F352678

General Info

Members Datasets Scaffolds Average Seq Length
240 103 239 165

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100366981|Ga0070665_1003669812
Length 185
Sequence MNLKPETLRQIDEVIPHYPVKRSAALPLLHLVQEDLGYIPPEAIDWVAAKLELQPINVFELVTFYPMFRQKPIGRRHIKVCRTLSCALLGGYKTCAVFEQEFNTHRGEISPDGEVTIEFVECLASCGTAPVVLIDDDLHEKVDARKAKQLSDEIKRQAAARSQPAIQSSRPAVTVPAAGAKPPKG

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
33 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
34 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
65 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
100 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
101 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
102 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
103 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 0.42
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001962 3300005329 Bacteria 16121
2 Ga0070683_100087265 3300005329 Bacteria 2926
3 Ga0068869_100000005 3300005334 Bacteria 103764
4 Ga0068868_100041271 3300005338 Bacteria 3594
5 Ga0070687_100230659 3300005343 Bacteria 1139
6 Ga0070659_100671757 3300005366 Bacteria 894
7 Ga0070679_100007616 3300005530 Bacteria 10134
8 Ga0070684_100489079 3300005535 Bacteria 1139
9 Ga0070693_100318109 3300005547 Bacteria 1055
10 Ga0070665_100366981 3300005548 Bacteria 1446
11 Ga0070665_100690019 3300005548 Bacteria 1034
12 Ga0068855_100557717 3300005563 Bacteria 1239
13 Ga0068857_100972758 3300005577 Bacteria 816
14 Ga0068856_100017092 3300005614 Bacteria 7031
15 Ga0068856_100053079 3300005614 Bacteria 3998
16 Ga0068866_10099961 3300005718 Bacteria 1598
17 Ga0070712_100512424 3300006175 Bacteria 1007
18 Ga0105240_10639562 3300009093 Bacteria 1167
19 Ga0105242_11595280 3300009176 Bacteria 686
20 Ga0105248_10346707 3300009177 Bacteria 1672
21 Ga0157374_10838888 3300013296 Bacteria 936
22 Ga0157372_11290558 3300013307 Unclassified 843
23 Ga0157375_10415566 3300013308 Bacteria 1511
24 Ga0163163_10078185 3300014325 Bacteria 3305
25 Ga0207646_10792845 3300025922 Bacteria 844
26 Ga0207689_10000323 3300025942 Bacteria 44332
27 Ga0207661_10001672 3300025944 Bacteria 15122
28 Ga0207661_11248989 3300025944 Unclassified 683
29 Ga0207667_10522415 3300025949 Bacteria 1202
30 Ga0207677_10247490 3300026023 Bacteria 1446
31 Ga0207677_10493046 3300026023 Bacteria 1058
32 Ga0207702_10000670 3300026078 Bacteria 37280
33 Ga0207702_10027621 3300026078 Bacteria 4714
34 Ga0207648_10000865 3300026089 Bacteria 34077
35 Ga0207675_100448087 3300026118 Bacteria 1279
36 Ga0268266_10609566 3300028379 Bacteria 1049
37 Ga0265337_1000928 3300028556 Bacteria 15366
38 Ga0265337_1007548 3300028556 Bacteria 4060
39 Ga0265337_1032766 3300028556 Bacteria 1536
40 Ga0265337_1034793 3300028556 Bacteria 1479
41 Ga0265337_1042533 3300028556 Bacteria 1303
42 Ga0265326_10028636 3300028558 Bacteria 1586
43 Ga0265319_1000022 3300028563 Bacteria 150752
44 Ga0265319_1001142 3300028563 Bacteria 16503
45 Ga0265319_1001278 3300028563 Bacteria 15269
46 Ga0265319_1003542 3300028563 Bacteria 8103
47 Ga0265319_1007568 3300028563 Bacteria 4864
48 Ga0265319_1015914 3300028563 Bacteria 2895
49 Ga0265319_1016015 3300028563 Bacteria 2883
50 Ga0265319_1018357 3300028563 Bacteria 2635
51 Ga0265319_1019187 3300028563 Bacteria 2560
52 Ga0265319_1024128 3300028563 Bacteria 2193
53 Ga0265319_1041605 3300028563 Bacteria 1549
54 Ga0265334_10003337 3300028573 Bacteria 7321
55 Ga0265334_10003688 3300028573 Bacteria 6932
56 Ga0265334_10040327 3300028573 Bacteria 1830
