteria 3204
196 Ga0496114_0049233 3300048917 Bacteria 3506
197 Ga0496114_0060273 3300048917 Bacteria 3171
198 Ga0496115_0004900 3300048918 Bacteria 9715
199 Ga0496117_0002686 3300048920 Bacteria 21983
200 Ga0496118_0002280 3300048921 Bacteria 26182
201 Ga0501031_0013391 3300049568 Bacteria 5351
202 Ga0501031_0079188 3300049568 Bacteria 2141
203 Ga0501033_0274653 3300049570 Bacteria 1191
204 Ga0501040_0010569 3300049576 Bacteria 6036
205 Ga0501041_0008670 3300049577 Bacteria 5989
206 Ga0501042_0027613 3300049578 Bacteria 3992
207 Ga0501042_0072322 3300049578 Bacteria 2467
208 Ga0501047_0077842 3300049581 Bacteria 3189
209 Ga0501048_0008471 3300049582 Bacteria 7776
210 Ga0501068_0052018 3300049584 Bacteria 2479
211 Ga0501072_0021679 3300049588 Bacteria 4983
212 Ga0501072_0027652 3300049588 Bacteria 4424
213 Ga0501075_0055327 3300049591 Bacteria 2986
214 Ga0501079_0022517 3300049741 Bacteria 4832
215 Ga0501081_0013111 3300049743 Bacteria 5450
216 Ga0501035_0272947 3300049822 Bacteria 1431
217 Ga0501045_0028573 3300049824 Bacteria 4024
218 Ga0501045_0037277 3300049824 Bacteria 3533
219 Ga0501045_0058162 3300049824 Bacteria 2830
220 nmdc:mga0yw44_128364_c1 3300050492 Bacteria 1639
221 nmdc:mga0yw44_13827_c1 3300050492 Bacteria 4264
222 nmdc:mga0yw44_226009_c1 3300050492 Bacteria 1241
223 nmdc:mga0yw44_38747_c1 3300050492 Bacteria 2822
224 nmdc:mga05p37_123584_c1 3300050507 Bacteria 3179
225 nmdc:mga05p37_207250_c1 3300050507 Bacteria 2371
226 nmdc:mga09592_349013_c1 3300050508 Bacteria 1281
227 nmdc:mga06r32_18223_c1 3300050510 Bacteria 6425
228 nmdc:mga08y16_80128_c1 3300050511 Bacteria 3404
229 nmdc:mga08y16_8138_c1 3300050511 Bacteria 10969
230 nmdc:mga0n895_11741_c1 3300050512 Bacteria 7829
231 nmdc:mga0n895_2669_c1 3300050512 Bacteria 14078
232 nmdc:mga0a205_110094_c1 3300050515 Bacteria 2653
233 Ga0495619_0000010 3300053085 Bacteria 302390
234 Ga0495619_0000146 3300053085 Bacteria 52136
235 Ga0501084_0078270 3300054114 Bacteria 2771
236 Ga0501082_0070661 3300060353 Bacteria 3006
237 Ga0466962_0005750 3300061719 Bacteria 5958
238 Ga0466962_0024131 3300061719 Bacteria 2922
239 Ga0530510_0244278 3300061734 Bacteria 1337
240 Ga0495686_0018210
241 JGI25406J46586_10002762
242 Ga0070683_100025028
243 Ga0070683_100052857
244 Ga0070683_100089920
245 Ga0070683_100224410
246 Ga0070683_100306571
247 Ga0070680_100001012
248 Ga0070682_100009080
249 Ga0070682_100175419
250 Ga0070692_10059521
251 Ga0070659_100025119
252 Ga0070714_100010420
253 Ga0070713_100144699
254 Ga0070713_100275679
255 Ga0070710_10008052
256 Ga0070701_10030746
257 Ga0070711_100071698
258 Ga0070681_10005635
259 Ga0070679_100000204
260 Ga0070684_100022008
261 Ga0070684_100237216
262 Ga0070684_100307429
263 Ga0068854_100006276
264 Ga0068854_100044694
265 Ga0068856_100018427
266 Ga0068856_100053570
267 Ga0070702_100002774
268 Ga0068852_100009176
269 Ga0068851_10000126
270 Ga0068851_10125853
271 Ga0068863_100026859
272 Ga0081455_10005423
273 Ga0081538_10001795
274 Ga0081538_10007931
275 Ga0081538_10022624
276 Ga0081540_1047655
277 Ga0081539_10004464
278 Ga0070717_10015040
