F352650
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 175 | 231 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100143555|Ga0070707_1001435553 |
| Length | 213 |
| Sequence | MTLSRRLLKGGLVLLDPKSGSPVRVLALQYNPDSLSRSFQIQATGGDGQSRSEALRLKGPPVETIKVEAEIDATDLLEAGDATASRIGIHAELAALETVIYPSSRQIRSNQSLAGSGTLEILPMEAPLTLFVWSMQRIVPVRITDLSVTEEAFDQNLNPIRAKVSIGMRVLSIDDLGFGHKGGEVFMTHLGRKEQLAAIRSSALATLGLESVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 2 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 3 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 4 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 5 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 6 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 7 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 8 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 154 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 155 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 156 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 157 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 158 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 169 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 173 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 174 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 175 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.42 |
| Metatranscriptomes | 0.83 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.17 |
| Nodule | 0 |
| Rhizoplane | 2.92 |
| Rhizosphere | 79.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10073776 | 3300003316 | Bacteria | 1114 |
| 2 | rootH2_10001362 | 3300003320 | Bacteria | 52723 |
| 3 | rootL2_10091718 | 3300003322 | Bacteria | 7564 |
| 4 | rootH1_10035420 | 3300003323 | Bacteria | 3231 |
| 5 | rootH1_10284792 | 3300003323 | Bacteria | 4158 |
| 6 | Ga0055525_1000207 | 3300003759 | Bacteria | 66980 |
| 7 | Ga0055527_1000108 | 3300003760 | Bacteria | 59457 |
| 8 | Ga0055535_1000646 | 3300003761 | Bacteria | 27765 |
| 9 | Ga0055542_1000223 | 3300003762 | Bacteria | 68138 |
| 10 | Ga0055542_1000447 | 3300003762 | Bacteria | 39214 |
| 11 | Ga0055529_1000603 | 3300003763 | Bacteria | 27759 |
| 12 | Ga0058861_11466948 | 3300004800 | Bacteria | 822 |
| 13 | Ga0065165_1007393 | 3300005262 | Bacteria | 5415 |
| 14 | Ga0065712_10025836 | 3300005290 | Bacteria | 1850 |
| 15 | Ga0070658_10000546 | 3300005327 | Bacteria | 32588 |
| 16 | Ga0070666_10000008 | 3300005335 | Bacteria | 293415 |
| 17 | Ga0070682_100010251 | 3300005337 | Bacteria | 5315 |
| 18 | Ga0070661_100230402 | 3300005344 | Bacteria | 1423 |
| 19 | Ga0070692_10099720 | 3300005345 | Bacteria | 1590 |
| 20 | Ga0070668_100152350 | 3300005347 | Bacteria | 1871 |
| 21 | Ga0070669_100154302 | 3300005353 | Bacteria | 1780 |
| 22 | Ga0070675_100068504 | 3300005354 | Bacteria | 2938 |
| 23 | Ga0070675_100836814 | 3300005354 | Bacteria | 842 |
| 24 | Ga0070671_100018684 | 3300005355 | Bacteria | 5633 |
| 25 | Ga0070671_100265264 | 3300005355 | Bacteria | 1460 |
| 26 | Ga0070688_100044291 | 3300005365 | Bacteria | 2745 |
| 27 | Ga0070688_100152973 | 3300005365 | Bacteria | 1578 |
| 28 | Ga0070659_100164428 | 3300005366 | Bacteria | 1815 |
| 29 | Ga0070667_100034232 | 3300005367 | Bacteria | 4249 |
| 30 | Ga0070714_100000073 | 3300005435 | Bacteria | 88847 |
| 31 | Ga0070711_100003614 | 3300005439 | Bacteria | 9028 |
| 32 | Ga0070694_100279338 | 3300005444 | Bacteria | 1272 |
| 33 | Ga0070708_100007847 | 3300005445 | Bacteria | 8548 |
| 34 | Ga0070663_100406453 | 3300005455 | Bacteria | 1114 |
| 35 | Ga0070663_100410637 | 3300005455 | Bacteria | 1109 |
| 36 | Ga0070678_100017162 | 3300005456 | Bacteria | 4653 |
| 37 | Ga0070678_100959440 | 3300005456 | Bacteria | 784 |
| 38 | Ga0070681_10544000 | 3300005458 | Bacteria | 1075 |
| 39 | Ga0068867_100256428 | 3300005459 | Bacteria | 1424 |
| 40 | Ga0068867_100311786 | 3300005459 | Bacteria | 1300 |
| 41 | Ga0068867_100617198 | 3300005459 | Bacteria | 948 |
| 42 | Ga0070706_100099406 | 3300005467 | Unclassified | 2703 |
| 43 | Ga0070707_100033740 | 3300005468 | Unclassified | 4880 |
| 44 | Ga0070707_100143555 | 3300005468 | Bacteria | 2323 |
| 45 | Ga0070698_100003316 | 3300005471 | Bacteria | 17711 |
