F352650

General Info

Members Datasets Scaffolds Average Seq Length
240 175 231 219

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100143555|Ga0070707_1001435553
Length 213
Sequence MTLSRRLLKGGLVLLDPKSGSPVRVLALQYNPDSLSRSFQIQATGGDGQSRSEALRLKGPPVETIKVEAEIDATDLLEAGDATASRIGIHAELAALETVIYPSSRQIRSNQSLAGSGTLEILPMEAPLTLFVWSMQRIVPVRITDLSVTEEAFDQNLNPIRAKVSIGMRVLSIDDLGFGHKGGEVFMTHLGRKEQLAAIRSSALATLGLESVP

Samples

Sample ID Description Type Environment
1 2734482264 Dyella sp. AD052 Isolate Unclassified
2 2738543009 Luteibacter sp. OK325 Isolate Unclassified
3 2739367700 Dyella sp. YR388 Isolate Unclassified
4 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
5 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
6 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
7 2928963466 Dyella japonica 1073 Isolate Unclassified
8 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0.83
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.17
Nodule 0
Rhizoplane 2.92
Rhizosphere 79.58
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10073776 3300003316 Bacteria 1114
2 rootH2_10001362 3300003320 Bacteria 52723
3 rootL2_10091718 3300003322 Bacteria 7564
4 rootH1_10035420 3300003323 Bacteria 3231
5 rootH1_10284792 3300003323 Bacteria 4158
6 Ga0055525_1000207 3300003759 Bacteria 66980
7 Ga0055527_1000108 3300003760 Bacteria 59457
8 Ga0055535_1000646 3300003761 Bacteria 27765
9 Ga0055542_1000223 3300003762 Bacteria 68138
10 Ga0055542_1000447 3300003762 Bacteria 39214
11 Ga0055529_1000603 3300003763 Bacteria 27759
12 Ga0058861_11466948 3300004800 Bacteria 822
13 Ga0065165_1007393 3300005262 Bacteria 5415
14 Ga0065712_10025836 3300005290 Bacteria 1850
15 Ga0070658_10000546 3300005327 Bacteria 32588
16 Ga0070666_10000008 3300005335 Bacteria 293415
17 Ga0070682_100010251 3300005337 Bacteria 5315
18 Ga0070661_100230402 3300005344 Bacteria 1423
19 Ga0070692_10099720 3300005345 Bacteria 1590
20 Ga0070668_100152350 3300005347 Bacteria 1871
21 Ga0070669_100154302 3300005353 Bacteria 1780
22 Ga0070675_100068504 3300005354 Bacteria 2938
23 Ga0070675_100836814 3300005354 Bacteria 842
24 Ga0070671_100018684 3300005355 Bacteria 5633
25 Ga0070671_100265264 3300005355 Bacteria 1460
26 Ga0070688_100044291 3300005365 Bacteria 2745
27 Ga0070688_100152973 3300005365 Bacteria 1578
28 Ga0070659_100164428 3300005366 Bacteria 1815
29 Ga0070667_100034232 3300005367 Bacteria 4249
30 Ga0070714_100000073 3300005435 Bacteria 88847
31 Ga0070711_100003614 3300005439 Bacteria 9028
32 Ga0070694_100279338 3300005444 Bacteria 1272
33 Ga0070708_100007847 3300005445 Bacteria 8548
34 Ga0070663_100406453 3300005455 Bacteria 1114
35 Ga0070663_100410637 3300005455 Bacteria 1109
36 Ga0070678_100017162 3300005456 Bacteria 4653
37 Ga0070678_100959440 3300005456 Bacteria 784
38 Ga0070681_10544000 3300005458 Bacteria 1075
39 Ga0068867_100256428 3300005459 Bacteria 1424
40 Ga0068867_100311786 3300005459 Bacteria 1300
41 Ga0068867_100617198 3300005459 Bacteria 948
42 Ga0070706_100099406 3300005467 Unclassified 2703
43 Ga0070707_100033740 3300005468 Unclassified 4880
44 Ga0070707_100143555 3300005468 Bacteria 2323
45 Ga0070698_100003316 3300005471 Bacteria 17711
46 Ga0070698_100047475 3300005471 Bacteria 4389
47 Ga0070698_100081406 3300005471 Bacteria 3232
48 Ga0070699_100003159 3300005518 Bacteria 14581
49 Ga0070699_100050294 3300005518 Bacteria 3608
50 Ga0070679_100433402 3300005530 Unclassified 1260
51 Ga0070684_100578638 3300005535 Bacteria 1043