57 Ga0265318_10000006 3300028577 Bacteria 285591
58 Ga0265318_10001263 3300028577 Bacteria 15300
59 Ga0265318_10002658 3300028577 Bacteria 9408
60 Ga0265318_10006239 3300028577 Bacteria 5510
61 Ga0265318_10013626 3300028577 Bacteria 3429
62 Ga0265318_10014540 3300028577 Bacteria 3302
63 Ga0265318_10028482 3300028577 Bacteria 2184
64 Ga0265323_10000006 3300028653 Bacteria 141508
65 Ga0265323_10005073 3300028653 Bacteria 5624
66 Ga0265323_10008554 3300028653 Bacteria 4217
67 Ga0265323_10010255 3300028653 Bacteria 3802
68 Ga0265323_10024470 3300028653 Bacteria 2294
69 Ga0265322_10000679 3300028654 Bacteria 12601
70 Ga0265322_10011044 3300028654 Bacteria 2619
71 Ga0265322_10056282 3300028654 Unclassified 1115
72 Ga0265336_10008868 3300028666 Bacteria 3505
73 Ga0265336_10010355 3300028666 Bacteria 3193
74 Ga0265336_10012414 3300028666 Bacteria 2867
75 Ga0265336_10079517 3300028666 Bacteria 979
76 Ga0307515_10095943 3300028794 Bacteria 3643
77 Ga0265338_10000201 3300028800 Bacteria 112868
78 Ga0265338_10000653 3300028800 Bacteria 59925
79 Ga0265338_10136645 3300028800 Bacteria 1926
80 Ga0265324_10001598 3300029957 Bacteria 12611
81 Ga0265324_10007786 3300029957 Bacteria 4308
82 Ga0265324_10035539 3300029957 Bacteria 1735
83 Ga0265324_10171612 3300029957 Bacteria 736
84 Ga0265330_10034723 3300031235 Bacteria 2251
85 Ga0265330_10054764 3300031235 Bacteria 1743
86 Ga0265330_10066255 3300031235 Bacteria 1567
87 Ga0265330_10088422 3300031235 Bacteria 1331
88 Ga0265332_10197799 3300031238 Bacteria 836
89 Ga0265328_10026404 3300031239 Bacteria 2182
90 Ga0265320_10000705 3300031240 Bacteria 25503
91 Ga0265320_10003977 3300031240 Bacteria 9751
92 Ga0265320_10005346 3300031240 Bacteria 8259
93 Ga0265320_10005580 3300031240 Bacteria 8057
94 Ga0265320_10012949 3300031240 Bacteria 4821
95 Ga0265320_10017562 3300031240 Bacteria 3967
96 Ga0265320_10025726 3300031240 Bacteria 3090
97 Ga0265320_10034942 3300031240 Bacteria 2551
98 Ga0265320_10038084 3300031240 Bacteria 2415
99 Ga0265320_10068077 3300031240 Bacteria 1683
100 Ga0265320_10099529 3300031240 Bacteria 1340
101 Ga0265320_10145369 3300031240 Bacteria 1072
102 Ga0265320_10198743 3300031240 Bacteria 895
103 Ga0265325_10026241 3300031241 Bacteria 3158
104 Ga0265325_10041105 3300031241 Bacteria 2425
105 Ga0265325_10067603 3300031241 Bacteria 1800
106 Ga0265329_10090683 3300031242 Bacteria 970
107 Ga0265340_10002758 3300031247 Bacteria 10006
108 Ga0265340_10079965 3300031247 Bacteria 1540
109 Ga0265339_10342079 3300031249 Unclassified 706
110 Ga0265339_10460124 3300031249 Unclassified 590
111 Ga0265331_10002834 3300031250 Bacteria 11490
112 Ga0265331_10004255 3300031250 Bacteria 8962
113 Ga0265331_10030526 3300031250 Bacteria 2684
114 Ga0265327_10000342 3300031251 Bacteria 88184
115 Ga0265327_10001076 3300031251 Bacteria 38060
116 Ga0265327_10002215 3300031251 Bacteria 21209
117 Ga0265327_10002565 3300031251 Bacteria 18834
118 Ga0265327_10040264 3300031251 Bacteria 2529
119 Ga0265327_10040415 3300031251 Bacteria 2523
120 Ga0265316_10006088 3300031344 Bacteria 11578
121 Ga0265316_10028099 3300031344 Bacteria 4644
122 Ga0265316_10028758 3300031344 Bacteria 4580
123 Ga0265316_10044985 3300031344 Bacteria 3507
124 Ga0265316_10100895 3300031344 Bacteria 2194
125 Ga0265316_10120522 3300031344 Bacteria 1981
126 Ga0265316_10141755 3300031344 Bacteria 1805
127 Ga0265316_10365278 3300031344 Bacteria 1043
128 Ga0265316_10478773 3300031344 Unclassified 891
129 Ga0265316_10520560 3300031344 Unclassified 848
