F352671

General Info

Members Datasets Scaffolds Average Seq Length
240 154 480 140

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100265465|Ga0068853_1002654652
Length 170
Sequence MKGPSQKQTASSFFDSQANSNFDITKLNHMQQWIFYALASALFAALTAIFAKLGLKDINSDLATAIRTAIILVITWAIVLFKGNPGVMISSLNRNNWLFLVLSAVATGLSWLFYYRALQLGKAGEVAVIDKGSLVFTILLAFVFLKEPLTPRLLLGGGLVAAGMLISIWK

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
143 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 0.42
Rhizosphere 88.33
Stem 0
Stem Tuber 0
Unclassified 20.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100265465 3300005539 Unclassified 1579
2 JGI25157J39369_1015235 3300002741 Bacteria 948
3 rootH2_10032886 3300003320 Bacteria 16021
4 rootH2_10273152 3300003320 Unclassified 1489
5 rootL2_10217896 3300003322 Bacteria 7005
6 rootH1_10237897 3300003323 Bacteria 4606
7 Ga0070658_10051522 3300005327 Unclassified 3336
8 Ga0070683_100003553 3300005329 Bacteria 12684
9 Ga0070670_100011274 3300005331 Bacteria 7644
10 Ga0070670_100378890 3300005331 Bacteria 1246
11 Ga0070670_100471117 3300005331 Unclassified 1114
12 Ga0070677_10589769 3300005333 Bacteria 614
13 Ga0070666_10080433 3300005335 Unclassified 2227
14 Ga0070666_10156223 3300005335 Bacteria 1593
15 Ga0068868_100004947 3300005338 Bacteria 9361
16 Ga0068868_100270190 3300005338 Unclassified 1436
17 Ga0068868_100580032 3300005338 Bacteria 991
18 Ga0070687_101255953 3300005343 Bacteria 548
19 Ga0070668_100461081 3300005347 Bacteria 1094
20 Ga0070669_100446576 3300005353 Bacteria 1065
21 Ga0070675_100886882 3300005354 Bacteria 817
22 Ga0070671_100007520 3300005355 Bacteria 8711
23 Ga0070671_100041092 3300005355 Bacteria 3842
24 Ga0070673_100237493 3300005364 Bacteria 1583
25 Ga0070673_100965215 3300005364 Bacteria 792
26 Ga0070667_100003422 3300005367 Bacteria 13516
27 Ga0070667_100009816 3300005367 Bacteria 7935
28 Ga0070667_100184593 3300005367 Bacteria 1846
29 Ga0070667_100700248 3300005367 Bacteria 937
30 Ga0070700_100310673 3300005441 Bacteria 1154
31 Ga0070678_100073826 3300005456 Unclassified 2561
32 Ga0070662_100653002 3300005457 Unclassified 887
33 Ga0070681_11272041 3300005458 Bacteria 658
34 Ga0070685_10238582 3300005466 Bacteria 1199
35 Ga0070679_100014389 3300005530 Bacteria 7599
36 Ga0068853_100271653 3300005539 Unclassified 1561
37 Ga0070695_100752748 3300005545 Bacteria 777
38 Ga0070665_100000001 3300005548 Bacteria 1083363
39 Ga0070704_100000905 3300005549 Bacteria 14870
40 Ga0068855_100026635 3300005563 Bacteria 6918
41 Ga0068855_100099918 3300005563 Bacteria 3341
42 Ga0068855_100875876 3300005563 Bacteria 950
43 Ga0070664_100182256 3300005564 Bacteria 1867
44 Ga0068857_100005433 3300005577 Bacteria 10865
45 Ga0068854_100026843 3300005578 Bacteria 3962
46 Ga0068854_100089714 3300005578 Bacteria 2285
47 Ga0068856_100199585 3300005614 Bacteria 2015
48 Ga0068852_100000242 3300005616 Bacteria 37066
49 Ga0068859_100041345 3300005617 Bacteria 4630
50 Ga0068859_102607867 3300005617 Unclassified 556
51 Ga0068861_101208330 3300005719 Unclassified 731
52 Ga0068851_10036681 3300005834 Bacteria 2455
53 Ga0068851_10157092 3300005834 Unclassified 1247
54 Ga0068863_100024423 3300005841 Bacteria 5764