52 Ga0070697_100001997 3300005536 Bacteria 15627
53 Ga0070665_100038793 3300005548 Bacteria 4788
54 Ga0070665_100065612 3300005548 Bacteria 3641
55 Ga0070665_100249400 3300005548 Bacteria 1776
56 Ga0068855_100000148 3300005563 Bacteria 89300
57 Ga0068855_100158589 3300005563 Bacteria 2569
58 Ga0068855_100205763 3300005563 Bacteria 2214
59 Ga0068855_100372367 3300005563 Bacteria 1570
60 Ga0068857_100138531 3300005577 Bacteria 2198
61 Ga0068854_100000527 3300005578 Bacteria 23195
62 Ga0068854_100079334 3300005578 Bacteria 2420
63 Ga0068859_100002758 3300005617 Bacteria 17812
64 Ga0068859_100036099 3300005617 Bacteria 4961
65 Ga0068859_100145673 3300005617 Bacteria 2443
66 Ga0068864_100078458 3300005618 Unclassified 2890
67 Ga0068864_100292750 3300005618 Bacteria 1522
68 Ga0068866_10150710 3300005718 Bacteria 1346
69 Ga0068851_10007226 3300005834 Bacteria 5091
70 Ga0068870_10565590 3300005840 Bacteria 768
71 Ga0068862_100000932 3300005844 Bacteria 28214
72 Ga0068862_100017498 3300005844 Bacteria 5970
73 Ga0068862_100019534 3300005844 Bacteria 5657
74 Ga0070717_10019275 3300006028 Bacteria 5349
75 Ga0075364_10070171 3300006051 Unclassified 2306
76 Ga0075362_10013108 3300006177 Bacteria 3309
77 Ga0075366_10103315 3300006195 Unclassified 1711
78 Ga0097621_100038934 3300006237 Bacteria 3817
79 Ga0097621_100160599 3300006237 Bacteria 1932
80 Ga0068871_100055259 3300006358 Unclassified 3223
81 Ga0068871_100716682 3300006358 Bacteria 917
82 Ga0075431_100681557 3300006847 Unclassified 1006
83 Ga0097620_100002758 3300006931 Bacteria 17812
84 Ga0097620_100036099 3300006931 Bacteria 4961
85 Ga0097620_100145657 3300006931 Bacteria 2443
86 Ga0105240_10007036 3300009093 Bacteria 16414
87 Ga0105240_10300398 3300009093 Bacteria 1837
88 Ga0105245_10001450 3300009098 Bacteria 21466
89 Ga0105241_10260853 3300009174 Bacteria 1473
90 Ga0105248_10108658 3300009177 Bacteria 3127
91 Ga0105248_10109716 3300009177 Bacteria 3111
92 Ga0105248_10920113 3300009177 Bacteria 988
93 Ga0105237_10143474 3300009545 Bacteria 2382
94 Ga0105237_10435761 3300009545 Bacteria 1316
95 Ga0105238_10000303 3300009551 Bacteria 53935
96 Ga0105238_10008975 3300009551 Bacteria 10008
97 Ga0105238_10016175 3300009551 Bacteria 7549
98 Ga0105238_10129660 3300009551 Bacteria 2500
99 Ga0105249_10181826 3300009553 Bacteria 2046
100 Ga0105239_10181599 3300010375 Unclassified 2354
101 Ga0105239_11141289 3300010375 Bacteria 897
102 Ga0105246_10265785 3300011119 Bacteria 1369
103 Ga0157370_10002744 3300013104 Bacteria 21055
104 Ga0157370_10176111 3300013104 Bacteria 1988
105 Ga0157370_10520127 3300013104 Bacteria 1092
106 Ga0157378_10034918 3300013297 Bacteria 4445
107 Ga0163162_10000900 3300013306 Bacteria 27686
108 Ga0157372_10491416 3300013307 Bacteria 1431
109 Ga0157375_10184426 3300013308 Bacteria 2239
110 Ga0157375_10971449 3300013308 Bacteria 990
111 Ga0157377_10386692 3300014745 Bacteria 949
112 Ga0182007_10011682 3300015262 Bacteria 3411
113 Ga0182007_10030681 3300015262 Bacteria 1835
114 Ga0183369_1014 3300015685 Bacteria 194173
115 Ga0163161_10147255 3300017792 Bacteria 1787
116 Ga0206353_10125045 3300020082 Bacteria 2359
117 Ga0209672_100103 3300025228 Bacteria 104244
118 Ga0209563_100150 3300025230 Bacteria 65666
119 Ga0207427_100768 3300025231 Bacteria 14614
120 Ga0209437_100228 3300025233 Bacteria 98265
121 Ga0209258_100232 3300025242 Bacteria 104244
122 Ga0209258_102440 3300025242 Bacteria 4806
123 Ga0209148_1000005 3300025254 Bacteria 1806504