| 46 | Ga0070698_100047475 | 3300005471 | Bacteria | 4389 |
| 47 | Ga0070698_100081406 | 3300005471 | Bacteria | 3232 |
| 48 | Ga0070699_100003159 | 3300005518 | Bacteria | 14581 |
| 49 | Ga0070699_100050294 | 3300005518 | Bacteria | 3608 |
| 50 | Ga0070679_100433402 | 3300005530 | Unclassified | 1260 |
| 51 | Ga0070684_100578638 | 3300005535 | Bacteria | 1043 |
| 52 | Ga0070697_100001997 | 3300005536 | Bacteria | 15627 |
| 53 | Ga0070665_100038793 | 3300005548 | Bacteria | 4788 |
| 54 | Ga0070665_100065612 | 3300005548 | Bacteria | 3641 |
| 55 | Ga0070665_100249400 | 3300005548 | Bacteria | 1776 |
| 56 | Ga0068855_100000148 | 3300005563 | Bacteria | 89300 |
| 57 | Ga0068855_100158589 | 3300005563 | Bacteria | 2569 |
| 58 | Ga0068855_100205763 | 3300005563 | Bacteria | 2214 |
| 59 | Ga0068855_100372367 | 3300005563 | Bacteria | 1570 |
| 60 | Ga0068857_100138531 | 3300005577 | Bacteria | 2198 |
| 61 | Ga0068854_100000527 | 3300005578 | Bacteria | 23195 |
| 62 | Ga0068854_100079334 | 3300005578 | Bacteria | 2420 |
| 63 | Ga0068859_100002758 | 3300005617 | Bacteria | 17812 |
| 64 | Ga0068859_100036099 | 3300005617 | Bacteria | 4961 |
| 65 | Ga0068859_100145673 | 3300005617 | Bacteria | 2443 |
| 66 | Ga0068864_100078458 | 3300005618 | Unclassified | 2890 |
| 67 | Ga0068864_100292750 | 3300005618 | Bacteria | 1522 |
| 68 | Ga0068866_10150710 | 3300005718 | Bacteria | 1346 |
| 69 | Ga0068851_10007226 | 3300005834 | Bacteria | 5091 |
| 70 | Ga0068870_10565590 | 3300005840 | Bacteria | 768 |
| 71 | Ga0068862_100000932 | 3300005844 | Bacteria | 28214 |
| 72 | Ga0068862_100017498 | 3300005844 | Bacteria | 5970 |
| 73 | Ga0068862_100019534 | 3300005844 | Bacteria | 5657 |
| 74 | Ga0070717_10019275 | 3300006028 | Bacteria | 5349 |
| 75 | Ga0075364_10070171 | 3300006051 | Unclassified | 2306 |
| 76 | Ga0075362_10013108 | 3300006177 | Bacteria | 3309 |
| 77 | Ga0075366_10103315 | 3300006195 | Unclassified | 1711 |
| 78 | Ga0097621_100038934 | 3300006237 | Bacteria | 3817 |
| 79 | Ga0097621_100160599 | 3300006237 | Bacteria | 1932 |
| 80 | Ga0068871_100055259 | 3300006358 | Unclassified | 3223 |
| 81 | Ga0068871_100716682 | 3300006358 | Bacteria | 917 |
| 82 | Ga0075431_100681557 | 3300006847 | Unclassified | 1006 |
| 83 | Ga0097620_100002758 | 3300006931 | Bacteria | 17812 |
| 84 | Ga0097620_100036099 | 3300006931 | Bacteria | 4961 |
| 85 | Ga0097620_100145657 | 3300006931 | Bacteria | 2443 |
| 86 | Ga0105240_10007036 | 3300009093 | Bacteria | 16414 |
| 87 | Ga0105240_10300398 | 3300009093 | Bacteria | 1837 |
| 88 | Ga0105245_10001450 | 3300009098 | Bacteria | 21466 |
| 89 | Ga0105241_10260853 | 3300009174 | Bacteria | 1473 |
| 90 | Ga0105248_10108658 | 3300009177 | Bacteria | 3127 |
| 91 | Ga0105248_10109716 | 3300009177 | Bacteria | 3111 |
| 92 | Ga0105248_10920113 | 3300009177 | Bacteria | 988 |
| 93 | Ga0105237_10143474 | 3300009545 | Bacteria | 2382 |
| 94 | Ga0105237_10435761 | 3300009545 | Bacteria | 1316 |
| 95 | Ga0105238_10000303 | 3300009551 | Bacteria | 53935 |
| 96 | Ga0105238_10008975 | 3300009551 | Bacteria | 10008 |
| 97 | Ga0105238_10016175 | 3300009551 | Bacteria | 7549 |
| 98 | Ga0105238_10129660 | 3300009551 | Bacteria | 2500 |
| 99 | Ga0105249_10181826 | 3300009553 | Bacteria | 2046 |
| 100 | Ga0105239_10181599 | 3300010375 | Unclassified | 2354 |
| 101 | Ga0105239_11141289 | 3300010375 | Bacteria | 897 |
| 102 | Ga0105246_10265785 | 3300011119 | Bacteria | 1369 |
| 103 | Ga0157370_10002744 | 3300013104 | Bacteria | 21055 |
| 104 | Ga0157370_10176111 | 3300013104 | Bacteria | 1988 |
| 105 | Ga0157370_10520127 | 3300013104 | Bacteria | 1092 |
| 106 | Ga0157378_10034918 | 3300013297 | Bacteria | 4445 |
| 107 | Ga0163162_10000900 | 3300013306 | Bacteria | 27686 |
| 108 | Ga0157372_10491416 | 3300013307 | Bacteria | 1431 |
| 109 | Ga0157375_10184426 | 3300013308 | Bacteria | 2239 |
| 110 | Ga0157375_10971449 | 3300013308 | Bacteria | 990 |
| 111 | Ga0157377_10386692 | 3300014745 | Bacteria | 949 |
| 112 | Ga0182007_10011682 | 3300015262 | Bacteria | 3411 |
| 113 | Ga0182007_10030681 | 3300015262 | Bacteria | 1835 |
| 114 | Ga0183369_1014 | 3300015685 | Bacteria | 194173 |
| 115 | Ga0163161_10147255 | 3300017792 | Bacteria | 1787 |
| 116 | Ga0206353_10125045 | 3300020082 | Bacteria | 2359 |