55 Ga0068863_100036330 3300005841 Bacteria 4693
56 Ga0068860_100000097 3300005843 Bacteria 146573
57 Ga0068860_100001074 3300005843 Bacteria 30126
58 Ga0068860_100021795 3300005843 Bacteria 6198
59 Ga0068860_100045674 3300005843 Bacteria 4177
60 Ga0068860_100559680 3300005843 Bacteria 1146
61 Ga0070717_10026277 3300006028 Bacteria 4643
62 Ga0070717_10557234 3300006028 Unclassified 1038
63 Ga0075366_10238740 3300006195 Bacteria 1108
64 Ga0097621_100000459 3300006237 Bacteria 28552
65 Ga0097621_100070084 3300006237 Bacteria 2895
66 Ga0097621_100519022 3300006237 Unclassified 1081
67 Ga0097621_100526908 3300006237 Bacteria 1073
68 Ga0068871_100000069 3300006358 Bacteria 57310
69 Ga0068871_100136844 3300006358 Bacteria 2081
70 Ga0068871_100521348 3300006358 Bacteria 1073
71 Ga0068871_101695323 3300006358 Bacteria 599
72 Ga0068865_100185454 3300006881 Unclassified 1605
73 Ga0075436_100010009 3300006914 Bacteria 6486
74 Ga0097620_100041347 3300006931 Bacteria 4630
75 Ga0097620_102606758 3300006931 Unclassified 556
76 Ga0105240_10000754 3300009093 Bacteria 59023
77 Ga0105240_10003320 3300009093 Bacteria 25129
78 Ga0105240_10055243 3300009093 Bacteria 4972
79 Ga0105240_10089051 3300009093 Bacteria 3775
80 Ga0105240_10251705 3300009093 Bacteria 2043
81 Ga0105247_10229866 3300009101 Unclassified 1259
82 Ga0105241_10240230 3300009174 Bacteria 1531
83 Ga0105242_10256458 3300009176 Unclassified 1578
84 Ga0105248_10072537 3300009177 Unclassified 3870
85 Ga0105248_10696274 3300009177 Unclassified 1146
86 Ga0105237_10004900 3300009545 Bacteria 15325
87 Ga0105237_10006840 3300009545 Bacteria 12569
88 Ga0105237_10010562 3300009545 Bacteria 9813
89 Ga0105237_10030014 3300009545 Bacteria 5523
90 Ga0105238_10057503 3300009551 Bacteria 3899
91 Ga0105238_10161256 3300009551 Bacteria 2218
92 Ga0105238_10239520 3300009551 Bacteria 1792
93 Ga0105238_11196430 3300009551 Unclassified 784
94 Ga0105239_10000529 3300010375 Bacteria 55233
95 Ga0105239_10000905 3300010375 Bacteria 42180
96 Ga0105239_10149394 3300010375 Bacteria 2607
97 Ga0105239_10181668 3300010375 Unclassified 2354
98 Ga0105246_10772998 3300011119 Bacteria 849
99 Ga0157373_10000031 3300013100 Bacteria 126446
100 Ga0157370_10002239 3300013104 Bacteria 23528
101 Ga0157370_10607666 3300013104 Bacteria 1001
102 Ga0157369_10048327 3300013105 Bacteria 4617
103 Ga0157374_10000001 3300013296 Bacteria 1077351
104 Ga0157374_10316036 3300013296 Bacteria 1547
105 Ga0157374_11081799 3300013296 Bacteria 822
106 Ga0157378_10005780 3300013297 Bacteria 10840
107 Ga0157378_10025262 3300013297 Bacteria 5232
108 Ga0157378_10919646 3300013297 Bacteria 906
109 Ga0163162_10000328 3300013306 Bacteria 43763
110 Ga0163162_10000350 3300013306 Bacteria 41929
111 Ga0163162_10002130 3300013306 Bacteria 18568
112 Ga0163162_10210479 3300013306 Bacteria 2074
113 Ga0163162_12160313 3300013306 Bacteria 639
114 Ga0157372_10001004 3300013307 Bacteria 30814
115 Ga0157372_10003947 3300013307 Bacteria 15925
116 Ga0157372_10010028 3300013307 Bacteria 10074
117 Ga0157375_10000517 3300013308 Bacteria 34801
118 Ga0157375_10023556 3300013308 Bacteria 5683
119 Ga0163163_10038794 3300014325 Bacteria 4644