124 Ga0209148_1000206 3300025254 Bacteria 104244
125 Ga0209233_1021239 3300025261 Bacteria 1685
126 Ga0209455_1000179 3300025272 Bacteria 104244
127 Ga0209758_1013549 3300025297 Bacteria 4431
128 Ga0207656_10003111 3300025321 Bacteria 5685
129 Ga0207680_10000005 3300025903 Bacteria 660983
130 Ga0207647_10033272 3300025904 Bacteria 3302
131 Ga0207645_10139519 3300025907 Bacteria 1579
132 Ga0207643_10456028 3300025908 Bacteria 814
133 Ga0207705_10002958 3300025909 Bacteria 12985
134 Ga0207705_10033543 3300025909 Bacteria 3668
135 Ga0207684_10001890 3300025910 Bacteria 21792
136 Ga0207707_10065850 3300025912 Bacteria 3155
137 Ga0207695_10008974 3300025913 Bacteria 12443
138 Ga0207671_10095289 3300025914 Unclassified 2247
139 Ga0207671_10570810 3300025914 Bacteria 902
140 Ga0207663_10071153 3300025916 Bacteria 2244
141 Ga0207660_10295745 3300025917 Bacteria 1288
142 Ga0207649_10053056 3300025920 Bacteria 2518
143 Ga0207646_10004632 3300025922 Bacteria 14850
144 Ga0207681_10157461 3300025923 Bacteria 1708
145 Ga0207694_10000241 3300025924 Bacteria 52660
146 Ga0207694_10018151 3300025924 Bacteria 5319
147 Ga0207694_10306149 3300025924 Bacteria 1309
148 Ga0207659_10384088 3300025926 Bacteria 1171
149 Ga0207659_10509935 3300025926 Bacteria 1019
150 Ga0207687_10014277 3300025927 Bacteria 5196
151 Ga0207664_10000041 3300025929 Bacteria 154806
152 Ga0207690_10125904 3300025932 Bacteria 1868
153 Ga0207690_10247792 3300025932 Bacteria 1375
154 Ga0207706_10020684 3300025933 Bacteria 5913
155 Ga0207709_10021806 3300025935 Bacteria 3628
156 Ga0207691_10062151 3300025940 Bacteria 3390
157 Ga0207711_10110607 3300025941 Bacteria 2443
158 Ga0207667_10000062 3300025949 Bacteria 190422
159 Ga0207667_10081490 3300025949 Bacteria 3352
160 Ga0207667_10193589 3300025949 Bacteria 2086
161 Ga0207667_10396456 3300025949 Bacteria 1405
162 Ga0207651_10387082 3300025960 Bacteria 1186
163 Ga0207712_10197562 3300025961 Bacteria 1592
164 Ga0207668_10309673 3300025972 Bacteria 1306
165 Ga0207640_10000022 3300025981 Bacteria 167526
166 Ga0207658_10034440 3300025986 Bacteria 3620
167 Ga0207658_10053844 3300025986 Bacteria 2975
168 Ga0207678_10448980 3300026067 Bacteria 1120
169 Ga0207648_10244853 3300026089 Bacteria 1597
170 Ga0207648_10415541 3300026089 Bacteria 1221
171 Ga0207648_10805177 3300026089 Bacteria 875
172 Ga0207674_10136959 3300026116 Bacteria 2410
173 Ga0207675_100111251 3300026118 Bacteria 2584
174 Ga0207683_10219747 3300026121 Bacteria 1731
175 Ga0268266_10000004 3300028379 Bacteria 1495817
176 Ga0268266_10070486 3300028379 Bacteria 3029
177 Ga0268266_10077910 3300028379 Bacteria 2883
178 Ga0268266_10201062 3300028379 Bacteria 1824
179 Ga0268265_10000351 3300028380 Bacteria 49884
180 Ga0268265_10012206 3300028380 Bacteria 5820
181 Ga0268265_10028037 3300028380 Bacteria 4028
182 Ga0268264_10181013 3300028381 Unclassified 1914
183 Ga0307408_100356401 3300031548 Bacteria 1243
184 Ga0316576_10155979 3300031727 Unclassified 1721
185 Ga0307510_10005119 3300033180 Bacteria 15579
186 Ga0307510_10253363 3300033180 Bacteria 1246
187 Ga0373935_0004610 3300035692 Bacteria 8101
188 Ga0373925_0108502 3300037068 Bacteria 2142
189 Ga0395899_0208278 3300037312 Bacteria 1360
190 Ga0395899_0312670 3300037312 Bacteria 1060
191 Ga0395900_0123116 3300037418 Bacteria 2660
192 Ga0395901_0517103 3300038443 Bacteria 1213
193 Ga0495650_0000027 3300046471 Bacteria 475071
194 Ga0495650_0000150 3300046471 Bacteria 158574
195 Ga0495639_0164916 3300046475 Unclassified 1074