130 Ga0265316_10585399 3300031344 Bacteria 792
131 Ga0307408_100000003 3300031548 Bacteria 618438
132 Ga0265313_10000377 3300031595 Bacteria 48049
133 Ga0265313_10000392 3300031595 Bacteria 47135
134 Ga0265313_10001871 3300031595 Bacteria 19140
135 Ga0265313_10003702 3300031595 Bacteria 12183
136 Ga0265313_10007381 3300031595 Bacteria 7532
137 Ga0265313_10089498 3300031595 Bacteria 1384
138 Ga0265313_10311906 3300031595 Bacteria 630
139 Ga0307508_10001771 3300031616 Bacteria 23994
140 Ga0265314_10000746 3300031711 Bacteria 39028
141 Ga0265314_10002502 3300031711 Bacteria 18756
142 Ga0265314_10003811 3300031711 Bacteria 14408
143 Ga0265314_10012634 3300031711 Bacteria 6874
144 Ga0265314_10036726 3300031711 Bacteria 3557
145 Ga0265314_10311474 3300031711 Bacteria 879
146 Ga0265314_10412710 3300031711 Bacteria 727
147 Ga0265314_10454544 3300031711 Bacteria 682
148 Ga0265342_10006204 3300031712 Bacteria 8935
149 Ga0265342_10025673 3300031712 Bacteria 3700
150 Ga0265342_10026746 3300031712 Bacteria 3613
151 Ga0265342_10094575 3300031712 Bacteria 1709
152 Ga0265342_10100342 3300031712 Bacteria 1650
153 Ga0265342_10134276 3300031712 Bacteria 1384
154 Ga0307410_10000039 3300031852 Bacteria 46194
155 Ga0307407_10012231 3300031903 Bacteria 4117
156 Ga0307412_10404154 3300031911 Bacteria 1113
157 Ga0307409_100000018 3300031995 Bacteria 57233
158 Ga0307416_100000027 3300032002 Bacteria 172418
159 Ga0373951_0058493 3300035091 Bacteria 961
160 Ga0373923_0241008 3300035111 Bacteria 845
161 Ga0373931_1104251 3300035691 Bacteria 540
162 Ga0373937_1230045 3300036401 Bacteria 697
163 Ga0395905_0000064 3300037471 Bacteria 186494
164 Ga0395905_0174124 3300037471 Bacteria 2021
165 Ga0451807_2056234 3300041486 Bacteria 642
166 Ga0451577_0000076 3300042876 Bacteria 225346
167 Ga0451577_0142854 3300042876 Bacteria 2152
168 Ga0451577_0394919 3300042876 Bacteria 1255
169 Ga0451577_1040029 3300042876 Bacteria 734
170 Ga0451577_1135630 3300042876 Bacteria 698
171 Ga0466969_0339087 3300044656 Bacteria 680
172 Ga0453683_0000626 3300044673 Bacteria 38554
173 Ga0453683_0419715 3300044673 Bacteria 863
174 Ga0466966_0027792 3300044684 Bacteria 3688
175 Ga0466961_0099965 3300044693 Bacteria 1828
176 Ga0453684_0016861 3300044712 Bacteria 11371
177 Ga0453684_0027153 3300044712 Bacteria 8225
178 Ga0453684_0182517 3300044712 Bacteria 2462
179 Ga0453684_0328997 3300044712 Bacteria 1728
180 Ga0453684_0366029 3300044712 Bacteria 1622
181 Ga0466957_0661182 3300044842 Bacteria 735
182 Ga0466959_0075361 3300045049 Bacteria 2438
183 Ga0451576_0000532 3300045051 Bacteria 82063
184 Ga0451576_0001385 3300045051 Bacteria 41630
185 Ga0451576_0003780 3300045051 Bacteria 20425
186 Ga0451576_0033909 3300045051 Bacteria 5424
187 Ga0451576_0074145 3300045051 Bacteria 3541
188 Ga0451576_0447301 3300045051 Bacteria 1356
189 Ga0451576_1445403 3300045051 Bacteria 715
190 Ga0495653_0520072 3300046463 Bacteria 740
191 Ga0495599_0613203 3300046678 Bacteria 633
192 Ga0495636_0053993 3300047318 Bacteria 1688
193 Ga0501031_0002510 3300049568 Bacteria 11692
194 Ga0501032_0000263 3300049569 Bacteria 44127
195 Ga0501032_0000944 3300049569 Bacteria 23507
196 Ga0501032_0816614 3300049569 Bacteria 588
197 Ga0501033_0001254 3300049570 Bacteria 22736
198 Ga0501033_0001836 3300049570 Bacteria 18501
199 Ga0501033_0227317 3300049570 Bacteria 1326
200 Ga0501034_0126970 3300049571 Bacteria 2535
201 Ga0501036_0004357 3300049572 Bacteria 11418
202 Ga0501036_0086002 3300049572 Bacteria 2658
203 Ga0501037_0000575 3300049573 Bacteria 28954