120 Ga0157379_10007255 3300014968 Bacteria 9591
121 Ga0157379_10137226 3300014968 Bacteria 2204
122 Ga0157379_10444177 3300014968 Bacteria 1196
123 Ga0157376_10000989 3300014969 Bacteria 18526
124 Ga0157376_10001292 3300014969 Bacteria 16487
125 Ga0163161_10009099 3300017792 Bacteria 6865
126 Ga0207647_10007852 3300025904 Bacteria 7675
127 Ga0207647_10127744 3300025904 Bacteria 1495
128 Ga0207695_10001197 3300025913 Bacteria 44626
129 Ga0207695_10047145 3300025913 Bacteria 4563
130 Ga0207695_10081744 3300025913 Bacteria 3268
131 Ga0207695_10365609 3300025913 Bacteria 1329
132 Ga0207671_10003348 3300025914 Bacteria 16085
133 Ga0207671_10004160 3300025914 Bacteria 13983
134 Ga0207671_10034158 3300025914 Bacteria 3780
135 Ga0207671_10413490 3300025914 Bacteria 1073
136 Ga0207671_11486304 3300025914 Bacteria 523
137 Ga0207662_10189580 3300025918 Bacteria 1326
138 Ga0207681_10392675 3300025923 Bacteria 1119
139 Ga0207694_10036328 3300025924 Bacteria 3781
140 Ga0207694_10495367 3300025924 Bacteria 1023
141 Ga0207650_10071436 3300025925 Bacteria 2611
142 Ga0207650_10072908 3300025925 Unclassified 2585
143 Ga0207659_10085202 3300025926 Bacteria 2347
144 Ga0207644_10004886 3300025931 Bacteria 8733
145 Ga0207706_10786276 3300025933 Unclassified 809
146 Ga0207669_11474479 3300025937 Bacteria 580
147 Ga0207704_10136733 3300025938 Unclassified 1707
148 Ga0207711_10127108 3300025941 Unclassified 2282
149 Ga0207661_10004099 3300025944 Bacteria 10186
150 Ga0207667_10001051 3300025949 Bacteria 35135
151 Ga0207667_10022381 3300025949 Bacteria 6985
152 Ga0207667_10840746 3300025949 Bacteria 913
153 Ga0207651_10361315 3300025960 Bacteria 1225
154 Ga0207668_10191002 3300025972 Bacteria 1623
155 Ga0207640_10041758 3300025981 Unclassified 2919
156 Ga0207640_10138058 3300025981 Bacteria 1773
157 Ga0207658_10022413 3300025986 Unclassified 4397
158 Ga0207658_10549659 3300025986 Bacteria 1033
159 Ga0207677_10030511 3300026023 Bacteria 3442
160 Ga0207677_10305595 3300026023 Unclassified 1316
161 Ga0207703_10215575 3300026035 Bacteria 1714
162 Ga0207639_10646829 3300026041 Bacteria 978
163 Ga0207708_10512464 3300026075 Bacteria 1007
164 Ga0207702_10779236 3300026078 Unclassified 945
165 Ga0207641_10078993 3300026088 Bacteria 2851
166 Ga0207648_10145765 3300026089 Unclassified 2088
167 Ga0207676_10549870 3300026095 Unclassified 1103
168 Ga0207676_10903332 3300026095 Bacteria 866
169 Ga0207674_10018113 3300026116 Bacteria 7663
170 Ga0207683_10187783 3300026121 Unclassified 1875
171 Ga0207698_10001352 3300026142 Bacteria 14283
172 Ga0268266_10000038 3300028379 Bacteria 325729
173 Ga0268264_10000167 3300028381 Bacteria 146190
174 Ga0268264_10003753 3300028381 Bacteria 13045
175 Ga0268264_10087578 3300028381 Bacteria 2678
176 Ga0265326_10080831 3300028558 Bacteria 919
177 Ga0307517_10016904 3300028786 Bacteria 9554
178 Ga0307515_10005958 3300028794 Bacteria 24553
179 Ga0307511_10004160 3300030521 Bacteria 14774
180 Ga0265327_10020596 3300031251 Bacteria 4010
181 Ga0265316_10023932 3300031344 Bacteria 5129
182 Ga0307513_10628293 3300031456 Unclassified 782
183 Ga0307509_10064366 3300031507 Bacteria 3857
184 Ga0307408_100046233 3300031548 Bacteria 3113