279 Ga0070717_10031766
280 Ga0075365_10000342
281 Ga0075365_10002261
282 Ga0075365_10013269
283 Ga0075365_10195035
284 Ga0075428_100076709
285 Ga0075431_100002725
286 Ga0111539_10017607
287 Ga0105245_10000201
288 Ga0105245_10007008
289 Ga0105245_10007551
290 Ga0105245_10019375
291 Ga0114129_10105969
292 Ga0114129_10176676
293 Ga0114129_10254745
294 Ga0105243_10100003
295 Ga0105242_10095993
296 Ga0105238_10019985
297 Ga0105249_10000050
298 Ga0157370_10036948
299 Ga0157377_10046153
300 Ga0206353_11601920
301 Ga0213874_10000224
302 Ga0213876_10010890
303 Ga0213876_10018563
304 Ga0213876_10048941
305 Ga0213875_10018301
306 Ga0213875_10051260
307 Ga0207426_1024187
308 Ga0207656_10003059
309 Ga0207682_10000018
310 Ga0207707_10010279
311 Ga0207693_10000942
312 Ga0207663_10162710
313 Ga0207657_10236960
314 Ga0207652_10015879
315 Ga0207687_10000020
316 Ga0207687_10000851
317 Ga0207700_10128942
318 Ga0207664_10015670
319 Ga0207664_10026775
320 Ga0207686_10054552
321 Ga0207704_10129705
322 Ga0207665_10040968
323 Ga0207661_10000787
324 Ga0207712_10000019
325 Ga0207640_10006888
326 Ga0207639_10022175
327 Ga0207678_10246818
328 Ga0207708_10027974
329 Ga0207702_10010875
330 Ga0207702_10242676
331 Ga0207641_10013041
332 Ga0207648_10218877
333 Ga0207428_10022667
334 Ga0207428_10041685
335 Ga0268266_10026375
336 Ga0265319_1000014
337 Ga0265318_10003151
338 Ga0265322_10029703
339 Ga0265338_10000185
340 Ga0265338_10032091
341 Ga0265320_10025488
342 Ga0265316_10106908
343 Ga0307406_10155580
344 Ga0307409_100130266
345 Ga0307415_100125937
346 Ga0373923_0051274
347 Ga0373941_0023479
348 Ga0395898_0002434
349 Ga0395898_0003507
350 Ga0395898_0182815
351 Ga0395905_0115596
352 Ga0436364_0023304
353 Ga0436364_0306250
354 Ga0436364_0453611
355 Ga0436364_1186703
356 Ga0436364_1279568
357 Ga0395901_0013568
358 Ga0395901_0186907
359 Ga0436365_0603548
360 Ga0436365_0669928
361 Ga0436365_0921224
362 Ga0436365_1019895
363 Ga0436365_1063845
364 Ga0436365_1128146
365 Ga0436365_1734079
366 Ga0436365_1748676
367 Ga0436363_0023518
368 Ga0436363_0868947
369 Ga0436363_1395526
370 Ga0436363_1448547
371 Ga0436362_0859919
372 Ga0436362_0996344
373 Ga0466966_0026689
374 Ga0466966_0027990
375 Ga0466961_0137046
376 Ga0466963_0000127
377 Ga0466963_0006735
378 Ga0466963_0017407
379 Ga0466963_0021929
380 Ga0466963_0023442
381 Ga0466963_0036052
382 Ga0466963_0060160
383 Ga0466968_0054149
384 Ga0466959_0095182
385 Ga0466967_0012960
386 Ga0466967_0015203
387 Ga0466967_0018386
388 Ga0466967_0020376
389 Ga0466967_0028985
390 Ga0466967_0044749
391 Ga0466967_0230896
392 Ga0466967_0368483
393 Ga0466967_0428506
394 Ga0495629_0268561
395 Ga0495641_0000278
396 Ga0495641_0041089
397 Ga0495594_0087964
398 Ga0495644_0014057
399 Ga0495652_0046971
400 Ga0495640_0016698
401 Ga0495667_0017989
402 Ga0495656_0018237
403 Ga0495646_0038533
404 Ga0495658_0007538
405 Ga0495674_0037928
406 Ga0495676_0037720
407 Ga0495684_0050501
408 Ga0495686_0000008
409 Ga0495686_0012972
410 Ga0495686_0171741
411 Ga0496100_0005942
412 Ga0496102_0014116
413 Ga0496102_0077035
414 Ga0496104_0000024
415 Ga0496104_0077933
416 Ga0496104_0193001