204 Ga0501037_0024279 3300049573 Bacteria 4484
205 Ga0501038_0001618 3300049574 Bacteria 20939
206 Ga0501038_0644914 3300049574 Bacteria 798
207 Ga0501038_0759006 3300049574 Bacteria 723
208 Ga0501039_0008523 3300049575 Bacteria 7817
209 Ga0501042_0001022 3300049578 Bacteria 15925
210 Ga0501043_0042068 3300049579 Bacteria 3589
211 Ga0501043_0123566 3300049579 Bacteria 2030
212 Ga0501043_0165478 3300049579 Bacteria 1727
213 Ga0501043_0404211 3300049579 Bacteria 1031
214 Ga0501046_0001943 3300049580 Bacteria 19629
215 Ga0501046_0014594 3300049580 Bacteria 6619
216 Ga0501046_0138270 3300049580 Bacteria 1844
217 Ga0501046_0361034 3300049580 Bacteria 1053
218 Ga0501047_0216673 3300049581 Bacteria 1771
219 Ga0501047_0245437 3300049581 Bacteria 1640
220 Ga0501047_0480181 3300049581 Bacteria 1070
221 Ga0501047_0480851 3300049581 Bacteria 1069
222 Ga0501048_0000923 3300049582 Bacteria 21636
223 Ga0501070_0019349 3300049586 Bacteria 5710
224 Ga0501070_0651813 3300049586 Bacteria 836
225 Ga0501083_0036631 3300049744 Bacteria 3345
226 Ga0501083_0388021 3300049744 Unclassified 908
227 Ga0501035_0000567 3300049822 Bacteria 40906
228 Ga0501035_0000849 3300049822 Bacteria 32602
229 Ga0501035_0105458 3300049822 Bacteria 2471
230 Ga0501035_0226471 3300049822 Bacteria 1595
231 Ga0501044_0001818 3300049823 Bacteria 24837
232 Ga0501044_0004025 3300049823 Bacteria 16476
233 Ga0501044_0028869 3300049823 Bacteria 5851
234 Ga0501044_0068649 3300049823 Bacteria 3610
235 Ga0501045_0470311 3300049824 Bacteria 934
236 Ga0500568_0003576 3300053139 Bacteria 8583
237 Ga0500573_0170398 3300053140 Bacteria 1178
238 Ga0500588_0167980 3300053146 Bacteria 801
239 Ga0500622_0022033 3300053156 Bacteria 3380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10792845 Ga0207646_107928451 152
2 3300053146 Ga0500588_0167980 Ga0500588_0167980_83_568 152
3 3300053139 Ga0500568_0003576 Ga0500568_0003576_5953_6447 153
4 3300053156 Ga0500622_0022033 Ga0500622_0022033_1914_2408 153
5 3300031251 Ga0265327_10040415 Ga0265327_100404152 155
6 3300045051 Ga0451576_1445403 Ga0451576_1445403_142_636 155
7 3300044712 Ga0453684_0016861 Ga0453684_0016861_10642_11130 156
8 iso_pu_bacteria 2786546940 2788435305 158
9 3300028556 Ga0265337_1034793 Ga0265337_10347932 160
10 3300028563 Ga0265319_1001278 Ga0265319_10012787 160
11 3300028563 Ga0265319_1018357 Ga0265319_10183573 160
12 3300028573 Ga0265334_10003337 Ga0265334_100033374 160
13 3300031240 Ga0265320_10000705 Ga0265320_1000070513 160
14 3300031249 Ga0265339_10460124 Ga0265339_104601241 160
15 3300031250 Ga0265331_10002834 Ga0265331_100028343 160
16 3300031595 Ga0265313_10000377 Ga0265313_1000037726 160
17 3300031595 Ga0265313_10311906 Ga0265313_103119061 160
18 3300046463 Ga0495653_0520072 Ga0495653_0520072_109_591 160
19 3300005547 Ga0070693_100318109 Ga0070693_1003181091 161
20 3300013308 Ga0157375_10415566 Ga0157375_104155662 161
21 3300028556 Ga0265337_1042533 Ga0265337_10425332 161
22 3300028563 Ga0265319_1015914 Ga0265319_10159143 161
23 3300028563 Ga0265319_1016015 Ga0265319_10160154 161
24 3300028563 Ga0265319_1019187 Ga0265319_10191872 161
25 3300028577 Ga0265318_10013626 Ga0265318_100136262 161
26 3300028653 Ga0265323_10005073 Ga0265323_100050735 161
27 3300028653 Ga0265323_10008554 Ga0265323_100085543 161
28 3300028666 Ga0265336_10012414 Ga0265336_100124142 161
29 3300031235 Ga0265330_10054764 Ga0265330_100547642 161
30 3300031235 Ga0265330_10088422 Ga0265330_100884222 161
31 3300031240 Ga0265320_10012949 Ga0265320_100129492 161