185 Ga0307508_10001003 3300031616 Bacteria 32817
186 Ga0307516_10012855 3300031730 Bacteria 8983
187 Ga0307516_10028519 3300031730 Bacteria 5648
188 Ga0307406_10074836 3300031901 Bacteria 2232
189 Ga0307409_100685153 3300031995 Bacteria 1023
190 Ga0373923_0055675 3300035111 Bacteria 1668
191 Ga0373954_0226836 3300035118 Unclassified 919
192 Ga0373955_0027492 3300035172 Bacteria 2942
193 Ga0373955_0090523 3300035172 Bacteria 1743
194 Ga0373935_0107918 3300035692 Unclassified 1844
195 Ga0373927_0062387 3300035695 Bacteria 2410
196 Ga0373937_0016939 3300036401 Bacteria 6480
197 Ga0373937_0686650 3300036401 Bacteria 970
198 Ga0373937_1384422 3300036401 Bacteria 651
199 Ga0436364_0047364 3300037853 Unclassified 748
200 Ga0436364_0445685 3300037853 Bacteria 13579
201 Ga0436364_0825978 3300037853 Unclassified 1354
202 Ga0466961_0017072 3300044693 Bacteria 4662
203 Ga0453684_0338418 3300044712 Bacteria 1700
204 Ga0453684_1871705 3300044712 Bacteria 608
205 Ga0466971_0234346 3300044719 Unclassified 872
206 Ga0466968_0348188 3300044735 Unclassified 719
207 Ga0466970_0047302 3300044765 Bacteria 2292
208 Ga0466959_0015232 3300045049 Bacteria 5600
209 Ga0451576_0551755 3300045051 Bacteria 1211
210 Ga0495638_0035566 3300046460 Bacteria 3175
211 Ga0495651_0943966 3300046462 Bacteria 526
212 Ga0495580_0556317 3300046472 Unclassified 761
213 Ga0495648_0006312 3300046524 Bacteria 9695
214 Ga0495640_0856500 3300046533 Unclassified 540
215 Ga0495587_0120281 3300046536 Bacteria 1505
216 Ga0495611_0042446 3300046648 Unclassified 2031
217 Ga0495613_0220710 3300046689 Unclassified 1331
218 Ga0495687_000001 3300047443 Bacteria 1215582
219 Ga0495684_0082607 3300047471 Unclassified 2437
220 Ga0496101_0192722 3300048904 Unclassified 1573
221 Ga0496126_0545594 3300048929 Bacteria 921
222 Ga0501298_027306 3300049521 Bacteria 1103
223 Ga0501038_1084323 3300049574 Unclassified 585
224 Ga0501046_0000068 3300049580 Bacteria 113679
225 Ga0501047_0277874 3300049581 Bacteria 1520
226 Ga0501047_0429967 3300049581 Bacteria 1151
227 Ga0501202_032254 3300049652 Bacteria 1099
228 Ga0501279_020990 3300049775 Bacteria 931
229 nmdc:mga0k408_404389_c1 3300050493 Bacteria 812
230 nmdc:mga08x19_22284_c1 3300050514 Bacteria 3922
231 Ga0500578_0384384 3300053086 Unclassified 813
232 Ga0500583_0001741 3300053092 Bacteria 6368
233 Ga0500642_0000875 3300053130 Bacteria 8753
234 Ga0500658_0340500 3300053134 Bacteria 689
235 Ga0500616_0000008 3300053153 Bacteria 785239
236 Ga0500622_0004273 3300053156 Bacteria 9059
237 Ga0500637_0124737 3300053178 Bacteria 1494
238 Ga0500637_0145990 3300053178 Unclassified 1368
239 Ga0501084_1856807 3300054114 Bacteria 503
240 Ga0466962_0097331 3300061719 Unclassified 1412
241 Ga0068853_100265465
242 JGI25157J39369_1015235
243 rootH2_10032886
244 rootH2_10273152
245 rootL2_10217896
246 rootH1_10237897
247 Ga0070658_10051522
248 Ga0070683_100003553
249 Ga0070670_100011274
250 Ga0070670_100378890
251 Ga0070670_100471117
252 Ga0070677_10589769
253 Ga0070666_10080433
254 Ga0070666_10156223
255 Ga0068868_100004947
256 Ga0068868_100270190
257 Ga0068868_100580032
258 Ga0070687_101255953
259 Ga0070668_100461081
260 Ga0070669_100446576
261 Ga0070675_100886882