196 Ga0495606_0002023 3300046507 Bacteria 24906
197 Ga0495663_0034352 3300046525 Bacteria 1518
198 Ga0495625_0107489 3300046660 Bacteria 1909
199 Ga0495671_0000124 3300046692 Bacteria 70221
200 Ga0495680_0194822 3300047322 Bacteria 1456
201 Ga0496101_0003417 3300048904 Bacteria 9902
202 Ga0496108_0112473 3300048911 Bacteria 2329
203 Ga0496109_0526685 3300048912 Bacteria 1115
204 Ga0496112_0080167 3300048915 Bacteria 3228
205 Ga0496113_0279353 3300048916 Bacteria 1335
206 Ga0496115_0002963 3300048918 Bacteria 12207
207 Ga0496115_0722684 3300048918 Bacteria 781
208 Ga0496118_0000291 3300048921 Bacteria 87433
209 Ga0496121_0025550 3300048924 Bacteria 5599
210 Ga0496122_0077094 3300048925 Bacteria 2343
211 Ga0496125_0056633 3300048928 Bacteria 3182
212 Ga0496126_0023712 3300048929 Bacteria 5943
213 Ga0501033_0000524 3300049570 Bacteria 35901
214 Ga0501033_0194364 3300049570 Bacteria 1451
215 Ga0501034_0059654 3300049571 Bacteria 3832
216 Ga0501037_0044251 3300049573 Bacteria 3269
217 Ga0501038_0638211 3300049574 Bacteria 803
218 Ga0501041_0118268 3300049577 Bacteria 1646
219 Ga0501070_0322272 3300049586 Bacteria 1257
220 Ga0501070_0630160 3300049586 Bacteria 853
221 Ga0501072_0014201 3300049588 Bacteria 6103
222 Ga0501077_0133171 3300049593 Bacteria 1576
223 Ga0501035_0019841 3300049822 Bacteria 6175
224 Ga0501044_0161125 3300049823 Bacteria 2220
225 nmdc:mga0yw44_332550_c1 3300050492 Bacteria 1021
226 nmdc:mga09592_696982_c1 3300050508 Bacteria 864
227 nmdc:mga0qj67_755485_c1 3300050509 Bacteria 771
228 Ga0501084_0069903 3300054114 Bacteria 2940
229 Ga0590071_000640 3300059421 Bacteria 9939
230 Ga0590075_004826 3300059424 Bacteria 3187
231 Ga0530510_0004524 3300061734 Bacteria 9625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0014201 Ga0501072_0014201_3146_3754 178
2 3300050492 nmdc:mga0yw44_332550_c1 nmdc:mga0yw44_332550_c1_267_845 191
3 3300050508 nmdc:mga09592_696982_c1 nmdc:mga09592_696982_c1_260_847 195
4 3300059421 Ga0590071_000640 Ga0590071_000640_3536_4195 201
5 3300059424 Ga0590075_004826 Ga0590075_004826_839_1498 201
6 3300009098 Ga0105245_10001450 Ga0105245_1000145014 203
7 3300025927 Ga0207687_10014277 Ga0207687_100142776 203
8 3300025960 Ga0207651_10387082 Ga0207651_103870822 204
9 3300048918 Ga0496115_0722684 Ga0496115_0722684_27_656 208
10 3300031727 Ga0316576_10155979 Ga0316576_101559793 211
11 3300005468 Ga0070707_100143555 Ga0070707_1001435553 213
12 3300005471 Ga0070698_100081406 Ga0070698_1000814062 213
13 3300005518 Ga0070699_100050294 Ga0070699_1000502945 213
14 3300006051 Ga0075364_10070171 Ga0075364_100701714 213
15 3300006177 Ga0075362_10013108 Ga0075362_100131084 213
16 3300006195 Ga0075366_10103315 Ga0075366_101033152 213
17 3300031548 Ga0307408_100356401 Ga0307408_1003564011 214
18 iso_pu_bacteria 2734482264 2735836964 214
19 iso_pu_bacteria 2738543009 2739226409 214
20 iso_pu_bacteria 2739367700 2739731120 214
21 iso_pu_bacteria 2895395659 2895398984 214
22 iso_pu_bacteria 2906635258 2906637964 214
23 iso_pu_bacteria 2919450847 2919451452 214
24 iso_pu_bacteria 2939611941 2939615371 214
25 iso_pu_bacteria 8001845381 8001846300 214
26 iso_pu_bacteria 2928963466 2928967167 215
27 3300025912 Ga0207707_10065850 Ga0207707_100658502 216
28 3300004800 Ga0058861_11466948 Ga0058861_114669481 217
29 3300006847 Ga0075431_100681557 Ga0075431_1006815572 217
30 3300005337 Ga0070682_100010251 Ga0070682_1000102514 218
31 3300005344 Ga0070661_100230402 Ga0070661_1002304022 218