| 117 | Ga0209672_100103 | 3300025228 | Bacteria | 104244 |
| 118 | Ga0209563_100150 | 3300025230 | Bacteria | 65666 |
| 119 | Ga0207427_100768 | 3300025231 | Bacteria | 14614 |
| 120 | Ga0209437_100228 | 3300025233 | Bacteria | 98265 |
| 121 | Ga0209258_100232 | 3300025242 | Bacteria | 104244 |
| 122 | Ga0209258_102440 | 3300025242 | Bacteria | 4806 |
| 123 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 124 | Ga0209148_1000206 | 3300025254 | Bacteria | 104244 |
| 125 | Ga0209233_1021239 | 3300025261 | Bacteria | 1685 |
| 126 | Ga0209455_1000179 | 3300025272 | Bacteria | 104244 |
| 127 | Ga0209758_1013549 | 3300025297 | Bacteria | 4431 |
| 128 | Ga0207656_10003111 | 3300025321 | Bacteria | 5685 |
| 129 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 130 | Ga0207647_10033272 | 3300025904 | Bacteria | 3302 |
| 131 | Ga0207645_10139519 | 3300025907 | Bacteria | 1579 |
| 132 | Ga0207643_10456028 | 3300025908 | Bacteria | 814 |
| 133 | Ga0207705_10002958 | 3300025909 | Bacteria | 12985 |
| 134 | Ga0207705_10033543 | 3300025909 | Bacteria | 3668 |
| 135 | Ga0207684_10001890 | 3300025910 | Bacteria | 21792 |
| 136 | Ga0207707_10065850 | 3300025912 | Bacteria | 3155 |
| 137 | Ga0207695_10008974 | 3300025913 | Bacteria | 12443 |
| 138 | Ga0207671_10095289 | 3300025914 | Unclassified | 2247 |
| 139 | Ga0207671_10570810 | 3300025914 | Bacteria | 902 |
| 140 | Ga0207663_10071153 | 3300025916 | Bacteria | 2244 |
| 141 | Ga0207660_10295745 | 3300025917 | Bacteria | 1288 |
| 142 | Ga0207649_10053056 | 3300025920 | Bacteria | 2518 |
| 143 | Ga0207646_10004632 | 3300025922 | Bacteria | 14850 |
| 144 | Ga0207681_10157461 | 3300025923 | Bacteria | 1708 |
| 145 | Ga0207694_10000241 | 3300025924 | Bacteria | 52660 |
| 146 | Ga0207694_10018151 | 3300025924 | Bacteria | 5319 |
| 147 | Ga0207694_10306149 | 3300025924 | Bacteria | 1309 |
| 148 | Ga0207659_10384088 | 3300025926 | Bacteria | 1171 |
| 149 | Ga0207659_10509935 | 3300025926 | Bacteria | 1019 |
| 150 | Ga0207687_10014277 | 3300025927 | Bacteria | 5196 |
| 151 | Ga0207664_10000041 | 3300025929 | Bacteria | 154806 |
| 152 | Ga0207690_10125904 | 3300025932 | Bacteria | 1868 |
| 153 | Ga0207690_10247792 | 3300025932 | Bacteria | 1375 |
| 154 | Ga0207706_10020684 | 3300025933 | Bacteria | 5913 |
| 155 | Ga0207709_10021806 | 3300025935 | Bacteria | 3628 |
| 156 | Ga0207691_10062151 | 3300025940 | Bacteria | 3390 |
| 157 | Ga0207711_10110607 | 3300025941 | Bacteria | 2443 |
| 158 | Ga0207667_10000062 | 3300025949 | Bacteria | 190422 |
| 159 | Ga0207667_10081490 | 3300025949 | Bacteria | 3352 |
| 160 | Ga0207667_10193589 | 3300025949 | Bacteria | 2086 |
| 161 | Ga0207667_10396456 | 3300025949 | Bacteria | 1405 |
| 162 | Ga0207651_10387082 | 3300025960 | Bacteria | 1186 |
| 163 | Ga0207712_10197562 | 3300025961 | Bacteria | 1592 |
| 164 | Ga0207668_10309673 | 3300025972 | Bacteria | 1306 |
| 165 | Ga0207640_10000022 | 3300025981 | Bacteria | 167526 |
| 166 | Ga0207658_10034440 | 3300025986 | Bacteria | 3620 |
| 167 | Ga0207658_10053844 | 3300025986 | Bacteria | 2975 |
| 168 | Ga0207678_10448980 | 3300026067 | Bacteria | 1120 |
| 169 | Ga0207648_10244853 | 3300026089 | Bacteria | 1597 |
| 170 | Ga0207648_10415541 | 3300026089 | Bacteria | 1221 |
| 171 | Ga0207648_10805177 | 3300026089 | Bacteria | 875 |
| 172 | Ga0207674_10136959 | 3300026116 | Bacteria | 2410 |
| 173 | Ga0207675_100111251 | 3300026118 | Bacteria | 2584 |
| 174 | Ga0207683_10219747 | 3300026121 | Bacteria | 1731 |
| 175 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 176 | Ga0268266_10070486 | 3300028379 | Bacteria | 3029 |
| 177 | Ga0268266_10077910 | 3300028379 | Bacteria | 2883 |
| 178 | Ga0268266_10201062 | 3300028379 | Bacteria | 1824 |
| 179 | Ga0268265_10000351 | 3300028380 | Bacteria | 49884 |
| 180 | Ga0268265_10012206 | 3300028380 | Bacteria | 5820 |
| 181 | Ga0268265_10028037 | 3300028380 | Bacteria | 4028 |
| 182 | Ga0268264_10181013 | 3300028381 | Unclassified | 1914 |
| 183 | Ga0307408_100356401 | 3300031548 | Bacteria | 1243 |
| 184 | Ga0316576_10155979 | 3300031727 | Unclassified | 1721 |
| 185 | Ga0307510_10005119 | 3300033180 | Bacteria | 15579 |
| 186 | Ga0307510_10253363 | 3300033180 | Bacteria | 1246 |
| 187 | Ga0373935_0004610 | 3300035692 | Bacteria | 8101 |