417 Ga0496105_0000013
418 Ga0496105_0112561
419 Ga0496106_0095338
420 Ga0496108_0000006
421 Ga0496108_0000232
422 Ga0496108_0005533
423 Ga0496108_0183612
424 Ga0496109_0000004
425 Ga0496109_0000044
426 Ga0496109_0006643
427 Ga0496109_0032585
428 Ga0496109_0159965
429 Ga0496109_0465282
430 Ga0496111_0104574
431 Ga0496112_0038279
432 Ga0496112_0060919
433 Ga0496112_0090552
434 Ga0496113_0047073
435 Ga0496114_0049233
436 Ga0496114_0060273
437 Ga0496115_0004900
438 Ga0496117_0002686
439 Ga0496118_0002280
440 Ga0501031_0013391
441 Ga0501031_0079188
442 Ga0501033_0274653
443 Ga0501040_0010569
444 Ga0501041_0008670
445 Ga0501042_0027613
446 Ga0501042_0072322
447 Ga0501047_0077842
448 Ga0501048_0008471
449 Ga0501068_0052018
450 Ga0501072_0021679
451 Ga0501072_0027652
452 Ga0501075_0055327
453 Ga0501079_0022517
454 Ga0501081_0013111
455 Ga0501035_0272947
456 Ga0501045_0028573
457 Ga0501045_0037277
458 Ga0501045_0058162
459 nmdc:mga0yw44_128364_c1
460 nmdc:mga0yw44_13827_c1
461 nmdc:mga0yw44_226009_c1
462 nmdc:mga0yw44_38747_c1
463 nmdc:mga05p37_123584_c1
464 nmdc:mga05p37_207250_c1
465 nmdc:mga09592_349013_c1
466 nmdc:mga06r32_18223_c1
467 nmdc:mga08y16_80128_c1
468 nmdc:mga08y16_8138_c1
469 nmdc:mga0n895_11741_c1
470 nmdc:mga0n895_2669_c1
471 nmdc:mga0a205_110094_c1
472 Ga0495619_0000010
473 Ga0495619_0000146
474 Ga0501084_0078270
475 Ga0501082_0070661
476 Ga0466962_0005750
477 Ga0466962_0024131
478 Ga0530510_0244278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

67

372

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cut-assembly1.cif.gz_A engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)-isopropylserine bound as the external aldimine 0.9536 7 385
7rnp-assembly2.cif.gz_B engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound 0.9526 8 384
6amh-assembly2.cif.gz_D engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb4d11 with ser bound as e(aex1) 0.9522 7 385
5ey5-assembly1.cif.gz_D lbcats 0.9504 7 382
6am9-assembly2.cif.gz_D engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser-bound in a predominantly closed state. 0.9504 7 385
ID Description Score Start End Superfamily
af_P14671_91_282_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9777 18 200 3.40.50.1100
2rhgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.976 8 201 3.40.50.1100
af_P43283_44_197_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.966 52 195 3.60.21.10
2rhgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.962 8 201 3.40.50.1100
af_Q60179_69_392_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9423 56 377 3.40.50.1100
ID Description Score Start End GO Terms
AF-G5SXB3-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 1.009 106 170 GO:0004834
GO:0005737
AF-A0A317YN28-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9953 99 202 GO:0004834
GO:0005737
AF-A0A2X3CN98-F1-model_v4 Tryptophan synthase beta chain (EC 4.2.1.20) 0.9927 89 218 GO:0004834
GO:0005737
AF-Q3HUY4-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.99 87 235 GO:0004834
GO:0005737
AF-A0A7R9NBY4-F1-model_v4 deleted 0.9874 109 253

Map