F352373

General Info

Members Datasets Scaffolds Average Seq Length
239 191 478 215

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0098602|Ga0500568_0098602_40_795
Length 251
Sequence MHAAGNLGSRSALVDGGQRDFEAAKGKRMNDMRSPGDLKFSRRDLLIVGAASLTAPAIGVTTSPFVAKAEVALKPAVPGAPVMSKVSFNVNGKVRELEVDTRTTLLDALREQLHFTGTKKGCDHGQCGACTVIVDGRRINSCLTLAVMHEGDSVTTIEGLGTPENMHPMQAAFVKHDGYQCGYCTPGQICSAVAVLDEIKAGIPSHVSADLTASPQFSATELRERMSGNICRCAAYSNIVDAVTEVAGSKA

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
86 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
87 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
88 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
89 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
165 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
166 2643221733 Bosea sp. Root381 Isolate Unclassified
167 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
168 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
169 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
170 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
171 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
172 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
173 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
174 2899924645 Variovorax sp. 369 Isolate Unclassified
175 2928037797 Variovorax sp. 1126 Isolate Unclassified
176 2928044640 Variovorax sp. 1128 Isolate Unclassified
177 2928051484 Variovorax sp. 1133 Isolate Unclassified
178 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
179 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
180 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
181 2929520902 Variovorax beijingensis 502 Isolate Unclassified
182 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
183 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
184 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
185 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
186 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
187 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
188 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
189 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
190 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
191 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.87
Metatranscriptomes 0.42
Isolates 11.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.34
Nodule 3.35
Rhizoplane 1.67
Rhizosphere 62.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0098602 3300053139 Bacteria 1098
2 Ga0055526_1024129 3300003771 Bacteria 2003
3 Ga0055536_1047988 3300003781 Bacteria 958
4 Ga0065165_1011386 3300005262 Bacteria 3719
5 Ga0070670_100063956 3300005331 Bacteria 3157
6 Ga0070670_100064695 3300005331 Bacteria 3137
7 Ga0070677_10290466 3300005333 Bacteria 827
8 Ga0070674_100551817 3300005356 Bacteria 967
9 Ga0070709_10163490 3300005434 Bacteria 1549
10 Ga0070713_100394363 3300005436 Bacteria 1292
11 Ga0070710_10459363 3300005437 Bacteria 865
12 Ga0070663_100857930 3300005455 Bacteria 782
13 Ga0068853_100030471 3300005539 Bacteria 4556
14 Ga0068857_100101863 3300005577 Bacteria 2577
15 Ga0068854_100000798 3300005578 Bacteria 18769
16 Ga0068852_100025737 3300005616 Bacteria 4772
17 Ga0068852_100146175 3300005616 Bacteria 2193
18 Ga0068859_100009697 3300005617 Bacteria 9722
19 Ga0068859_100325020 3300005617 Bacteria 1632
20 Ga0068864_100385553 3300005618 Bacteria 1329