32 3300031240 Ga0265320_10034942 Ga0265320_100349422 161
33 3300031344 Ga0265316_10028758 Ga0265316_100287583 161
34 3300031344 Ga0265316_10120522 Ga0265316_101205222 161
35 3300031344 Ga0265316_10585399 Ga0265316_105853991 161
36 3300031616 Ga0307508_10001771 Ga0307508_1000177119 161
37 3300031711 Ga0265314_10454544 Ga0265314_104545441 161
38 3300031712 Ga0265342_10100342 Ga0265342_101003422 161
39 3300035091 Ga0373951_0058493 Ga0373951_0058493_244_729 161
40 3300035111 Ga0373923_0241008 Ga0373923_0241008_149_634 161
41 3300036401 Ga0373937_1230045 Ga0373937_1230045_186_671 161
42 3300037471 Ga0395905_0174124 Ga0395905_0174124_887_1372 161
43 3300049580 Ga0501046_0361034 Ga0501046_0361034_112_597 161
44 3300049581 Ga0501047_0216673 Ga0501047_0216673_164_649 161
45 3300049822 Ga0501035_0105458 Ga0501035_0105458_567_1052 161
46 3300053140 Ga0500573_0170398 Ga0500573_0170398_114_599 161
47 3300005329 Ga0070683_100001962 Ga0070683_10000196214 162
48 3300005329 Ga0070683_100087265 Ga0070683_1000872654 162
49 3300005334 Ga0068869_100000005 Ga0068869_10000000547 162
50 3300005338 Ga0068868_100041271 Ga0068868_1000412714 162
51 3300005343 Ga0070687_100230659 Ga0070687_1002306592 162
52 3300005366 Ga0070659_100671757 Ga0070659_1006717572 162
53 3300005530 Ga0070679_100007616 Ga0070679_1000076167 162
54 3300005535 Ga0070684_100489079 Ga0070684_1004890792 162
55 3300005548 Ga0070665_100366981 Ga0070665_1003669812 162
56 3300005548 Ga0070665_100690019 Ga0070665_1006900192 162
57 3300005563 Ga0068855_100557717 Ga0068855_1005577172 162
58 3300005577 Ga0068857_100972758 Ga0068857_1009727581 162
59 3300005614 Ga0068856_100017092 Ga0068856_1000170926 162
60 3300005614 Ga0068856_100053079 Ga0068856_1000530792 162
61 3300005718 Ga0068866_10099961 Ga0068866_100999611 162
62 3300006175 Ga0070712_100512424 Ga0070712_1005124241 162
63 3300009093 Ga0105240_10639562 Ga0105240_106395622 162
64 3300009176 Ga0105242_11595280 Ga0105242_115952802 162
65 3300009177 Ga0105248_10346707 Ga0105248_103467072 162
66 3300013296 Ga0157374_10838888 Ga0157374_108388882 162
67 3300013307 Ga0157372_11290558 Ga0157372_112905582 162
68 3300014325 Ga0163163_10078185 Ga0163163_100781852 162
69 3300025942 Ga0207689_10000323 Ga0207689_1000032319 162
70 3300025944 Ga0207661_10001672 Ga0207661_100016723 162
71 3300025944 Ga0207661_11248989 Ga0207661_112489892 162
72 3300025949 Ga0207667_10522415 Ga0207667_105224151 162
73 3300026023 Ga0207677_10247490 Ga0207677_102474902 162
74 3300026023 Ga0207677_10493046 Ga0207677_104930461 162
75 3300026078 Ga0207702_10000670 Ga0207702_1000067010 162
76 3300026078 Ga0207702_10027621 Ga0207702_100276214 162
77 3300026089 Ga0207648_10000865 Ga0207648_1000086515 162
78 3300026118 Ga0207675_100448087 Ga0207675_1004480872 162
79 3300028379 Ga0268266_10609566 Ga0268266_106095662 162
80 3300028556 Ga0265337_1000928 Ga0265337_10009287 162
81 3300028556 Ga0265337_1007548 Ga0265337_10075483 162
82 3300028556 Ga0265337_1032766 Ga0265337_10327662 162
83 3300028558 Ga0265326_10028636 Ga0265326_100286362 162
84 3300028563 Ga0265319_1000022 Ga0265319_10000229 162
85 3300028563 Ga0265319_1001142 Ga0265319_10011422 162
86 3300028563 Ga0265319_1003542 Ga0265319_10035425 162
87 3300028563 Ga0265319_1007568 Ga0265319_10075683 162
88 3300028563 Ga0265319_1024128 Ga0265319_10241282 162
89 3300028563 Ga0265319_1041605 Ga0265319_10416054 162
90 3300028573 Ga0265334_10003688 Ga0265334_100036888 162
91 3300028573 Ga0265334_10040327 Ga0265334_100403271 162
92 3300028577 Ga0265318_10000006 Ga0265318_10000006245 162