32 3300005345 Ga0070692_10099720 Ga0070692_100997202 218
33 3300005366 Ga0070659_100164428 Ga0070659_1001644282 218
34 3300005435 Ga0070714_100000073 Ga0070714_10000007361 218
35 3300005444 Ga0070694_100279338 Ga0070694_1002793382 218
36 3300005459 Ga0068867_100311786 Ga0068867_1003117862 218
37 3300005535 Ga0070684_100578638 Ga0070684_1005786382 218
38 3300005563 Ga0068855_100158589 Ga0068855_1001585892 218
39 3300005563 Ga0068855_100205763 Ga0068855_1002057631 218
40 3300005577 Ga0068857_100138531 Ga0068857_1001385312 218
41 3300009174 Ga0105241_10260853 Ga0105241_102608532 218
42 3300009177 Ga0105248_10920113 Ga0105248_109201132 218
43 3300009545 Ga0105237_10435761 Ga0105237_104357612 218
44 3300009551 Ga0105238_10129660 Ga0105238_101296603 218
45 3300010375 Ga0105239_11141289 Ga0105239_111412892 218
46 3300013104 Ga0157370_10176111 Ga0157370_101761112 218
47 3300013104 Ga0157370_10520127 Ga0157370_105201272 218
48 3300013307 Ga0157372_10491416 Ga0157372_104914162 218
49 3300015262 Ga0182007_10011682 Ga0182007_100116823 218
50 3300015262 Ga0182007_10030681 Ga0182007_100306813 218
51 3300017792 Ga0163161_10147255 Ga0163161_101472552 218
52 3300020082 Ga0206353_10125045 Ga0206353_101250452 218
53 3300025904 Ga0207647_10033272 Ga0207647_100332726 218
54 3300025909 Ga0207705_10033543 Ga0207705_100335431 218
55 3300025914 Ga0207671_10570810 Ga0207671_105708101 218
56 3300025920 Ga0207649_10053056 Ga0207649_100530563 218
57 3300025924 Ga0207694_10306149 Ga0207694_103061491 218
58 3300025929 Ga0207664_10000041 Ga0207664_10000041112 218
59 3300025932 Ga0207690_10125904 Ga0207690_101259042 218
60 3300025932 Ga0207690_10247792 Ga0207690_102477923 218
61 3300025933 Ga0207706_10020684 Ga0207706_100206847 218
62 3300025949 Ga0207667_10081490 Ga0207667_100814903 218
63 3300025949 Ga0207667_10193589 Ga0207667_101935892 218
64 3300025949 Ga0207667_10396456 Ga0207667_103964563 218
65 3300026089 Ga0207648_10415541 Ga0207648_104155412 218
66 3300026116 Ga0207674_10136959 Ga0207674_101369592 218
67 3300037312 Ga0395899_0208278 Ga0395899_0208278_552_1208 218
68 3300037418 Ga0395900_0123116 Ga0395900_0123116_1699_2355 218
69 3300038443 Ga0395901_0517103 Ga0395901_0517103_79_735 218
70 3300046475 Ga0495639_0164916 Ga0495639_0164916_137_793 218
71 3300048904 Ga0496101_0003417 Ga0496101_0003417_5364_6020 218
72 3300048918 Ga0496115_0002963 Ga0496115_0002963_862_1518 218
73 3300048925 Ga0496122_0077094 Ga0496122_0077094_313_969 218
74 3300049570 Ga0501033_0194364 Ga0501033_0194364_15_671 218
75 3300049571 Ga0501034_0059654 Ga0501034_0059654_1126_1782 218
76 3300049573 Ga0501037_0044251 Ga0501037_0044251_1942_2598 218
77 3300049574 Ga0501038_0638211 Ga0501038_0638211_20_676 218
78 3300049577 Ga0501041_0118268 Ga0501041_0118268_479_1135 218
79 3300049586 Ga0501070_0322272 Ga0501070_0322272_203_859 218
80 3300049593 Ga0501077_0133171 Ga0501077_0133171_394_1050 218
81 3300049822 Ga0501035_0019841 Ga0501035_0019841_5054_5710 218
82 3300049823 Ga0501044_0161125 Ga0501044_0161125_363_1019 218
83 3300054114 Ga0501084_0069903 Ga0501084_0069903_2210_2866 218
84 3300003316 rootH1_10073776 rootH1_100737762 219
85 3300003320 rootH2_10001362 rootH2_1000136228 219
86 3300003322 rootL2_10091718 rootL2_100917186 219
87 3300003323 rootH1_10035420 rootH1_100354203 219
88 3300003323 rootH1_10284792 rootH1_102847923 219
89 3300003759 Ga0055525_1000207 Ga0055525_100020729 219
90 3300003760 Ga0055527_1000108 Ga0055527_100010826 219