21 Ga0068870_10263154 3300005840 Bacteria 1074
22 Ga0068863_100002525 3300005841 Bacteria 18156
23 Ga0068863_100011552 3300005841 Bacteria 8543
24 Ga0068860_100000131 3300005843 Bacteria 121109
25 Ga0068860_100007614 3300005843 Bacteria 10836
26 Ga0068860_100039909 3300005843 Bacteria 4488
27 Ga0068862_100000742 3300005844 Bacteria 32711
28 Ga0081455_10114702 3300005937 Bacteria 2134
29 Ga0081540_1001861 3300005983 Bacteria 17661
30 Ga0081539_10000922 3300005985 Bacteria 55364
31 Ga0081539_10035090 3300005985 Bacteria 3020
32 Ga0070717_10716021 3300006028 Bacteria 909
33 Ga0075365_10029758 3300006038 Bacteria 3493
34 Ga0075365_10142855 3300006038 Bacteria 1662
35 Ga0075365_10698667 3300006038 Bacteria 716
36 Ga0075363_100068761 3300006048 Bacteria 1921
37 Ga0075363_100174313 3300006048 Bacteria 1222
38 Ga0070712_100065622 3300006175 Bacteria 2577
39 Ga0075362_10040156 3300006177 Bacteria 2059
40 Ga0075367_10019627 3300006178 Bacteria 3751
41 Ga0075367_10306629 3300006178 Bacteria 1000
42 Ga0075369_10042203 3300006186 Bacteria 1955
43 Ga0075366_10045844 3300006195 Bacteria 2591
44 Ga0075370_10179968 3300006353 Bacteria 1244
45 Ga0075370_10210203 3300006353 Bacteria 1149
46 Ga0068871_100295452 3300006358 Bacteria 1421
47 Ga0068871_100951653 3300006358 Bacteria 798
48 Ga0075428_100003995 3300006844 Bacteria 16188
49 Ga0075428_100157769 3300006844 Bacteria 2464
50 Ga0075431_100000133 3300006847 Bacteria 49893
51 Ga0075431_100256403 3300006847 Bacteria 1776
52 Ga0075434_100034065 3300006871 Bacteria 5028
53 Ga0097620_100009696 3300006931 Bacteria 9722
54 Ga0097620_100325032 3300006931 Bacteria 1632
55 Ga0075435_100006352 3300007076 Bacteria 8353
56 Ga0105240_10840018 3300009093 Bacteria 992
57 Ga0111539_10005823 3300009094 Bacteria 15932
58 Ga0105247_10008509 3300009101 Bacteria 6249
59 Ga0114129_10010316 3300009147 Bacteria 13330
60 Ga0105249_10000161 3300009553 Bacteria 80491
61 Ga0105249_10241118 3300009553 Bacteria 1787
62 Ga0105246_10233270 3300011119 Bacteria 1450
63 Ga0157378_10084279 3300013297 Bacteria 2877
64 Ga0163162_11443317 3300013306 Bacteria 783
65 Ga0157375_10005452 3300013308 Bacteria 11063
66 Ga0157376_10253396 3300014969 Bacteria 1645
67 Ga0209676_1007351 3300025292 Bacteria 5196
68 Ga0209025_1000010 3300025294 Bacteria 986612
69 Ga0209564_1000290 3300025295 Bacteria 101964
70 Ga0209758_1090061 3300025297 Bacteria 901
71 Ga0207656_10058384 3300025321 Bacteria 1685
72 Ga0207710_10004644 3300025900 Bacteria 5963
73 Ga0207643_10417974 3300025908 Bacteria 850
74 Ga0207671_10040870 3300025914 Bacteria 3432
75 Ga0207693_10066618 3300025915 Bacteria 2819
76 Ga0207650_10373485 3300025925 Bacteria 1176
77 Ga0207644_10364137 3300025931 Bacteria 1177
78 Ga0207691_10005483 3300025940 Bacteria 12252
79 Ga0207712_10000059 3300025961 Bacteria 137849
80 Ga0207640_10014688 3300025981 Bacteria 4513
81 Ga0207658_10000094 3300025986 Bacteria 98638
82 Ga0207639_10000169 3300026041 Bacteria 50659
83 Ga0207678_10800835 3300026067 Bacteria 832
84 Ga0207641_10003204 3300026088 Bacteria 14644
85 Ga0207641_10065176 3300026088 Bacteria 3115
86 Ga0207674_10088330 3300026116 Bacteria 3093
87 Ga0207698_10050443 3300026142 Bacteria 3175
88 Ga0207428_10013695 3300027907 Bacteria 7072
89 Ga0268266_10209801 3300028379 Bacteria 1786
90 Ga0268265_10000281 3300028380 Bacteria 57698
91 Ga0268264_10000204 3300028381 Bacteria 120959
92 Ga0268264_10006477 3300028381 Bacteria 9859