| 188 | Ga0373925_0108502 | 3300037068 | Bacteria | 2142 |
| 189 | Ga0395899_0208278 | 3300037312 | Bacteria | 1360 |
| 190 | Ga0395899_0312670 | 3300037312 | Bacteria | 1060 |
| 191 | Ga0395900_0123116 | 3300037418 | Bacteria | 2660 |
| 192 | Ga0395901_0517103 | 3300038443 | Bacteria | 1213 |
| 193 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 194 | Ga0495650_0000150 | 3300046471 | Bacteria | 158574 |
| 195 | Ga0495639_0164916 | 3300046475 | Unclassified | 1074 |
| 196 | Ga0495606_0002023 | 3300046507 | Bacteria | 24906 |
| 197 | Ga0495663_0034352 | 3300046525 | Bacteria | 1518 |
| 198 | Ga0495625_0107489 | 3300046660 | Bacteria | 1909 |
| 199 | Ga0495671_0000124 | 3300046692 | Bacteria | 70221 |
| 200 | Ga0495680_0194822 | 3300047322 | Bacteria | 1456 |
| 201 | Ga0496101_0003417 | 3300048904 | Bacteria | 9902 |
| 202 | Ga0496108_0112473 | 3300048911 | Bacteria | 2329 |
| 203 | Ga0496109_0526685 | 3300048912 | Bacteria | 1115 |
| 204 | Ga0496112_0080167 | 3300048915 | Bacteria | 3228 |
| 205 | Ga0496113_0279353 | 3300048916 | Bacteria | 1335 |
| 206 | Ga0496115_0002963 | 3300048918 | Bacteria | 12207 |
| 207 | Ga0496115_0722684 | 3300048918 | Bacteria | 781 |
| 208 | Ga0496118_0000291 | 3300048921 | Bacteria | 87433 |
| 209 | Ga0496121_0025550 | 3300048924 | Bacteria | 5599 |
| 210 | Ga0496122_0077094 | 3300048925 | Bacteria | 2343 |
| 211 | Ga0496125_0056633 | 3300048928 | Bacteria | 3182 |
| 212 | Ga0496126_0023712 | 3300048929 | Bacteria | 5943 |
| 213 | Ga0501033_0000524 | 3300049570 | Bacteria | 35901 |
| 214 | Ga0501033_0194364 | 3300049570 | Bacteria | 1451 |
| 215 | Ga0501034_0059654 | 3300049571 | Bacteria | 3832 |
| 216 | Ga0501037_0044251 | 3300049573 | Bacteria | 3269 |
| 217 | Ga0501038_0638211 | 3300049574 | Bacteria | 803 |
| 218 | Ga0501041_0118268 | 3300049577 | Bacteria | 1646 |
| 219 | Ga0501070_0322272 | 3300049586 | Bacteria | 1257 |
| 220 | Ga0501070_0630160 | 3300049586 | Bacteria | 853 |
| 221 | Ga0501072_0014201 | 3300049588 | Bacteria | 6103 |
| 222 | Ga0501077_0133171 | 3300049593 | Bacteria | 1576 |
| 223 | Ga0501035_0019841 | 3300049822 | Bacteria | 6175 |
| 224 | Ga0501044_0161125 | 3300049823 | Bacteria | 2220 |
| 225 | nmdc:mga0yw44_332550_c1 | 3300050492 | Bacteria | 1021 |
| 226 | nmdc:mga09592_696982_c1 | 3300050508 | Bacteria | 864 |
| 227 | nmdc:mga0qj67_755485_c1 | 3300050509 | Bacteria | 771 |
| 228 | Ga0501084_0069903 | 3300054114 | Bacteria | 2940 |
| 229 | Ga0590071_000640 | 3300059421 | Bacteria | 9939 |
| 230 | Ga0590075_004826 | 3300059424 | Bacteria | 3187 |
| 231 | Ga0530510_0004524 | 3300061734 | Bacteria | 9625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0014201 | Ga0501072_0014201_3146_3754 | 178 |
| 2 | 3300050492 | nmdc:mga0yw44_332550_c1 | nmdc:mga0yw44_332550_c1_267_845 | 191 |
| 3 | 3300050508 | nmdc:mga09592_696982_c1 | nmdc:mga09592_696982_c1_260_847 | 195 |
| 4 | 3300059421 | Ga0590071_000640 | Ga0590071_000640_3536_4195 | 201 |
| 5 | 3300059424 | Ga0590075_004826 | Ga0590075_004826_839_1498 | 201 |
| 6 | 3300009098 | Ga0105245_10001450 | Ga0105245_1000145014 | 203 |
| 7 | 3300025927 | Ga0207687_10014277 | Ga0207687_100142776 | 203 |
| 8 | 3300025960 | Ga0207651_10387082 | Ga0207651_103870822 | 204 |
| 9 | 3300048918 | Ga0496115_0722684 | Ga0496115_0722684_27_656 | 208 |
| 10 | 3300031727 | Ga0316576_10155979 | Ga0316576_101559793 | 211 |
| 11 | 3300005468 | Ga0070707_100143555 | Ga0070707_1001435553 | 213 |
| 12 | 3300005471 | Ga0070698_100081406 | Ga0070698_1000814062 | 213 |
| 13 | 3300005518 | Ga0070699_100050294 | Ga0070699_1000502945 | 213 |
| 14 | 3300006051 | Ga0075364_10070171 | Ga0075364_100701714 | 213 |
| 15 | 3300006177 | Ga0075362_10013108 | Ga0075362_100131084 | 213 |
| 16 | 3300006195 | Ga0075366_10103315 | Ga0075366_101033152 | 213 |
| 17 | 3300031548 | Ga0307408_100356401 | Ga0307408_1003564011 | 214 |
| 18 | iso_pu_bacteria | 2734482264 | 2735836964 | 214 |
| 19 | iso_pu_bacteria | 2738543009 | 2739226409 | 214 |
| 20 | iso_pu_bacteria | 2739367700 | 2739731120 | 214 |
| 21 | iso_pu_bacteria | 2895395659 | 2895398984 | 214 |
| 22 | iso_pu_bacteria | 2906635258 | 2906637964 | 214 |
| 23 | iso_pu_bacteria | 2919450847 | 2919451452 | 214 |