93 3300028577 Ga0265318_10001263 Ga0265318_1000126310 162
94 3300028577 Ga0265318_10002658 Ga0265318_100026583 162
95 3300028577 Ga0265318_10006239 Ga0265318_100062395 162
96 3300028577 Ga0265318_10014540 Ga0265318_100145404 162
97 3300028577 Ga0265318_10028482 Ga0265318_100284822 162
98 3300028653 Ga0265323_10000006 Ga0265323_1000000676 162
99 3300028653 Ga0265323_10010255 Ga0265323_100102554 162
100 3300028653 Ga0265323_10024470 Ga0265323_100244702 162
101 3300028654 Ga0265322_10000679 Ga0265322_100006798 162
102 3300028654 Ga0265322_10011044 Ga0265322_100110442 162
103 3300028654 Ga0265322_10056282 Ga0265322_100562822 162
104 3300028666 Ga0265336_10008868 Ga0265336_100088684 162
105 3300028666 Ga0265336_10010355 Ga0265336_100103552 162
106 3300028666 Ga0265336_10079517 Ga0265336_100795172 162
107 3300028794 Ga0307515_10095943 Ga0307515_100959433 162
108 3300028800 Ga0265338_10000201 Ga0265338_1000020183 162
109 3300028800 Ga0265338_10000653 Ga0265338_1000065334 162
110 3300028800 Ga0265338_10136645 Ga0265338_101366452 162
111 3300029957 Ga0265324_10001598 Ga0265324_100015984 162
112 3300029957 Ga0265324_10007786 Ga0265324_100077862 162
113 3300029957 Ga0265324_10035539 Ga0265324_100355392 162
114 3300029957 Ga0265324_10171612 Ga0265324_101716122 162
115 3300031235 Ga0265330_10034723 Ga0265330_100347233 162
116 3300031235 Ga0265330_10066255 Ga0265330_100662552 162
117 3300031238 Ga0265332_10197799 Ga0265332_101977992 162
118 3300031239 Ga0265328_10026404 Ga0265328_100264043 162
119 3300031240 Ga0265320_10003977 Ga0265320_100039774 162
120 3300031240 Ga0265320_10005346 Ga0265320_100053467 162
121 3300031240 Ga0265320_10005580 Ga0265320_100055802 162
122 3300031240 Ga0265320_10017562 Ga0265320_100175625 162
123 3300031240 Ga0265320_10025726 Ga0265320_100257262 162
124 3300031240 Ga0265320_10038084 Ga0265320_100380842 162
125 3300031240 Ga0265320_10068077 Ga0265320_100680772 162
126 3300031240 Ga0265320_10099529 Ga0265320_100995291 162
127 3300031240 Ga0265320_10145369 Ga0265320_101453692 162
128 3300031240 Ga0265320_10198743 Ga0265320_101987432 162
129 3300031241 Ga0265325_10026241 Ga0265325_100262412 162
130 3300031241 Ga0265325_10041105 Ga0265325_100411053 162
131 3300031241 Ga0265325_10067603 Ga0265325_100676032 162
132 3300031242 Ga0265329_10090683 Ga0265329_100906832 162
133 3300031247 Ga0265340_10002758 Ga0265340_100027582 162
134 3300031247 Ga0265340_10079965 Ga0265340_100799652 162
135 3300031249 Ga0265339_10342079 Ga0265339_103420791 162
136 3300031250 Ga0265331_10004255 Ga0265331_100042556 162
137 3300031250 Ga0265331_10030526 Ga0265331_100305262 162
138 3300031251 Ga0265327_10000342 Ga0265327_1000034244 162
139 3300031251 Ga0265327_10001076 Ga0265327_1000107635 162
140 3300031251 Ga0265327_10002215 Ga0265327_100022153 162
141 3300031251 Ga0265327_10002565 Ga0265327_100025655 162
142 3300031251 Ga0265327_10040264 Ga0265327_100402642 162
143 3300031344 Ga0265316_10006088 Ga0265316_100060882 162
144 3300031344 Ga0265316_10028099 Ga0265316_100280994 162
145 3300031344 Ga0265316_10044985 Ga0265316_100449852 162
146 3300031344 Ga0265316_10100895 Ga0265316_101008951 162
147 3300031344 Ga0265316_10141755 Ga0265316_101417552 162
148 3300031344 Ga0265316_10365278 Ga0265316_103652782 162
149 3300031344 Ga0265316_10478773 Ga0265316_104787731 162
150 3300031344 Ga0265316_10520560 Ga0265316_105205602 162
151 3300031548 Ga0307408_100000003 Ga0307408_100000003366 162
152 3300031595 Ga0265313_10000392 Ga0265313_1000039240 162