91 3300003761 Ga0055535_1000646 Ga0055535_100064617 219
92 3300003762 Ga0055542_1000223 Ga0055542_100022324 219
93 3300003762 Ga0055542_1000447 Ga0055542_100044714 219
94 3300003763 Ga0055529_1000603 Ga0055529_10006039 219
95 3300005262 Ga0065165_1007393 Ga0065165_10073936 219
96 3300005290 Ga0065712_10025836 Ga0065712_100258362 219
97 3300005327 Ga0070658_10000546 Ga0070658_100005468 219
98 3300005335 Ga0070666_10000008 Ga0070666_1000000811 219
99 3300005347 Ga0070668_100152350 Ga0070668_1001523502 219
100 3300005353 Ga0070669_100154302 Ga0070669_1001543022 219
101 3300005354 Ga0070675_100068504 Ga0070675_1000685044 219
102 3300005354 Ga0070675_100836814 Ga0070675_1008368141 219
103 3300005355 Ga0070671_100018684 Ga0070671_1000186843 219
104 3300005355 Ga0070671_100265264 Ga0070671_1002652643 219
105 3300005365 Ga0070688_100044291 Ga0070688_1000442912 219
106 3300005365 Ga0070688_100152973 Ga0070688_1001529733 219
107 3300005367 Ga0070667_100034232 Ga0070667_1000342323 219
108 3300005439 Ga0070711_100003614 Ga0070711_1000036144 219
109 3300005445 Ga0070708_100007847 Ga0070708_1000078478 219
110 3300005455 Ga0070663_100406453 Ga0070663_1004064532 219
111 3300005455 Ga0070663_100410637 Ga0070663_1004106372 219
112 3300005456 Ga0070678_100017162 Ga0070678_1000171623 219
113 3300005456 Ga0070678_100959440 Ga0070678_1009594401 219
114 3300005458 Ga0070681_10544000 Ga0070681_105440002 219
115 3300005459 Ga0068867_100256428 Ga0068867_1002564282 219
116 3300005459 Ga0068867_100617198 Ga0068867_1006171982 219
117 3300005467 Ga0070706_100099406 Ga0070706_1000994063 219
118 3300005468 Ga0070707_100033740 Ga0070707_1000337404 219
119 3300005471 Ga0070698_100003316 Ga0070698_1000033168 219
120 3300005471 Ga0070698_100047475 Ga0070698_1000474754 219
121 3300005518 Ga0070699_100003159 Ga0070699_10000315910 219
122 3300005530 Ga0070679_100433402 Ga0070679_1004334022 219
123 3300005536 Ga0070697_100001997 Ga0070697_10000199710 219
124 3300005548 Ga0070665_100038793 Ga0070665_1000387933 219
125 3300005548 Ga0070665_100065612 Ga0070665_1000656124 219
126 3300005548 Ga0070665_100249400 Ga0070665_1002494001 219
127 3300005563 Ga0068855_100000148 Ga0068855_10000014823 219
128 3300005563 Ga0068855_100372367 Ga0068855_1003723672 219
129 3300005578 Ga0068854_100000527 Ga0068854_1000005278 219
130 3300005578 Ga0068854_100079334 Ga0068854_1000793342 219
131 3300005617 Ga0068859_100002758 Ga0068859_10000275812 219
132 3300005617 Ga0068859_100036099 Ga0068859_1000360992 219
133 3300005617 Ga0068859_100145673 Ga0068859_1001456733 219
134 3300005618 Ga0068864_100078458 Ga0068864_1000784582 219
135 3300005618 Ga0068864_100292750 Ga0068864_1002927502 219
136 3300005718 Ga0068866_10150710 Ga0068866_101507103 219
137 3300005834 Ga0068851_10007226 Ga0068851_100072264 219
138 3300005840 Ga0068870_10565590 Ga0068870_105655901 219
139 3300005844 Ga0068862_100000932 Ga0068862_10000093215 219
140 3300005844 Ga0068862_100017498 Ga0068862_1000174984 219
141 3300005844 Ga0068862_100019534 Ga0068862_1000195342 219
142 3300006028 Ga0070717_10019275 Ga0070717_100192755 219
143 3300006237 Ga0097621_100038934 Ga0097621_1000389342 219
144 3300006237 Ga0097621_100160599 Ga0097621_1001605992 219
145 3300006358 Ga0068871_100055259 Ga0068871_1000552593 219
146 3300006358 Ga0068871_100716682 Ga0068871_1007166822 219
147 3300006931 Ga0097620_100002758 Ga0097620_10000275812 219
148 3300006931 Ga0097620_100036099 Ga0097620_1000360992 219
149 3300006931 Ga0097620_100145657 Ga0097620_1001456572 219