262 Ga0070671_100007520
263 Ga0070671_100041092
264 Ga0070673_100237493
265 Ga0070673_100965215
266 Ga0070667_100003422
267 Ga0070667_100009816
268 Ga0070667_100184593
269 Ga0070667_100700248
270 Ga0070700_100310673
271 Ga0070678_100073826
272 Ga0070662_100653002
273 Ga0070681_11272041
274 Ga0070685_10238582
275 Ga0070679_100014389
276 Ga0068853_100271653
277 Ga0070695_100752748
278 Ga0070665_100000001
279 Ga0070704_100000905
280 Ga0068855_100026635
281 Ga0068855_100099918
282 Ga0068855_100875876
283 Ga0070664_100182256
284 Ga0068857_100005433
285 Ga0068854_100026843
286 Ga0068854_100089714
287 Ga0068856_100199585
288 Ga0068852_100000242
289 Ga0068859_100041345
290 Ga0068859_102607867
291 Ga0068861_101208330
292 Ga0068851_10036681
293 Ga0068851_10157092
294 Ga0068863_100024423
295 Ga0068863_100036330
296 Ga0068860_100000097
297 Ga0068860_100001074
298 Ga0068860_100021795
299 Ga0068860_100045674
300 Ga0068860_100559680
301 Ga0070717_10026277
302 Ga0070717_10557234
303 Ga0075366_10238740
304 Ga0097621_100000459
305 Ga0097621_100070084
306 Ga0097621_100519022
307 Ga0097621_100526908
308 Ga0068871_100000069
309 Ga0068871_100136844
310 Ga0068871_100521348
311 Ga0068871_101695323
312 Ga0068865_100185454
313 Ga0075436_100010009
314 Ga0097620_100041347
315 Ga0097620_102606758
316 Ga0105240_10000754
317 Ga0105240_10003320
318 Ga0105240_10055243
319 Ga0105240_10089051
320 Ga0105240_10251705
321 Ga0105247_10229866
322 Ga0105241_10240230
323 Ga0105242_10256458
324 Ga0105248_10072537
325 Ga0105248_10696274
326 Ga0105237_10004900
327 Ga0105237_10006840
328 Ga0105237_10010562
329 Ga0105237_10030014
330 Ga0105238_10057503
331 Ga0105238_10161256
332 Ga0105238_10239520
333 Ga0105238_11196430
334 Ga0105239_10000529
335 Ga0105239_10000905
336 Ga0105239_10149394
337 Ga0105239_10181668
338 Ga0105246_10772998
339 Ga0157373_10000031
340 Ga0157370_10002239
341 Ga0157370_10607666
342 Ga0157369_10048327
343 Ga0157374_10000001
344 Ga0157374_10316036
345 Ga0157374_11081799
346 Ga0157378_10005780
347 Ga0157378_10025262
348 Ga0157378_10919646
349 Ga0163162_10000328
350 Ga0163162_10000350
351 Ga0163162_10002130
352 Ga0163162_10210479
353 Ga0163162_12160313
354 Ga0157372_10001004
355 Ga0157372_10003947
356 Ga0157372_10010028
357 Ga0157375_10000517
358 Ga0157375_10023556
359 Ga0163163_10038794
360 Ga0157379_10007255
361 Ga0157379_10137226
362 Ga0157379_10444177
363 Ga0157376_10000989
364 Ga0157376_10001292
365 Ga0163161_10009099
366 Ga0207647_10007852
367 Ga0207647_10127744
368 Ga0207695_10001197
369 Ga0207695_10047145
370 Ga0207695_10081744
371 Ga0207695_10365609
372 Ga0207671_10003348
373 Ga0207671_10004160
374 Ga0207671_10034158
375 Ga0207671_10413490
376 Ga0207671_11486304
377 Ga0207662_10189580
378 Ga0207681_10392675
379 Ga0207694_10036328
380 Ga0207694_10495367
381 Ga0207650_10071436
382 Ga0207650_10072908
383 Ga0207659_10085202
384 Ga0207644_10004886
385 Ga0207706_10786276
386 Ga0207669_11474479
387 Ga0207704_10136733
388 Ga0207711_10127108
389 Ga0207661_10004099
390 Ga0207667_10001051
391 Ga0207667_10022381
392 Ga0207667_10840746
393 Ga0207651_10361315
394 Ga0207668_10191002
395 Ga0207640_10041758
396 Ga0207640_10138058
397 Ga0207658_10022413