153 3300031595 Ga0265313_10001871 Ga0265313_100018719 162
154 3300031595 Ga0265313_10003702 Ga0265313_1000370215 162
155 3300031595 Ga0265313_10007381 Ga0265313_100073818 162
156 3300031595 Ga0265313_10089498 Ga0265313_100894982 162
157 3300031711 Ga0265314_10000746 Ga0265314_1000074622 162
158 3300031711 Ga0265314_10002502 Ga0265314_1000250214 162
159 3300031711 Ga0265314_10003811 Ga0265314_100038114 162
160 3300031711 Ga0265314_10012634 Ga0265314_100126345 162
161 3300031711 Ga0265314_10036726 Ga0265314_100367262 162
162 3300031711 Ga0265314_10311474 Ga0265314_103114742 162
163 3300031711 Ga0265314_10412710 Ga0265314_104127102 162
164 3300031712 Ga0265342_10006204 Ga0265342_100062044 162
165 3300031712 Ga0265342_10025673 Ga0265342_100256733 162
166 3300031712 Ga0265342_10026746 Ga0265342_100267464 162
167 3300031712 Ga0265342_10094575 Ga0265342_100945752 162
168 3300031712 Ga0265342_10134276 Ga0265342_101342762 162
169 3300031852 Ga0307410_10000039 Ga0307410_1000003920 162
170 3300031903 Ga0307407_10012231 Ga0307407_100122316 162
171 3300031911 Ga0307412_10404154 Ga0307412_104041542 162
172 3300031995 Ga0307409_100000018 Ga0307409_10000001815 162
173 3300032002 Ga0307416_100000027 Ga0307416_10000002797 162
174 3300035691 Ga0373931_1104251 Ga0373931_1104251_38_526 162
175 3300037471 Ga0395905_0000064 Ga0395905_0000064_167680_168177 162
176 3300041486 Ga0451807_2056234 Ga0451807_2056234_99_587 162
177 3300042876 Ga0451577_0000076 Ga0451577_0000076_81992_82480 162
178 3300042876 Ga0451577_0142854 Ga0451577_0142854_811_1311 162
179 3300042876 Ga0451577_0394919 Ga0451577_0394919_751_1239 162
180 3300042876 Ga0451577_1040029 Ga0451577_1040029_228_722 162
181 3300042876 Ga0451577_1135630 Ga0451577_1135630_81_569 162
182 3300044656 Ga0466969_0339087 Ga0466969_0339087_151_639 162
183 3300044673 Ga0453683_0000626 Ga0453683_0000626_28280_28789 162
184 3300044673 Ga0453683_0419715 Ga0453683_0419715_52_564 162
185 3300044684 Ga0466966_0027792 Ga0466966_0027792_439_927 162
186 3300044693 Ga0466961_0099965 Ga0466961_0099965_179_667 162
187 3300044712 Ga0453684_0027153 Ga0453684_0027153_6459_6947 162
188 3300044712 Ga0453684_0182517 Ga0453684_0182517_1545_2033 162
189 3300044712 Ga0453684_0328997 Ga0453684_0328997_767_1261 162
190 3300044712 Ga0453684_0366029 Ga0453684_0366029_390_884 162
191 3300044842 Ga0466957_0661182 Ga0466957_0661182_93_587 162
192 3300045049 Ga0466959_0075361 Ga0466959_0075361_245_733 162
193 3300045051 Ga0451576_0000532 Ga0451576_0000532_77297_77818 162
194 3300045051 Ga0451576_0001385 Ga0451576_0001385_12686_13186 162
195 3300045051 Ga0451576_0003780 Ga0451576_0003780_8790_9293 162
196 3300045051 Ga0451576_0033909 Ga0451576_0033909_2577_3101 162
197 3300045051 Ga0451576_0074145 Ga0451576_0074145_2405_2893 162
198 3300045051 Ga0451576_0447301 Ga0451576_0447301_813_1301 162
199 3300046678 Ga0495599_0613203 Ga0495599_0613203_94_582 162
200 3300047318 Ga0495636_0053993 Ga0495636_0053993_130_630 162
201 3300049568 Ga0501031_0002510 Ga0501031_0002510_9599_10111 162
202 3300049569 Ga0501032_0000263 Ga0501032_0000263_16856_17368 162
203 3300049569 Ga0501032_0000944 Ga0501032_0000944_16014_16505 162
204 3300049569 Ga0501032_0816614 Ga0501032_0816614_77_565 162
205 3300049570 Ga0501033_0001254 Ga0501033_0001254_16837_17325 162
206 3300049570 Ga0501033_0001836 Ga0501033_0001836_6988_7500 162
207 3300049570 Ga0501033_0227317 Ga0501033_0227317_327_839 162
208 3300049571 Ga0501034_0126970 Ga0501034_0126970_1177_1689 162
209 3300049572 Ga0501036_0004357 Ga0501036_0004357_10471_10983 162