150 3300009093 Ga0105240_10007036 Ga0105240_100070369 219
151 3300009093 Ga0105240_10300398 Ga0105240_103003982 219
152 3300009177 Ga0105248_10108658 Ga0105248_101086584 219
153 3300009177 Ga0105248_10109716 Ga0105248_101097162 219
154 3300009545 Ga0105237_10143474 Ga0105237_101434744 219
155 3300009551 Ga0105238_10000303 Ga0105238_1000030327 219
156 3300009551 Ga0105238_10008975 Ga0105238_100089759 219
157 3300009551 Ga0105238_10016175 Ga0105238_100161755 219
158 3300009553 Ga0105249_10181826 Ga0105249_101818262 219
159 3300010375 Ga0105239_10181599 Ga0105239_101815992 219
160 3300011119 Ga0105246_10265785 Ga0105246_102657852 219
161 3300013104 Ga0157370_10002744 Ga0157370_100027449 219
162 3300013297 Ga0157378_10034918 Ga0157378_100349182 219
163 3300013306 Ga0163162_10000900 Ga0163162_1000090010 219
164 3300013308 Ga0157375_10184426 Ga0157375_101844262 219
165 3300013308 Ga0157375_10971449 Ga0157375_109714492 219
166 3300014745 Ga0157377_10386692 Ga0157377_103866922 219
167 3300015685 Ga0183369_1014 Ga0183369_101438 219
168 3300025228 Ga0209672_100103 Ga0209672_10010343 219
169 3300025230 Ga0209563_100150 Ga0209563_10015021 219
170 3300025231 Ga0207427_100768 Ga0207427_10076812 219
171 3300025233 Ga0209437_100228 Ga0209437_10022812 219
172 3300025242 Ga0209258_100232 Ga0209258_10023243 219
173 3300025242 Ga0209258_102440 Ga0209258_1024404 219
174 3300025254 Ga0209148_1000005 Ga0209148_1000005818 219
175 3300025254 Ga0209148_1000206 Ga0209148_100020643 219
176 3300025261 Ga0209233_1021239 Ga0209233_10212392 219
177 3300025272 Ga0209455_1000179 Ga0209455_100017943 219
178 3300025297 Ga0209758_1013549 Ga0209758_10135493 219
179 3300025321 Ga0207656_10003111 Ga0207656_100031114 219
180 3300025903 Ga0207680_10000005 Ga0207680_10000005224 219
181 3300025907 Ga0207645_10139519 Ga0207645_101395192 219
182 3300025908 Ga0207643_10456028 Ga0207643_104560281 219
183 3300025909 Ga0207705_10002958 Ga0207705_100029584 219
184 3300025910 Ga0207684_10001890 Ga0207684_1000189014 219
185 3300025913 Ga0207695_10008974 Ga0207695_100089747 219
186 3300025914 Ga0207671_10095289 Ga0207671_100952892 219
187 3300025916 Ga0207663_10071153 Ga0207663_100711532 219
188 3300025917 Ga0207660_10295745 Ga0207660_102957452 219
189 3300025922 Ga0207646_10004632 Ga0207646_100046324 219
190 3300025923 Ga0207681_10157461 Ga0207681_101574612 219
191 3300025924 Ga0207694_10000241 Ga0207694_1000024111 219
192 3300025924 Ga0207694_10018151 Ga0207694_100181513 219
193 3300025926 Ga0207659_10384088 Ga0207659_103840882 219
194 3300025926 Ga0207659_10509935 Ga0207659_105099352 219
195 3300025935 Ga0207709_10021806 Ga0207709_100218062 219
196 3300025940 Ga0207691_10062151 Ga0207691_100621512 219
197 3300025941 Ga0207711_10110607 Ga0207711_101106071 219
198 3300025949 Ga0207667_10000062 Ga0207667_1000006241 219
199 3300025961 Ga0207712_10197562 Ga0207712_101975622 219
200 3300025972 Ga0207668_10309673 Ga0207668_103096732 219
201 3300025981 Ga0207640_10000022 Ga0207640_1000002271 219
202 3300025986 Ga0207658_10034440 Ga0207658_100344404 219
203 3300025986 Ga0207658_10053844 Ga0207658_100538443 219
204 3300026067 Ga0207678_10448980 Ga0207678_104489802 219
205 3300026089 Ga0207648_10244853 Ga0207648_102448533 219
206 3300026089 Ga0207648_10805177 Ga0207648_108051771 219
207 3300026118 Ga0207675_100111251 Ga0207675_1001112512 219
208 3300026121 Ga0207683_10219747 Ga0207683_102197472 219
209 3300028379 Ga0268266_10000004 Ga0268266_100000041302 219