93 Ga0268264_10012701 3300028381 Bacteria 6931
94 Ga0307517_10000744 3300028786 Bacteria 56253
95 Ga0316177_1121176 3300030731 Bacteria 865
96 Ga0307513_10034667 3300031456 Bacteria 5660
97 Ga0307513_10282094 3300031456 Bacteria 1438
98 Ga0307516_10256289 3300031730 Bacteria 1442
99 Ga0307412_10213572 3300031911 Bacteria 1474
100 Ga0307409_100650686 3300031995 Bacteria 1048
101 Ga0307409_101116352 3300031995 Bacteria 810
102 Ga0307416_100313053 3300032002 Bacteria 1567
103 Ga0307416_100717724 3300032002 Bacteria 1090
104 Ga0307414_10071844 3300032004 Bacteria 2498
105 Ga0307411_10096133 3300032005 Bacteria 2081
106 Ga0395900_0126443 3300037418 Bacteria 2622
107 Ga0395905_0581063 3300037471 Bacteria 1022
108 Ga0439438_053328 3300041405 Bacteria 1024
109 Ga0451837_0622177 3300041494 Bacteria 1624
110 Ga0451841_1351317 3300041498 Bacteria 6680
111 Ga0451855_0035245 3300041511 Bacteria 1618
112 Ga0439459_0122422 3300042438 Bacteria 657
113 Ga0466957_0193501 3300044842 Bacteria 1333
114 Ga0495590_0006602 3300046457 Bacteria 4521
115 Ga0495638_0009327 3300046460 Bacteria 6898
116 Ga0495638_0231027 3300046460 Bacteria 1029
117 Ga0495639_0191283 3300046475 Bacteria 999
118 Ga0495664_0023769 3300046477 Bacteria 3557
119 Ga0495584_0010105 3300046491 Bacteria 4847
120 Ga0495594_0158493 3300046499 Bacteria 1286
121 Ga0495596_0057405 3300046500 Bacteria 1519
122 Ga0495606_0006558 3300046507 Bacteria 10700
123 Ga0495610_0000300 3300046512 Bacteria 52078
124 Ga0495632_0000753 3300046519 Bacteria 29159
125 Ga0495632_0013885 3300046519 Bacteria 4576
126 Ga0495637_0000896 3300046520 Bacteria 19239
127 Ga0495643_0000010 3300046522 Bacteria 341431
128 Ga0495643_0000023 3300046522 Bacteria 288590
129 Ga0495663_0000144 3300046525 Bacteria 29159
130 Ga0495654_0023742 3300046530 Bacteria 3173
131 Ga0495597_0129556 3300046542 Bacteria 1047
132 Ga0495622_0000692 3300046557 Bacteria 19112
133 Ga0495633_0002127 3300046558 Bacteria 14195
134 Ga0495668_0008680 3300046616 Bacteria 6316
135 Ga0495668_0304619 3300046616 Bacteria 874
136 Ga0495625_0010464 3300046660 Bacteria 7674
137 Ga0495625_0380315 3300046660 Bacteria 886
138 Ga0495588_0090075 3300046674 Bacteria 1606
139 Ga0495599_0137342 3300046678 Bacteria 1517
140 Ga0495646_0144903 3300046680 Bacteria 1325
141 Ga0495658_0393120 3300046683 Bacteria 883
142 Ga0495671_0000014 3300046692 Bacteria 341431
143 Ga0495671_0034951 3300046692 Bacteria 2554
144 Ga0495649_0020544 3300046694 Bacteria 3704
145 Ga0495649_0103491 3300046694 Bacteria 1512
146 Ga0495649_0149747 3300046694 Bacteria 1226
147 Ga0495589_0029340 3300046794 Bacteria 2773
148 Ga0495674_0089370 3300047319 Bacteria 2633
149 Ga0495679_000005 3300047446 Bacteria 455007
150 Ga0495681_0003234 3300047470 Bacteria 11359
151 Ga0495686_0018091 3300047472 Bacteria 4735
152 Ga0495602_0164116 3300048088 Bacteria 1731
153 Ga0496102_0096861 3300048905 Bacteria 2736
154 Ga0496106_0458816 3300048909 Bacteria 1024
155 Ga0496114_0862192 3300048917 Bacteria 786
156 Ga0496122_0023862 3300048925 Bacteria 5372
157 Ga0496123_0047512 3300048926 Bacteria 2898
158 Ga0496123_0056806 3300048926 Bacteria 2554
159 Ga0496123_0104194 3300048926 Bacteria 1641
160 Ga0496123_0172750 3300048926 Bacteria 1138
161 Ga0496124_0036684 3300048927 Bacteria 4273
162 Ga0496125_0000063 3300048928 Bacteria 250260
163 Ga0496126_0612139 3300048929 Bacteria 857