210 3300049572 Ga0501036_0086002 Ga0501036_0086002_732_1223 162
211 3300049573 Ga0501037_0000575 Ga0501037_0000575_6291_6803 162
212 3300049573 Ga0501037_0024279 Ga0501037_0024279_2766_3254 162
213 3300049574 Ga0501038_0001618 Ga0501038_0001618_8566_9078 162
214 3300049574 Ga0501038_0644914 Ga0501038_0644914_13_501 162
215 3300049574 Ga0501038_0759006 Ga0501038_0759006_23_514 162
216 3300049575 Ga0501039_0008523 Ga0501039_0008523_4388_4900 162
217 3300049578 Ga0501042_0001022 Ga0501042_0001022_5235_5747 162
218 3300049579 Ga0501043_0042068 Ga0501043_0042068_1037_1549 162
219 3300049579 Ga0501043_0123566 Ga0501043_0123566_772_1260 162
220 3300049579 Ga0501043_0165478 Ga0501043_0165478_1159_1647 162
221 3300049579 Ga0501043_0404211 Ga0501043_0404211_506_1018 162
222 3300049580 Ga0501046_0001943 Ga0501046_0001943_15128_15640 162
223 3300049580 Ga0501046_0014594 Ga0501046_0014594_3629_4117 162
224 3300049580 Ga0501046_0138270 Ga0501046_0138270_132_623 162
225 3300049581 Ga0501047_0245437 Ga0501047_0245437_275_763 162
226 3300049581 Ga0501047_0480181 Ga0501047_0480181_517_1029 162
227 3300049581 Ga0501047_0480851 Ga0501047_0480851_516_1028 162
228 3300049582 Ga0501048_0000923 Ga0501048_0000923_10425_10937 162
229 3300049586 Ga0501070_0019349 Ga0501070_0019349_2547_3059 162
230 3300049586 Ga0501070_0651813 Ga0501070_0651813_306_794 162
231 3300049744 Ga0501083_0036631 Ga0501083_0036631_1288_1782 162
232 3300049744 Ga0501083_0388021 Ga0501083_0388021_19_531 162
233 3300049822 Ga0501035_0000567 Ga0501035_0000567_30315_30827 162
234 3300049822 Ga0501035_0000849 Ga0501035_0000849_15716_16207 162
235 3300049822 Ga0501035_0226471 Ga0501035_0226471_495_983 162
236 3300049823 Ga0501044_0001818 Ga0501044_0001818_8387_8878 162
237 3300049823 Ga0501044_0004025 Ga0501044_0004025_9845_10357 162
238 3300049823 Ga0501044_0028869 Ga0501044_0028869_1763_2269 162
239 3300049823 Ga0501044_0068649 Ga0501044_0068649_1592_2080 162
240 3300049824 Ga0501045_0470311 Ga0501045_0470311_367_879 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

11

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.8481 76 152
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.8456 76 152
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.8433 74 152
8oh5-assembly1.cif.gz_A cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.837 8 154
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.8292 74 152
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9489 73 156 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9371 73 156 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9352 72 153 3.40.30.10
af_Q6PBX8_48_121_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9305 1 72 1.10.10.1590
af_P0AFD1_13_82_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9233 2 71 1.10.10.1590
ID Description Score Start End GO Terms
AF-A0A2G9M1R4-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9238 6 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A5B9DEP0-F1-model_v4 NADH dehydrogenase subunit E 0.9155 7 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A533RNT2-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) 0.9148 15 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A2C6MIB6-F1-model_v4 NADH dehydrogenase 0.9062 12 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A2L2XEK3-F1-model_v4 NADH-ubiquinone oxidoreductase chain E 0.9043 7 154 GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
90.26 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map