398 Ga0207658_10549659
399 Ga0207677_10030511
400 Ga0207677_10305595
401 Ga0207703_10215575
402 Ga0207639_10646829
403 Ga0207708_10512464
404 Ga0207702_10779236
405 Ga0207641_10078993
406 Ga0207648_10145765
407 Ga0207676_10549870
408 Ga0207676_10903332
409 Ga0207674_10018113
410 Ga0207683_10187783
411 Ga0207698_10001352
412 Ga0268266_10000038
413 Ga0268264_10000167
414 Ga0268264_10003753
415 Ga0268264_10087578
416 Ga0265326_10080831
417 Ga0307517_10016904
418 Ga0307515_10005958
419 Ga0307511_10004160
420 Ga0265327_10020596
421 Ga0265316_10023932
422 Ga0307513_10628293
423 Ga0307509_10064366
424 Ga0307408_100046233
425 Ga0307508_10001003
426 Ga0307516_10012855
427 Ga0307516_10028519
428 Ga0307406_10074836
429 Ga0307409_100685153
430 Ga0373923_0055675
431 Ga0373954_0226836
432 Ga0373955_0027492
433 Ga0373955_0090523
434 Ga0373935_0107918
435 Ga0373927_0062387
436 Ga0373937_0016939
437 Ga0373937_0686650
438 Ga0373937_1384422
439 Ga0436364_0047364
440 Ga0436364_0445685
441 Ga0436364_0825978
442 Ga0466961_0017072
443 Ga0453684_0338418
444 Ga0453684_1871705
445 Ga0466971_0234346
446 Ga0466968_0348188
447 Ga0466970_0047302
448 Ga0466959_0015232
449 Ga0451576_0551755
450 Ga0495638_0035566
451 Ga0495651_0943966
452 Ga0495580_0556317
453 Ga0495648_0006312
454 Ga0495640_0856500
455 Ga0495587_0120281
456 Ga0495611_0042446
457 Ga0495613_0220710
458 Ga0495687_000001
459 Ga0495684_0082607
460 Ga0496101_0192722
461 Ga0496126_0545594
462 Ga0501298_027306
463 Ga0501038_1084323
464 Ga0501046_0000068
465 Ga0501047_0277874
466 Ga0501047_0429967
467 Ga0501202_032254
468 Ga0501279_020990
469 nmdc:mga0k408_404389_c1
470 nmdc:mga08x19_22284_c1
471 Ga0500578_0384384
472 Ga0500583_0001741
473 Ga0500642_0000875
474 Ga0500658_0340500
475 Ga0500616_0000008
476 Ga0500622_0004273
477 Ga0500637_0124737
478 Ga0500637_0145990
479 Ga0501084_1856807
480 Ga0466962_0097331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

31

169

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly2.cif.gz_B crystal structure of protein 0.8517 61 135
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.5992 44 135
7sfq-assembly1.cif.gz_A emre s64v mutant bound to tetra(4-fluorophenyl)phosphonium at ph 8.0 0.5685 71 135
4nv6-assembly1.cif.gz_A c212a mutant of synechococcus vkor 0.5459 75 137
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.5355 44 135
ID Description Score Start End Superfamily
af_Q2FUS1_154_287_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8041 4 134 1.25.10.10
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7997 74 135 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7901 74 135 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.779 60 135 1.10.3730.20
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7747 17 135 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A519VE27-F1-model_v4 EamA family transporter 0.997 1 136 GO:0016020
AF-A0A7T9C149-F1-model_v4 deleted 0.9963 2 136
AF-A0A1G2BUI3-F1-model_v4 EamA domain-containing protein 0.9962 2 136 GO:0016020
AF-A0A2H0VCG7-F1-model_v4 EamA domain-containing protein 0.9957 2 136 GO:0016020
AF-A0A3B7N1N1-F1-model_v4 EamA family transporter 0.9948 1 136 GO:0016020

Map