164 Ga0501307_039762 3300049162 Bacteria 680
165 Ga0501032_0056474 3300049569 Bacteria 2639
166 Ga0501033_0096888 3300049570 Bacteria 2156
167 Ga0501034_0217573 3300049571 Bacteria 1864
168 Ga0501047_0714134 3300049581 Bacteria 819
169 Ga0501067_0226424 3300049583 Bacteria 1041
170 Ga0501073_0174316 3300049589 Bacteria 1489
171 Ga0501249_002799 3300049679 Bacteria 3511
172 Ga0501044_0111422 3300049823 Bacteria 2744
173 nmdc:mga03683_13791_c1 3300050489 Bacteria 2979
174 nmdc:mga03683_24572_c1 3300050489 Bacteria 2358
175 nmdc:mga03683_65104_c1 3300050489 Bacteria 1548
176 nmdc:mga03n38_137691_c1 3300050490 Bacteria 1216
177 nmdc:mga03n38_76051_c1 3300050490 Bacteria 1565
178 nmdc:mga00v17_179738_c1 3300050491 Bacteria 1365
179 nmdc:mga00v17_46032_c1 3300050491 Bacteria 2638
180 nmdc:mga0yw44_163472_c1 3300050492 Bacteria 1458
181 nmdc:mga0yw44_25464_c1 3300050492 Bacteria 3364
182 nmdc:mga0yw44_52694_c1 3300050492 Bacteria 2468
183 nmdc:mga0k408_60315_c1 3300050493 Bacteria 2204
184 nmdc:mga06z11_3004_c1 3300050494 Bacteria 6486
185 nmdc:mga06z11_38822_c1 3300050494 Bacteria 2366
186 nmdc:mga07m45_180592_c1 3300050496 Bacteria 1227
187 nmdc:mga07m45_9472_c1 3300050496 Bacteria 5055
188 nmdc:mga05p37_148648_c1 3300050507 Bacteria 2867
189 nmdc:mga05p37_2269_c1 3300050507 Bacteria 17220
190 nmdc:mga06r32_240655_c1 3300050510 Bacteria 1797
191 nmdc:mga06r32_50_c1 3300050510 Bacteria 73688
192 nmdc:mga08y16_310_c1 3300050511 Bacteria 43986
193 nmdc:mga0n895_79472_c1 3300050512 Bacteria 2963
194 nmdc:mga0rr50_2619_c1 3300050513 Bacteria 10194
195 nmdc:mga0sz30_32537_c1 3300050516 Bacteria 2163
196 Ga0500635_0025082 3300053080 Bacteria 1876
197 Ga0500635_0027525 3300053080 Bacteria 1808
198 Ga0500643_014042 3300053087 Bacteria 2800
199 Ga0500583_0191322 3300053092 Bacteria 1018
200 Ga0500641_0157789 3300053096 Bacteria 979
201 Ga0500562_052358 3300053108 Bacteria 1093
202 Ga0500595_005151 3300053119 Bacteria 5737
203 Ga0500618_048651 3300053125 Bacteria 963
204 Ga0500658_0000833 3300053134 Bacteria 12691
205 Ga0500568_0010971 3300053139 Bacteria 4223
206 Ga0500568_0020061 3300053139 Bacteria 2898
207 Ga0500616_0087573 3300053153 Bacteria 1550
208 Ga0500622_0000544 3300053156 Bacteria 34698
209 Ga0500622_0001591 3300053156 Bacteria 17867
210 Ga0500627_0044480 3300053158 Bacteria 1918
211 Ga0466962_0043022 3300061719 Bacteria 2162
212 2513694434 2513237101 Bacteria 7952346
213 2600228682 2599185359 Bacteria 4772316
214 2644731071 2643221733 Bacteria 5690728
215 2723849077 2721755755 Bacteria 8322773
216 2819714520 2818991466 Bacteria 4748179
217 2838058457 2838054893 Bacteria 7451788
218 2848298331 2848297114 Bacteria 3608511
219 2874607023 2874604998 Bacteria 7834745
220 2879164951 2879163058 Bacteria 4223965
221 2896389728 2896384573 Bacteria 7700774
222 2899929460 2899924645 Bacteria 7487985
223 2928040096 2928037797 Bacteria 7273642
224 2928047155 2928044640 Bacteria 7271509
225 2928057642 2928051484 Bacteria 7773759
226 2928067976 2928064002 Bacteria 7419480
227 2928529022 2928526807 Bacteria 4760224
228 2928968540 2928968154 Bacteria 4633371
229 2929523970 2929520902 Bacteria 6765052
230 2932414424 2932410948 Bacteria 6312192
231 2932417033 2932416698 Bacteria 6315112
232 2945910206 2945909444 Bacteria 7065066
233 2945972770 2945972063 Bacteria 6086495
234 2945987768 2945984333 Bacteria 7358892
235 8006972497 8006964411 Bacteria 8966052
236 8006988524 8006984368 Bacteria 9651211