| 24 | iso_pu_bacteria | 2939611941 | 2939615371 | 214 |
| 25 | iso_pu_bacteria | 8001845381 | 8001846300 | 214 |
| 26 | iso_pu_bacteria | 2928963466 | 2928967167 | 215 |
| 27 | 3300025912 | Ga0207707_10065850 | Ga0207707_100658502 | 216 |
| 28 | 3300004800 | Ga0058861_11466948 | Ga0058861_114669481 | 217 |
| 29 | 3300006847 | Ga0075431_100681557 | Ga0075431_1006815572 | 217 |
| 30 | 3300005337 | Ga0070682_100010251 | Ga0070682_1000102514 | 218 |
| 31 | 3300005344 | Ga0070661_100230402 | Ga0070661_1002304022 | 218 |
| 32 | 3300005345 | Ga0070692_10099720 | Ga0070692_100997202 | 218 |
| 33 | 3300005366 | Ga0070659_100164428 | Ga0070659_1001644282 | 218 |
| 34 | 3300005435 | Ga0070714_100000073 | Ga0070714_10000007361 | 218 |
| 35 | 3300005444 | Ga0070694_100279338 | Ga0070694_1002793382 | 218 |
| 36 | 3300005459 | Ga0068867_100311786 | Ga0068867_1003117862 | 218 |
| 37 | 3300005535 | Ga0070684_100578638 | Ga0070684_1005786382 | 218 |
| 38 | 3300005563 | Ga0068855_100158589 | Ga0068855_1001585892 | 218 |
| 39 | 3300005563 | Ga0068855_100205763 | Ga0068855_1002057631 | 218 |
| 40 | 3300005577 | Ga0068857_100138531 | Ga0068857_1001385312 | 218 |
| 41 | 3300009174 | Ga0105241_10260853 | Ga0105241_102608532 | 218 |
| 42 | 3300009177 | Ga0105248_10920113 | Ga0105248_109201132 | 218 |
| 43 | 3300009545 | Ga0105237_10435761 | Ga0105237_104357612 | 218 |
| 44 | 3300009551 | Ga0105238_10129660 | Ga0105238_101296603 | 218 |
| 45 | 3300010375 | Ga0105239_11141289 | Ga0105239_111412892 | 218 |
| 46 | 3300013104 | Ga0157370_10176111 | Ga0157370_101761112 | 218 |
| 47 | 3300013104 | Ga0157370_10520127 | Ga0157370_105201272 | 218 |
| 48 | 3300013307 | Ga0157372_10491416 | Ga0157372_104914162 | 218 |
| 49 | 3300015262 | Ga0182007_10011682 | Ga0182007_100116823 | 218 |
| 50 | 3300015262 | Ga0182007_10030681 | Ga0182007_100306813 | 218 |
| 51 | 3300017792 | Ga0163161_10147255 | Ga0163161_101472552 | 218 |
| 52 | 3300020082 | Ga0206353_10125045 | Ga0206353_101250452 | 218 |
| 53 | 3300025904 | Ga0207647_10033272 | Ga0207647_100332726 | 218 |
| 54 | 3300025909 | Ga0207705_10033543 | Ga0207705_100335431 | 218 |
| 55 | 3300025914 | Ga0207671_10570810 | Ga0207671_105708101 | 218 |
| 56 | 3300025920 | Ga0207649_10053056 | Ga0207649_100530563 | 218 |
| 57 | 3300025924 | Ga0207694_10306149 | Ga0207694_103061491 | 218 |
| 58 | 3300025929 | Ga0207664_10000041 | Ga0207664_10000041112 | 218 |
| 59 | 3300025932 | Ga0207690_10125904 | Ga0207690_101259042 | 218 |
| 60 | 3300025932 | Ga0207690_10247792 | Ga0207690_102477923 | 218 |
| 61 | 3300025933 | Ga0207706_10020684 | Ga0207706_100206847 | 218 |
| 62 | 3300025949 | Ga0207667_10081490 | Ga0207667_100814903 | 218 |
| 63 | 3300025949 | Ga0207667_10193589 | Ga0207667_101935892 | 218 |
| 64 | 3300025949 | Ga0207667_10396456 | Ga0207667_103964563 | 218 |
| 65 | 3300026089 | Ga0207648_10415541 | Ga0207648_104155412 | 218 |
| 66 | 3300026116 | Ga0207674_10136959 | Ga0207674_101369592 | 218 |
| 67 | 3300037312 | Ga0395899_0208278 | Ga0395899_0208278_552_1208 | 218 |
| 68 | 3300037418 | Ga0395900_0123116 | Ga0395900_0123116_1699_2355 | 218 |
| 69 | 3300038443 | Ga0395901_0517103 | Ga0395901_0517103_79_735 | 218 |
| 70 | 3300046475 | Ga0495639_0164916 | Ga0495639_0164916_137_793 | 218 |
| 71 | 3300048904 | Ga0496101_0003417 | Ga0496101_0003417_5364_6020 | 218 |
| 72 | 3300048918 | Ga0496115_0002963 | Ga0496115_0002963_862_1518 | 218 |
| 73 | 3300048925 | Ga0496122_0077094 | Ga0496122_0077094_313_969 | 218 |
| 74 | 3300049570 | Ga0501033_0194364 | Ga0501033_0194364_15_671 | 218 |
| 75 | 3300049571 | Ga0501034_0059654 | Ga0501034_0059654_1126_1782 | 218 |
| 76 | 3300049573 | Ga0501037_0044251 | Ga0501037_0044251_1942_2598 | 218 |
| 77 | 3300049574 | Ga0501038_0638211 | Ga0501038_0638211_20_676 | 218 |
| 78 | 3300049577 | Ga0501041_0118268 | Ga0501041_0118268_479_1135 | 218 |
| 79 | 3300049586 | Ga0501070_0322272 | Ga0501070_0322272_203_859 | 218 |
| 80 | 3300049593 | Ga0501077_0133171 | Ga0501077_0133171_394_1050 | 218 |
| 81 | 3300049822 | Ga0501035_0019841 | Ga0501035_0019841_5054_5710 | 218 |
| 82 | 3300049823 | Ga0501044_0161125 | Ga0501044_0161125_363_1019 | 218 |
| 83 | 3300054114 | Ga0501084_0069903 | Ga0501084_0069903_2210_2866 | 218 |
| 84 | 3300003316 | rootH1_10073776 | rootH1_100737762 | 219 |