210 3300028379 Ga0268266_10070486 Ga0268266_100704861 219
211 3300028379 Ga0268266_10077910 Ga0268266_100779104 219
212 3300028379 Ga0268266_10201062 Ga0268266_102010623 219
213 3300028380 Ga0268265_10000351 Ga0268265_100003519 219
214 3300028380 Ga0268265_10012206 Ga0268265_100122062 219
215 3300028380 Ga0268265_10028037 Ga0268265_100280375 219
216 3300028381 Ga0268264_10181013 Ga0268264_101810133 219
217 3300033180 Ga0307510_10005119 Ga0307510_100051194 219
218 3300033180 Ga0307510_10253363 Ga0307510_102533632 219
219 3300035692 Ga0373935_0004610 Ga0373935_0004610_3732_4391 219
220 3300037068 Ga0373925_0108502 Ga0373925_0108502_1079_1738 219
221 3300037312 Ga0395899_0312670 Ga0395899_0312670_284_943 219
222 3300046471 Ga0495650_0000027 Ga0495650_0000027_10874_11533 219
223 3300046471 Ga0495650_0000150 Ga0495650_0000150_29041_29700 219
224 3300046507 Ga0495606_0002023 Ga0495606_0002023_21456_22118 219
225 3300046525 Ga0495663_0034352 Ga0495663_0034352_682_1341 219
226 3300046660 Ga0495625_0107489 Ga0495625_0107489_1185_1844 219
227 3300046692 Ga0495671_0000124 Ga0495671_0000124_55768_56427 219
228 3300047322 Ga0495680_0194822 Ga0495680_0194822_343_1002 219
229 3300048911 Ga0496108_0112473 Ga0496108_0112473_22_723 219
230 3300048912 Ga0496109_0526685 Ga0496109_0526685_355_1014 219
231 3300048915 Ga0496112_0080167 Ga0496112_0080167_2184_2885 219
232 3300048916 Ga0496113_0279353 Ga0496113_0279353_404_1105 219
233 3300048921 Ga0496118_0000291 Ga0496118_0000291_43104_43769 219
234 3300048924 Ga0496121_0025550 Ga0496121_0025550_3511_4170 219
235 3300048928 Ga0496125_0056633 Ga0496125_0056633_1866_2525 219
236 3300048929 Ga0496126_0023712 Ga0496126_0023712_1148_1807 219
237 3300049570 Ga0501033_0000524 Ga0501033_0000524_14074_14733 219
238 3300049586 Ga0501070_0630160 Ga0501070_0630160_54_734 219
239 3300050509 nmdc:mga0qj67_755485_c1 nmdc:mga0qj67_755485_c1_43_702 219
240 3300061734 Ga0530510_0004524 Ga0530510_0004524_1232_1891 219

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rbk-assembly1.cif.gz_A cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised 0.6986 10 175
5xvq-assembly2.cif.gz_B crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) 0.6906 146 177
7aeb-assembly1.cif.gz_N cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.684 9 179
6j0n-assembly1.cif.gz_b cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6816 12 177
6chh-assembly1.cif.gz_D structure of human nnmt in complex with bisubstrate inhibitor ms2756 0.6708 146 177
ID Description Score Start End Superfamily
af_I1JPT8_30_125_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7216 10 35 2.60.40.1120
1u8sB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7104 146 179 3.30.70.260
af_Q9AV31_37_132_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.6882 12 35 2.60.40.1120
af_A2ZPL3_44_135_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.6703 12 35 2.60.40.1120
5yjfD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6409 146 176 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3B1BHS8-F1-model_v4 Uncharacterized protein 0.9085 92 219
AF-A0A150RXT0-F1-model_v4 Uncharacterized protein 0.905 69 204
AF-A0A419A4L8-F1-model_v4 Uncharacterized protein 0.8983 11 219
AF-A0A3B1BHS8-F1-model_v4 Uncharacterized protein 0.8829 92 219
AF-A0A419A4L8-F1-model_v4 Uncharacterized protein 0.8737 11 219

Feature Viewer

pLDDT pTM Quality
83.9 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map