237 8006995268 8006994254 Bacteria 8309700
238 8055307927 8055301274 Bacteria 8587385
239 8056679236 8056673599 Bacteria 7871253
240 Ga0500568_0098602
241 Ga0055526_1024129
242 Ga0055536_1047988
243 Ga0065165_1011386
244 Ga0070670_100063956
245 Ga0070670_100064695
246 Ga0070677_10290466
247 Ga0070674_100551817
248 Ga0070709_10163490
249 Ga0070713_100394363
250 Ga0070710_10459363
251 Ga0070663_100857930
252 Ga0068853_100030471
253 Ga0068857_100101863
254 Ga0068854_100000798
255 Ga0068852_100025737
256 Ga0068852_100146175
257 Ga0068859_100009697
258 Ga0068859_100325020
259 Ga0068864_100385553
260 Ga0068870_10263154
261 Ga0068863_100002525
262 Ga0068863_100011552
263 Ga0068860_100000131
264 Ga0068860_100007614
265 Ga0068860_100039909
266 Ga0068862_100000742
267 Ga0081455_10114702
268 Ga0081540_1001861
269 Ga0081539_10000922
270 Ga0081539_10035090
271 Ga0070717_10716021
272 Ga0075365_10029758
273 Ga0075365_10142855
274 Ga0075365_10698667
275 Ga0075363_100068761
276 Ga0075363_100174313
277 Ga0070712_100065622
278 Ga0075362_10040156
279 Ga0075367_10019627
280 Ga0075367_10306629
281 Ga0075369_10042203
282 Ga0075366_10045844
283 Ga0075370_10179968
284 Ga0075370_10210203
285 Ga0068871_100295452
286 Ga0068871_100951653
287 Ga0075428_100003995
288 Ga0075428_100157769
289 Ga0075431_100000133
290 Ga0075431_100256403
291 Ga0075434_100034065
292 Ga0097620_100009696
293 Ga0097620_100325032
294 Ga0075435_100006352
295 Ga0105240_10840018
296 Ga0111539_10005823
297 Ga0105247_10008509
298 Ga0114129_10010316
299 Ga0105249_10000161
300 Ga0105249_10241118
301 Ga0105246_10233270
302 Ga0157378_10084279
303 Ga0163162_11443317
304 Ga0157375_10005452
305 Ga0157376_10253396
306 Ga0209676_1007351
307 Ga0209025_1000010
308 Ga0209564_1000290
309 Ga0209758_1090061
310 Ga0207656_10058384
311 Ga0207710_10004644
312 Ga0207643_10417974
313 Ga0207671_10040870
314 Ga0207693_10066618
315 Ga0207650_10373485
316 Ga0207644_10364137
317 Ga0207691_10005483
318 Ga0207712_10000059
319 Ga0207640_10014688
320 Ga0207658_10000094
321 Ga0207639_10000169
322 Ga0207678_10800835
323 Ga0207641_10003204
324 Ga0207641_10065176
325 Ga0207674_10088330
326 Ga0207698_10050443
327 Ga0207428_10013695
328 Ga0268266_10209801
329 Ga0268265_10000281
330 Ga0268264_10000204
331 Ga0268264_10006477
332 Ga0268264_10012701
333 Ga0307517_10000744
334 Ga0316177_1121176
335 Ga0307513_10034667
336 Ga0307513_10282094
337 Ga0307516_10256289
338 Ga0307412_10213572
339 Ga0307409_100650686
340 Ga0307409_101116352
341 Ga0307416_100313053
342 Ga0307416_100717724
343 Ga0307414_10071844
344 Ga0307411_10096133
345 Ga0395900_0126443
346 Ga0395905_0581063
347 Ga0439438_053328
348 Ga0451837_0622177
349 Ga0451841_1351317
350 Ga0451855_0035245
351 Ga0439459_0122422
352 Ga0466957_0193501
353 Ga0495590_0006602
354 Ga0495638_0009327
355 Ga0495638_0231027
356 Ga0495639_0191283
357 Ga0495664_0023769
358 Ga0495584_0010105
359 Ga0495594_0158493
360 Ga0495596_0057405
361 Ga0495606_0006558
362 Ga0495610_0000300
363 Ga0495632_0000753
364 Ga0495632_0013885
365 Ga0495637_0000896
366 Ga0495643_0000010
367 Ga0495643_0000023
368 Ga0495663_0000144
369 Ga0495654_0023742
370 Ga0495597_0129556
371 Ga0495622_0000692
372 Ga0495633_0002127
373 Ga0495668_0008680
374 Ga0495668_0304619
375 Ga0495625_0010464
376 Ga0495625_0380315
377 Ga0495588_0090075
378 Ga0495599_0137342
379 Ga0495646_0144903
380 Ga0495658_0393120
381 Ga0495671_0000014