| 85 | 3300003320 | rootH2_10001362 | rootH2_1000136228 | 219 |
| 86 | 3300003322 | rootL2_10091718 | rootL2_100917186 | 219 |
| 87 | 3300003323 | rootH1_10035420 | rootH1_100354203 | 219 |
| 88 | 3300003323 | rootH1_10284792 | rootH1_102847923 | 219 |
| 89 | 3300003759 | Ga0055525_1000207 | Ga0055525_100020729 | 219 |
| 90 | 3300003760 | Ga0055527_1000108 | Ga0055527_100010826 | 219 |
| 91 | 3300003761 | Ga0055535_1000646 | Ga0055535_100064617 | 219 |
| 92 | 3300003762 | Ga0055542_1000223 | Ga0055542_100022324 | 219 |
| 93 | 3300003762 | Ga0055542_1000447 | Ga0055542_100044714 | 219 |
| 94 | 3300003763 | Ga0055529_1000603 | Ga0055529_10006039 | 219 |
| 95 | 3300005262 | Ga0065165_1007393 | Ga0065165_10073936 | 219 |
| 96 | 3300005290 | Ga0065712_10025836 | Ga0065712_100258362 | 219 |
| 97 | 3300005327 | Ga0070658_10000546 | Ga0070658_100005468 | 219 |
| 98 | 3300005335 | Ga0070666_10000008 | Ga0070666_1000000811 | 219 |
| 99 | 3300005347 | Ga0070668_100152350 | Ga0070668_1001523502 | 219 |
| 100 | 3300005353 | Ga0070669_100154302 | Ga0070669_1001543022 | 219 |
| 101 | 3300005354 | Ga0070675_100068504 | Ga0070675_1000685044 | 219 |
| 102 | 3300005354 | Ga0070675_100836814 | Ga0070675_1008368141 | 219 |
| 103 | 3300005355 | Ga0070671_100018684 | Ga0070671_1000186843 | 219 |
| 104 | 3300005355 | Ga0070671_100265264 | Ga0070671_1002652643 | 219 |
| 105 | 3300005365 | Ga0070688_100044291 | Ga0070688_1000442912 | 219 |
| 106 | 3300005365 | Ga0070688_100152973 | Ga0070688_1001529733 | 219 |
| 107 | 3300005367 | Ga0070667_100034232 | Ga0070667_1000342323 | 219 |
| 108 | 3300005439 | Ga0070711_100003614 | Ga0070711_1000036144 | 219 |
| 109 | 3300005445 | Ga0070708_100007847 | Ga0070708_1000078478 | 219 |
| 110 | 3300005455 | Ga0070663_100406453 | Ga0070663_1004064532 | 219 |
| 111 | 3300005455 | Ga0070663_100410637 | Ga0070663_1004106372 | 219 |
| 112 | 3300005456 | Ga0070678_100017162 | Ga0070678_1000171623 | 219 |
| 113 | 3300005456 | Ga0070678_100959440 | Ga0070678_1009594401 | 219 |
| 114 | 3300005458 | Ga0070681_10544000 | Ga0070681_105440002 | 219 |
| 115 | 3300005459 | Ga0068867_100256428 | Ga0068867_1002564282 | 219 |
| 116 | 3300005459 | Ga0068867_100617198 | Ga0068867_1006171982 | 219 |
| 117 | 3300005467 | Ga0070706_100099406 | Ga0070706_1000994063 | 219 |
| 118 | 3300005468 | Ga0070707_100033740 | Ga0070707_1000337404 | 219 |
| 119 | 3300005471 | Ga0070698_100003316 | Ga0070698_1000033168 | 219 |
| 120 | 3300005471 | Ga0070698_100047475 | Ga0070698_1000474754 | 219 |
| 121 | 3300005518 | Ga0070699_100003159 | Ga0070699_10000315910 | 219 |
| 122 | 3300005530 | Ga0070679_100433402 | Ga0070679_1004334022 | 219 |
| 123 | 3300005536 | Ga0070697_100001997 | Ga0070697_10000199710 | 219 |
| 124 | 3300005548 | Ga0070665_100038793 | Ga0070665_1000387933 | 219 |
| 125 | 3300005548 | Ga0070665_100065612 | Ga0070665_1000656124 | 219 |
| 126 | 3300005548 | Ga0070665_100249400 | Ga0070665_1002494001 | 219 |
| 127 | 3300005563 | Ga0068855_100000148 | Ga0068855_10000014823 | 219 |
| 128 | 3300005563 | Ga0068855_100372367 | Ga0068855_1003723672 | 219 |
| 129 | 3300005578 | Ga0068854_100000527 | Ga0068854_1000005278 | 219 |
| 130 | 3300005578 | Ga0068854_100079334 | Ga0068854_1000793342 | 219 |
| 131 | 3300005617 | Ga0068859_100002758 | Ga0068859_10000275812 | 219 |
| 132 | 3300005617 | Ga0068859_100036099 | Ga0068859_1000360992 | 219 |
| 133 | 3300005617 | Ga0068859_100145673 | Ga0068859_1001456733 | 219 |
| 134 | 3300005618 | Ga0068864_100078458 | Ga0068864_1000784582 | 219 |
| 135 | 3300005618 | Ga0068864_100292750 | Ga0068864_1002927502 | 219 |
| 136 | 3300005718 | Ga0068866_10150710 | Ga0068866_101507103 | 219 |
| 137 | 3300005834 | Ga0068851_10007226 | Ga0068851_100072264 | 219 |
| 138 | 3300005840 | Ga0068870_10565590 | Ga0068870_105655901 | 219 |
| 139 | 3300005844 | Ga0068862_100000932 | Ga0068862_10000093215 | 219 |
| 140 | 3300005844 | Ga0068862_100017498 | Ga0068862_1000174984 | 219 |
| 141 | 3300005844 | Ga0068862_100019534 | Ga0068862_1000195342 | 219 |
| 142 | 3300006028 | Ga0070717_10019275 | Ga0070717_100192755 | 219 |
| 143 | 3300006237 | Ga0097621_100038934 | Ga0097621_1000389342 | 219 |
| 144 | 3300006237 | Ga0097621_100160599 | Ga0097621_1001605992 | 219 |