382 Ga0495671_0034951
383 Ga0495649_0020544
384 Ga0495649_0103491
385 Ga0495649_0149747
386 Ga0495589_0029340
387 Ga0495674_0089370
388 Ga0495679_000005
389 Ga0495681_0003234
390 Ga0495686_0018091
391 Ga0495602_0164116
392 Ga0496102_0096861
393 Ga0496106_0458816
394 Ga0496114_0862192
395 Ga0496122_0023862
396 Ga0496123_0047512
397 Ga0496123_0056806
398 Ga0496123_0104194
399 Ga0496123_0172750
400 Ga0496124_0036684
401 Ga0496125_0000063
402 Ga0496126_0612139
403 Ga0501307_039762
404 Ga0501032_0056474
405 Ga0501033_0096888
406 Ga0501034_0217573
407 Ga0501047_0714134
408 Ga0501067_0226424
409 Ga0501073_0174316
410 Ga0501249_002799
411 Ga0501044_0111422
412 nmdc:mga03683_13791_c1
413 nmdc:mga03683_24572_c1
414 nmdc:mga03683_65104_c1
415 nmdc:mga03n38_137691_c1
416 nmdc:mga03n38_76051_c1
417 nmdc:mga00v17_179738_c1
418 nmdc:mga00v17_46032_c1
419 nmdc:mga0yw44_163472_c1
420 nmdc:mga0yw44_25464_c1
421 nmdc:mga0yw44_52694_c1
422 nmdc:mga0k408_60315_c1
423 nmdc:mga06z11_3004_c1
424 nmdc:mga06z11_38822_c1
425 nmdc:mga07m45_180592_c1
426 nmdc:mga07m45_9472_c1
427 nmdc:mga05p37_148648_c1
428 nmdc:mga05p37_2269_c1
429 nmdc:mga06r32_240655_c1
430 nmdc:mga06r32_50_c1
431 nmdc:mga08y16_310_c1
432 nmdc:mga0n895_79472_c1
433 nmdc:mga0rr50_2619_c1
434 nmdc:mga0sz30_32537_c1
435 Ga0500635_0025082
436 Ga0500635_0027525
437 Ga0500643_014042
438 Ga0500583_0191322
439 Ga0500641_0157789
440 Ga0500562_052358
441 Ga0500595_005151
442 Ga0500618_048651
443 Ga0500658_0000833
444 Ga0500568_0010971
445 Ga0500568_0020061
446 Ga0500616_0087573
447 Ga0500622_0000544
448 Ga0500622_0001591
449 Ga0500627_0044480
450 Ga0466962_0043022
451 2513694434
452 2600228682
453 2644731071
454 2723849077
455 2819714520
456 2838058457
457 2848298331
458 2874607023
459 2879164951
460 2896389728
461 2899929460
462 2928040096
463 2928047155
464 2928057642
465 2928067976
466 2928529022
467 2928968540
468 2929523970
469 2932414424
470 2932417033
471 2945910206
472 2945972770
473 2945987768
474 8006972497
475 8006988524
476 8006995268
477 8055307927
478 8056679236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

156

244

0.97

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

88

155

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9644 42 211
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9496 47 213
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9487 44 214
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9483 47 212
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9427 42 211
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9801 47 121 3.10.20.30
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9773 123 211 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9769 46 121 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9736 46 121 3.10.20.30
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9667 123 211 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A2N3EJN6-F1-model_v4 Carbon monoxide dehydrogenase 0.989 47 125 GO:0051537
AF-A0A520HSC2-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9878 50 165 GO:0016903
GO:0046872
GO:0051537
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9864 47 124 GO:0051537
AF-A0A7C4DXL3-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9839 47 123 GO:0051537
AF-G9ZZ75-F1-model_v4 2Fe-2S iron-sulfur cluster-binding domain protein 0.9828 47 214 GO:0016903
GO:0042597
GO:0046872
GO:0051537

Map