| 145 | 3300006358 | Ga0068871_100055259 | Ga0068871_1000552593 | 219 |
| 146 | 3300006358 | Ga0068871_100716682 | Ga0068871_1007166822 | 219 |
| 147 | 3300006931 | Ga0097620_100002758 | Ga0097620_10000275812 | 219 |
| 148 | 3300006931 | Ga0097620_100036099 | Ga0097620_1000360992 | 219 |
| 149 | 3300006931 | Ga0097620_100145657 | Ga0097620_1001456572 | 219 |
| 150 | 3300009093 | Ga0105240_10007036 | Ga0105240_100070369 | 219 |
| 151 | 3300009093 | Ga0105240_10300398 | Ga0105240_103003982 | 219 |
| 152 | 3300009177 | Ga0105248_10108658 | Ga0105248_101086584 | 219 |
| 153 | 3300009177 | Ga0105248_10109716 | Ga0105248_101097162 | 219 |
| 154 | 3300009545 | Ga0105237_10143474 | Ga0105237_101434744 | 219 |
| 155 | 3300009551 | Ga0105238_10000303 | Ga0105238_1000030327 | 219 |
| 156 | 3300009551 | Ga0105238_10008975 | Ga0105238_100089759 | 219 |
| 157 | 3300009551 | Ga0105238_10016175 | Ga0105238_100161755 | 219 |
| 158 | 3300009553 | Ga0105249_10181826 | Ga0105249_101818262 | 219 |
| 159 | 3300010375 | Ga0105239_10181599 | Ga0105239_101815992 | 219 |
| 160 | 3300011119 | Ga0105246_10265785 | Ga0105246_102657852 | 219 |
| 161 | 3300013104 | Ga0157370_10002744 | Ga0157370_100027449 | 219 |
| 162 | 3300013297 | Ga0157378_10034918 | Ga0157378_100349182 | 219 |
| 163 | 3300013306 | Ga0163162_10000900 | Ga0163162_1000090010 | 219 |
| 164 | 3300013308 | Ga0157375_10184426 | Ga0157375_101844262 | 219 |
| 165 | 3300013308 | Ga0157375_10971449 | Ga0157375_109714492 | 219 |
| 166 | 3300014745 | Ga0157377_10386692 | Ga0157377_103866922 | 219 |
| 167 | 3300015685 | Ga0183369_1014 | Ga0183369_101438 | 219 |
| 168 | 3300025228 | Ga0209672_100103 | Ga0209672_10010343 | 219 |
| 169 | 3300025230 | Ga0209563_100150 | Ga0209563_10015021 | 219 |
| 170 | 3300025231 | Ga0207427_100768 | Ga0207427_10076812 | 219 |
| 171 | 3300025233 | Ga0209437_100228 | Ga0209437_10022812 | 219 |
| 172 | 3300025242 | Ga0209258_100232 | Ga0209258_10023243 | 219 |
| 173 | 3300025242 | Ga0209258_102440 | Ga0209258_1024404 | 219 |
| 174 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005818 | 219 |
| 175 | 3300025254 | Ga0209148_1000206 | Ga0209148_100020643 | 219 |
| 176 | 3300025261 | Ga0209233_1021239 | Ga0209233_10212392 | 219 |
| 177 | 3300025272 | Ga0209455_1000179 | Ga0209455_100017943 | 219 |
| 178 | 3300025297 | Ga0209758_1013549 | Ga0209758_10135493 | 219 |
| 179 | 3300025321 | Ga0207656_10003111 | Ga0207656_100031114 | 219 |
| 180 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005224 | 219 |
| 181 | 3300025907 | Ga0207645_10139519 | Ga0207645_101395192 | 219 |
| 182 | 3300025908 | Ga0207643_10456028 | Ga0207643_104560281 | 219 |
| 183 | 3300025909 | Ga0207705_10002958 | Ga0207705_100029584 | 219 |
| 184 | 3300025910 | Ga0207684_10001890 | Ga0207684_1000189014 | 219 |
| 185 | 3300025913 | Ga0207695_10008974 | Ga0207695_100089747 | 219 |
| 186 | 3300025914 | Ga0207671_10095289 | Ga0207671_100952892 | 219 |
| 187 | 3300025916 | Ga0207663_10071153 | Ga0207663_100711532 | 219 |
| 188 | 3300025917 | Ga0207660_10295745 | Ga0207660_102957452 | 219 |
| 189 | 3300025922 | Ga0207646_10004632 | Ga0207646_100046324 | 219 |
| 190 | 3300025923 | Ga0207681_10157461 | Ga0207681_101574612 | 219 |
| 191 | 3300025924 | Ga0207694_10000241 | Ga0207694_1000024111 | 219 |
| 192 | 3300025924 | Ga0207694_10018151 | Ga0207694_100181513 | 219 |
| 193 | 3300025926 | Ga0207659_10384088 | Ga0207659_103840882 | 219 |
| 194 | 3300025926 | Ga0207659_10509935 | Ga0207659_105099352 | 219 |
| 195 | 3300025935 | Ga0207709_10021806 | Ga0207709_100218062 | 219 |
| 196 | 3300025940 | Ga0207691_10062151 | Ga0207691_100621512 | 219 |
| 197 | 3300025941 | Ga0207711_10110607 | Ga0207711_101106071 | 219 |
| 198 | 3300025949 | Ga0207667_10000062 | Ga0207667_1000006241 | 219 |
| 199 | 3300025961 | Ga0207712_10197562 | Ga0207712_101975622 | 219 |
| 200 | 3300025972 | Ga0207668_10309673 | Ga0207668_103096732 | 219 |
| 201 | 3300025981 | Ga0207640_10000022 | Ga0207640_1000002271 | 219 |
| 202 | 3300025986 | Ga0207658_10034440 | Ga0207658_100344404 | 219 |
| 203 | 3300025986 | Ga0207658_10053844 | Ga0207658_100538443 | 219 |
| 204 | 3300026067 | Ga0207678_10448980 | Ga0207678_104489802 | 219 |
| 205 | 3300026089 | Ga0207648_10244853 | Ga0207648_102448533 | 219 |
| 206 | 3300026089 | Ga0207648_10805177 | Ga0207648_108051771 | 219 |
| 207 | 3300026118 | Ga0207675_100111251 | Ga0207675_1001112512 | 219 |
| 208 | 3300026121 | Ga0207683_10219747 | Ga0207683_102197472 | 219 |
| 209 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041302 | 219 |
| 210 | 3300028379 | Ga0268266_10070486 | Ga0268266_100704861 | 219 |
| 211 | 3300028379 | Ga0268266_10077910 | Ga0268266_100779104 | 219 |
| 212 | 3300028379 | Ga0268266_10201062 | Ga0268266_102010623 | 219 |
| 213 | 3300028380 | Ga0268265_10000351 | Ga0268265_100003519 | 219 |
| 214 | 3300028380 | Ga0268265_10012206 | Ga0268265_100122062 | 219 |
| 215 | 3300028380 | Ga0268265_10028037 | Ga0268265_100280375 | 219 |
| 216 | 3300028381 | Ga0268264_10181013 | Ga0268264_101810133 | 219 |
| 217 | 3300033180 | Ga0307510_10005119 | Ga0307510_100051194 | 219 |
| 218 | 3300033180 | Ga0307510_10253363 | Ga0307510_102533632 | 219 |
| 219 | 3300035692 | Ga0373935_0004610 | Ga0373935_0004610_3732_4391 | 219 |
| 220 | 3300037068 | Ga0373925_0108502 | Ga0373925_0108502_1079_1738 | 219 |
| 221 | 3300037312 | Ga0395899_0312670 | Ga0395899_0312670_284_943 | 219 |
| 222 | 3300046471 | Ga0495650_0000027 | Ga0495650_0000027_10874_11533 | 219 |
| 223 | 3300046471 | Ga0495650_0000150 | Ga0495650_0000150_29041_29700 | 219 |
| 224 | 3300046507 | Ga0495606_0002023 | Ga0495606_0002023_21456_22118 | 219 |
| 225 | 3300046525 | Ga0495663_0034352 | Ga0495663_0034352_682_1341 | 219 |
| 226 | 3300046660 | Ga0495625_0107489 | Ga0495625_0107489_1185_1844 | 219 |
| 227 | 3300046692 | Ga0495671_0000124 | Ga0495671_0000124_55768_56427 | 219 |
| 228 | 3300047322 | Ga0495680_0194822 | Ga0495680_0194822_343_1002 | 219 |
| 229 | 3300048911 | Ga0496108_0112473 | Ga0496108_0112473_22_723 | 219 |
| 230 | 3300048912 | Ga0496109_0526685 | Ga0496109_0526685_355_1014 | 219 |
| 231 | 3300048915 | Ga0496112_0080167 | Ga0496112_0080167_2184_2885 | 219 |
| 232 | 3300048916 | Ga0496113_0279353 | Ga0496113_0279353_404_1105 | 219 |
| 233 | 3300048921 | Ga0496118_0000291 | Ga0496118_0000291_43104_43769 | 219 |
| 234 | 3300048924 | Ga0496121_0025550 | Ga0496121_0025550_3511_4170 | 219 |
| 235 | 3300048928 | Ga0496125_0056633 | Ga0496125_0056633_1866_2525 | 219 |
| 236 | 3300048929 | Ga0496126_0023712 | Ga0496126_0023712_1148_1807 | 219 |
| 237 | 3300049570 | Ga0501033_0000524 | Ga0501033_0000524_14074_14733 | 219 |
| 238 | 3300049586 | Ga0501070_0630160 | Ga0501070_0630160_54_734 | 219 |
| 239 | 3300050509 | nmdc:mga0qj67_755485_c1 | nmdc:mga0qj67_755485_c1_43_702 | 219 |
| 240 | 3300061734 | Ga0530510_0004524 | Ga0530510_0004524_1232_1891 | 219 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rbk-assembly1.cif.gz_A | cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised | 0.6986 | 10 | 175 |
| 5xvq-assembly2.cif.gz_B | crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) | 0.6906 | 146 | 177 |
| 7aeb-assembly1.cif.gz_N | cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. | 0.684 | 9 | 179 |
| 6j0n-assembly1.cif.gz_b | cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry | 0.6816 | 12 | 177 |
| 6chh-assembly1.cif.gz_D | structure of human nnmt in complex with bisubstrate inhibitor ms2756 | 0.6708 | 146 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JPT8_30_125_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.7216 | 10 | 35 | 2.60.40.1120 |
| 1u8sB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.7104 | 146 | 179 | 3.30.70.260 |
| af_Q9AV31_37_132_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.6882 | 12 | 35 | 2.60.40.1120 |
| af_A2ZPL3_44_135_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.6703 | 12 | 35 | 2.60.40.1120 |
| 5yjfD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6409 | 146 | 176 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B1BHS8-F1-model_v4 | Uncharacterized protein | 0.9085 | 92 | 219 |
|
| AF-A0A150RXT0-F1-model_v4 | Uncharacterized protein | 0.905 | 69 | 204 |
|
| AF-A0A419A4L8-F1-model_v4 | Uncharacterized protein | 0.8983 | 11 | 219 |
|
| AF-A0A3B1BHS8-F1-model_v4 | Uncharacterized protein | 0.8829 | 92 | 219 |
|
| AF-A0A419A4L8-F1-model_v4 | Uncharacterized protein | 0.8737 | 11 | 219 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar