F352899

General Info

Members Datasets Scaffolds Average Seq Length
240 208 185 320

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10000063|Ga0213872_1000006325
Length 334
Sequence MKWKKLGKIFDPTEHVLPNGCKEFAQSPQCLVFDDFVRIYFSTRSIDSKNGKYLSHIAFVDMSKDFRNVIRVSDRPVIPLGELGCFDEHGIFPMNVLRHDNLVLGYTCGWNRRVSVSVDTAIGLAISRDGGLTFQRTGPGPVMGATLHEPCLVGDAFVKRIGDRFHMWYIFGTGWKRYADNTTPDRTYKIGHAESADGMNWTKEEARQIIADRLGEDESQALPSVIEISGRYHMFFCYRQSFDFRTNAQRGYRIGHAWSDDLKNWTRDDAGLSLETTAGDWDSDMQCYPHVTECDGNITCYITAMPLADRVSDWRCWSGNGSDNPIPAKYRQRR

Samples

Sample ID Description Type Environment
1 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
2 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
5 2643221591 Devosia sp. Root685 Isolate Unclassified
6 2718217927 Rhizobium sp. N324 Isolate Nodule
7 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
8 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
9 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
10 2718218423 Rhizobium sp. N941 Isolate Nodule
11 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
12 2721755809 Rhizobium sp. N541 Isolate Nodule
13 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
14 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
15 2738541337 Pelomonas sp. BT06 Isolate Unclassified
16 2791355265 Rhizobium sp. H4 Isolate Nodule
17 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
18 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
19 2838048938 Rhizobium pisi 27/80 Isolate Nodule
20 2838061910 Rhizobium phaseoli L15 Isolate Nodule
21 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
22 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
23 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
24 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
25 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
26 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
27 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
28 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
29 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
30 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
31 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
32 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
33 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
34 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
35 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
36 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
37 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
38 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
39 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
40 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
41 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
42 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
43 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
44 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
47 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 8005275841 Rhizobium sp. N4311 Isolate Nodule
202 8005395548 Rhizobium sp. R339 Isolate Nodule
203 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
204 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
205 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
206 8018176218 Rhizobium sp. N122 Isolate Nodule
207 8024501048 Rhizobium sp. H4 Isolate Nodule
208 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.08
Metatranscriptomes 0
Isolates 22.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.75
Nodule 19.17
Rhizoplane 5.83
Rhizosphere 60
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10164923 3300003323 Bacteria 3743
2 Ga0055528_1002119 3300003790 Bacteria 10953
3 Ga0055540_1029508 3300003792 Bacteria 1283
4 Ga0055531_10000007 3300003794 Bacteria 225289
5 Ga0070666_10001834 3300005335 Bacteria 12941
6 Ga0068868_100001999 3300005338 Bacteria 14029
7 Ga0070689_100029808 3300005340 Bacteria 4135
8 Ga0070689_100086215 3300005340 Bacteria 2470
9 Ga0070669_100047295 3300005353 Bacteria 3138
10 Ga0070675_100111111 3300005354 Bacteria 2319
11 Ga0070671_100006127 3300005355 Bacteria 9578
12 Ga0070674_100168910 3300005356 Unclassified 1666
13 Ga0070673_100001135 3300005364 Bacteria 15323
14 Ga0070688_100003007 3300005365 Bacteria 8598
15 Ga0070659_100041743 3300005366 Bacteria 3587
16 Ga0070667_100030603 3300005367 Bacteria 4489
17 Ga0070667_100044700 3300005367 Bacteria 3720
18 Ga0070713_100221127 3300005436 Bacteria 1718
19 Ga0070710_10077935 3300005437 Bacteria 1927
20 Ga0070711_100025397 3300005439 Bacteria 3876
21 Ga0068867_100185570 3300005459 Bacteria 1656
22 Ga0070707_100001508 3300005468 Bacteria 22712
23 Ga0070699_100001291 3300005518 Bacteria 23104
24 Ga0070699_100020489 3300005518 Bacteria 5704
25 Ga0068853_100004714 3300005539 Bacteria 10582
26 Ga0070672_100053776 3300005543 Bacteria 3149
27 Ga0070672_100234818 3300005543 Bacteria 1541
28 Ga0070686_100058344 3300005544 Bacteria 2483
29 Ga0070665_100073513 3300005548 Bacteria 3424
30 Ga0068855_100052223 3300005563 Bacteria 4813
31 Ga0068855_100074327 3300005563 Bacteria 3948
32 Ga0068856_100044344 3300005614 Bacteria 4377
33 Ga0068859_100000752 3300005617 Bacteria 32637
34 Ga0068859_100333896 3300005617 Bacteria 1610
35 Ga0068864_100001479 3300005618 Bacteria 19364
36 Ga0068851_10159435 3300005834 Bacteria 1238
37 Ga0068863_100008664 3300005841 Bacteria 9941
38 Ga0068858_100003128 3300005842 Bacteria 16565
39 Ga0068860_100005794 3300005843 Bacteria 12443
40 Ga0068862_100341809 3300005844 Bacteria 1386
41 Ga0075367_10022886 3300006178 Bacteria 3511
42 Ga0068871_100002423 3300006358 Bacteria 12736
43 Ga0075428_100206995 3300006844 Bacteria 2120
44 Ga0075429_100180252 3300006880 Bacteria 1851
45 Ga0097620_100000752 3300006931 Bacteria 32637
46 Ga0097620_100333887 3300006931 Bacteria 1610
47 Ga0099794_10084951 3300007265 Bacteria 1565
48 Ga0105250_10015292 3300009092 Bacteria 3143
49 Ga0105240_10013204 3300009093 Bacteria 11364
50 Ga0111539_10528935 3300009094 Bacteria 1374
51 Ga0105245_10005949 3300009098 Bacteria 10720
52 Ga0105247_10032030 3300009101 Bacteria 3193
53 Ga0114129_10039716 3300009147 Bacteria 6636
54 Ga0114129_10083943 3300009147 Unclassified 4423
55 Ga0105242_10010848 3300009176 Bacteria 6998
56 Ga0105248_10135122 3300009177 Bacteria 2782
57 Ga0105239_10001689 3300010375 Bacteria 29111
58 Ga0105246_10013581 3300011119 Bacteria 5109
59 Ga0157371_10014810 3300013102 Bacteria 5870
60 Ga0157370_10008545 3300013104 Bacteria 11036
61 Ga0157374_10001973 3300013296 Bacteria 17209
62 Ga0157378_10004445 3300013297 Bacteria 12331
63 Ga0163162_10000585 3300013306 Bacteria 33759
64 Ga0163162_10002465 3300013306 Bacteria 17469
65 Ga0163162_10067129 3300013306 Bacteria 3636
66 Ga0157375_10185532 3300013308 Bacteria 2233
67 Ga0163163_10000541 3300014325 Bacteria 33456
68 Ga0163163_10727862 3300014325 Bacteria 1056
69 Ga0157377_10010413 3300014745 Bacteria 4599
70 Ga0157379_10000597 3300014968 Bacteria 29148
71 Ga0157376_10002086 3300014969 Bacteria 13438
72 Ga0163161_10022744 3300017792 Bacteria 4415
73 Ga0213872_10000063 3300021361 Bacteria 97755
74 Ga0213872_10144935 3300021361 Bacteria 1040
75 Ga0209129_1005065 3300025258 Bacteria 4838
76 Ga0209673_1002354 3300025273 Bacteria 13319
77 Ga0209025_1065146 3300025294 Bacteria 1333
78 Ga0209758_1002328 3300025297 Bacteria 19630
79 Ga0209050_1000934 3300025298 Bacteria 38215
80 Ga0209256_1013915 3300025299 Bacteria 2945
81 Ga0209051_1006408 3300025303 Bacteria 6634
82 Ga0209051_1024599 3300025303 Bacteria 2471
83 Ga0209051_1032346 3300025303 Bacteria 1997
84 Ga0209257_1000021 3300025304 Bacteria 771986
85 Ga0207655_1003666 3300025728 Bacteria 11321
86 Ga0207710_10021934 3300025900 Bacteria 2739
87 Ga0207680_10000531 3300025903 Bacteria 18126
88 Ga0207695_10029730 3300025913 Bacteria 6029
89 Ga0207646_10002835 3300025922 Bacteria 20156
90 Ga0207681_10007422 3300025923 Bacteria 6714
91 Ga0207687_10000968 3300025927 Bacteria 19507
92 Ga0207644_10004427 3300025931 Bacteria 9119
93 Ga0207690_10004780 3300025932 Bacteria 7988
94 Ga0207690_10077515 3300025932 Bacteria 2311
95 Ga0207686_10033745 3300025934 Bacteria 3057
96 Ga0207670_10008880 3300025936 Bacteria 5697
97 Ga0207670_10039327 3300025936 Bacteria 3097
98 Ga0207691_10240359 3300025940 Bacteria 1566
99 Ga0207711_10000970 3300025941 Bacteria 27457
100 Ga0207667_10070624 3300025949 Bacteria 3634
101 Ga0207651_10011638 3300025960 Bacteria 4933
102 Ga0207658_10019290 3300025986 Bacteria 4715
103 Ga0207658_10029536 3300025986 Bacteria 3873
104 Ga0207677_10000206 3300026023 Bacteria 47813
105 Ga0207703_10001244 3300026035 Bacteria 23862
106 Ga0207639_10003834 3300026041 Bacteria 10133
107 Ga0207641_10197054 3300026088 Bacteria 1854
108 Ga0207676_10000386 3300026095 Bacteria 37594
109 Ga0268266_10053925 3300028379 Bacteria 3455
110 Ga0268264_10001587 3300028381 Bacteria 21048
111 Ga0265338_10001525 3300028800 Bacteria 37363
112 Ga0265331_10009181 3300031250 Bacteria 5576
113 Ga0265331_10055529 3300031250 Bacteria 1883
114 Ga0373954_0002282 3300035118 Bacteria 7988
115 Ga0373947_0020648 3300035725 Bacteria 3805
116 Ga0373937_0074707 3300036401 Bacteria 3128
117 Ga0373925_0063667 3300037068 Bacteria 2775
118 Ga0395905_0005588 3300037471 Bacteria 12807
119 Ga0400490_02014 3300038726 Bacteria 2239
120 Ga0400483_224703 3300039062 Bacteria 3050
121 Ga0436361_0794733 3300039447 Bacteria 8336
122 Ga0436361_0811061 3300039447 Bacteria 135576
123 Ga0453684_0001941 3300044712 Bacteria 53308
124 Ga0453684_0023286 3300044712 Bacteria 9133
125 Ga0453684_0028773 3300044712 Bacteria 7912
126 Ga0453684_0041288 3300044712 Bacteria 6244
127 Ga0453684_0089833 3300044712 Bacteria 3797
128 Ga0453684_0114818 3300044712 Bacteria 3264
129 Ga0453684_0306054 3300044712 Bacteria 1805
130 Ga0453684_0600367 3300044712 Bacteria 1206
131 Ga0495617_011223 3300046452 Bacteria 3058
132 Ga0495639_0009222 3300046475 Bacteria 4229
133 Ga0495584_0000511 3300046491 Bacteria 26555
134 Ga0495584_0015899 3300046491 Bacteria 3840
135 Ga0495585_0004565 3300046492 Bacteria 8956
136 Ga0495585_0006751 3300046492 Bacteria 7084
137 Ga0495606_0104633 3300046507 Bacteria 1717
138 Ga0495610_0011551 3300046512 Bacteria 5390
139 Ga0495616_0016554 3300046513 Bacteria 4078
140 Ga0495631_0039286 3300046518 Bacteria 2101
141 Ga0495643_0006006 3300046522 Bacteria 8099
142 Ga0495597_0000834 3300046542 Bacteria 24225
143 Ga0495622_0002744 3300046557 Bacteria 8426
144 Ga0495633_0002543 3300046558 Bacteria 12798
145 Ga0495611_0002210 3300046648 Bacteria 9045
146 Ga0495661_0007280 3300046665 Bacteria 7714
147 Ga0495588_0001986 3300046674 Bacteria 8748
148 Ga0495588_0025898 3300046674 Bacteria 2926
149 Ga0495657_0052485 3300046675 Bacteria 2733
150 Ga0495670_0017136 3300046691 Bacteria 3563
151 Ga0495649_0022586 3300046694 Bacteria 3520
152 Ga0495600_0006235 3300046809 Bacteria 7238
153 Ga0495676_0000093 3300047321 Bacteria 66312
154 Ga0495676_0226457 3300047321 Bacteria 1286
155 Ga0495686_0215559 3300047472 Bacteria 1094
156 Ga0496100_0003277 3300048903 Bacteria 8413
157 Ga0496101_0006948 3300048904 Bacteria 7313
158 Ga0496102_0027264 3300048905 Bacteria 5101
159 Ga0496103_0008681 3300048906 Bacteria 6034
160 Ga0496104_0145860 3300048907 Bacteria 2273
161 Ga0496105_0005455 3300048908 Bacteria 9649
162 Ga0496107_0024196 3300048910 Bacteria 4296
163 Ga0496108_0099297 3300048911 Bacteria 2481
164 Ga0496109_0019728 3300048912 Bacteria 5948
165 Ga0496109_0041663 3300048912 Bacteria 4159
166 Ga0496111_0011447 3300048914 Bacteria 5975
167 Ga0496112_0045130 3300048915 Bacteria 4320
168 Ga0496114_0168695 3300048917 Bacteria 1906
169 Ga0496114_0176505 3300048917 Bacteria 1864
170 Ga0496121_0011434 3300048924 Bacteria 9856
171 Ga0496122_0166811 3300048925 Bacteria 1334
172 Ga0496123_0008662 3300048926 Bacteria 9299
173 Ga0496124_0014314 3300048927 Bacteria 7675
174 Ga0496125_0000542 3300048928 Bacteria 64978
175 Ga0495682_0001416 3300049460 Bacteria 13012
176 nmdc:mga00v17_175471_c1 3300050491 Bacteria 1382
177 nmdc:mga05p37_37594_c1 3300050507 Bacteria 5936
178 nmdc:mga0n895_52677_c1 3300050512 Bacteria 3995
179 nmdc:mga08x19_98554_c1 3300050514 Bacteria 1936
180 Ga0500578_0012282 3300053086 Bacteria 5532
181 Ga0500646_0008857 3300053090 Bacteria 2578
182 Ga0500569_000485 3300053109 Bacteria 6577
183 Ga0500604_0000001 3300053151 Bacteria 174619
184 Ga0500616_0003150 3300053153 Bacteria 12876
185 Ga0500636_0034558 3300053177 Bacteria 2993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0024196 Ga0496107_0024196_2444_3199 248
2 3300038726 Ga0400490_02014 Ga0400490_02014_333_1295 300
3 3300044712 Ga0453684_0600367 Ga0453684_0600367_16_924 301
4 3300046475 Ga0495639_0009222 Ga0495639_0009222_2186_3145 302
5 3300046674 Ga0495588_0025898 Ga0495588_0025898_488_1447 302
6 3300047321 Ga0495676_0226457 Ga0495676_0226457_310_1269 302
7 3300025298 Ga0209050_1000934 Ga0209050_100093435 306
8 3300048917 Ga0496114_0168695 Ga0496114_0168695_267_1235 306
9 3300005340 Ga0070689_100086215 Ga0070689_1000862152 310
10 3300005354 Ga0070675_100111111 Ga0070675_1001111112 310
11 3300005617 Ga0068859_100333896 Ga0068859_1003338961 310
12 3300006931 Ga0097620_100333887 Ga0097620_1003338871 310
13 3300009094 Ga0111539_10528935 Ga0111539_105289352 310
14 3300009147 Ga0114129_10039716 Ga0114129_100397166 310
15 3300014325 Ga0163163_10727862 Ga0163163_107278622 310
16 3300014745 Ga0157377_10010413 Ga0157377_100104134 310
17 3300025936 Ga0207670_10039327 Ga0207670_100393272 310
18 iso_pu_bacteria 2571042143 2571529883 310
19 iso_pu_bacteria 2929160207 2929161119 313
20 iso_pu_bacteria 2574179768 2574431871 314
21 iso_pu_bacteria 2738541337 2739058850 314
22 iso_pu_bacteria 2861691609 2861695119 314
23 iso_pu_bacteria 2933594066 2933597153 314
24 3300044712 Ga0453684_0001941 Ga0453684_0001941_22260_23222 315
25 iso_pu_bacteria 2643221591 2643964960 315
26 3300005356 Ga0070674_100168910 Ga0070674_1001689102 316
27 3300005459 Ga0068867_100185570 Ga0068867_1001855702 316
28 3300005563 Ga0068855_100074327 Ga0068855_1000743274 316
29 3300009177 Ga0105248_10135122 Ga0105248_101351222 316
30 3300013102 Ga0157371_10014810 Ga0157371_100148106 316
31 3300013104 Ga0157370_10008545 Ga0157370_100085455 316
32 3300021361 Ga0213872_10000063 Ga0213872_1000006325 316
33 3300025932 Ga0207690_10004780 Ga0207690_100047806 316
34 3300044712 Ga0453684_0041288 Ga0453684_0041288_2556_3506 316
35 3300005335 Ga0070666_10001834 Ga0070666_100018346 317
36 3300005338 Ga0068868_100001999 Ga0068868_10000199910 317
37 3300005340 Ga0070689_100029808 Ga0070689_1000298083 317
38 3300005355 Ga0070671_100006127 Ga0070671_1000061277 317
39 3300005364 Ga0070673_100001135 Ga0070673_10000113510 317
40 3300005365 Ga0070688_100003007 Ga0070688_1000030075 317
41 3300005367 Ga0070667_100044700 Ga0070667_1000447003 317
42 3300005436 Ga0070713_100221127 Ga0070713_1002211271 317
43 3300005437 Ga0070710_10077935 Ga0070710_100779353 317
44 3300005439 Ga0070711_100025397 Ga0070711_1000253974 317
45 3300005518 Ga0070699_100001291 Ga0070699_10000129115 317
46 3300005539 Ga0068853_100004714 Ga0068853_1000047145 317
47 3300005543 Ga0070672_100053776 Ga0070672_1000537762 317
48 3300005544 Ga0070686_100058344 Ga0070686_1000583443 317
49 3300005548 Ga0070665_100073513 Ga0070665_1000735134 317
50 3300005563 Ga0068855_100052223 Ga0068855_1000522234 317
51 3300005614 Ga0068856_100044344 Ga0068856_1000443443 317
52 3300005617 Ga0068859_100000752 Ga0068859_1000007525 317
53 3300005618 Ga0068864_100001479 Ga0068864_10000147911 317
54 3300005834 Ga0068851_10159435 Ga0068851_101594352 317
55 3300005841 Ga0068863_100008664 Ga0068863_10000866413 317
56 3300005842 Ga0068858_100003128 Ga0068858_10000312811 317
57 3300005843 Ga0068860_100005794 Ga0068860_10000579410 317
58 3300005844 Ga0068862_100341809 Ga0068862_1003418092 317
59 3300006358 Ga0068871_100002423 Ga0068871_10000242310 317
60 3300006844 Ga0075428_100206995 Ga0075428_1002069952 317
61 3300006880 Ga0075429_100180252 Ga0075429_1001802521 317
62 3300006931 Ga0097620_100000752 Ga0097620_1000007525 317
63 3300009098 Ga0105245_10005949 Ga0105245_100059495 317
64 3300009101 Ga0105247_10032030 Ga0105247_100320302 317
65 3300009147 Ga0114129_10083943 Ga0114129_100839434 317
66 3300009176 Ga0105242_10010848 Ga0105242_100108484 317
67 3300010375 Ga0105239_10001689 Ga0105239_1000168911 317
68 3300011119 Ga0105246_10013581 Ga0105246_100135813 317
69 3300013296 Ga0157374_10001973 Ga0157374_1000197310 317
70 3300013297 Ga0157378_10004445 Ga0157378_1000444510 317
71 3300013306 Ga0163162_10002465 Ga0163162_1000246512 317
72 3300014325 Ga0163163_10000541 Ga0163163_1000054110 317
73 3300014968 Ga0157379_10000597 Ga0157379_1000059721 317
74 3300014969 Ga0157376_10002086 Ga0157376_1000208610 317
75 3300021361 Ga0213872_10144935 Ga0213872_101449351 317
76 3300025303 Ga0209051_1024599 Ga0209051_10245992 317
77 3300025900 Ga0207710_10021934 Ga0207710_100219343 317
78 3300025903 Ga0207680_10000531 Ga0207680_1000053110 317
79 3300025927 Ga0207687_10000968 Ga0207687_100009688 317
80 3300025931 Ga0207644_10004427 Ga0207644_100044274 317
81 3300025934 Ga0207686_10033745 Ga0207686_100337453 317
82 3300025936 Ga0207670_10008880 Ga0207670_100088805 317
83 3300025941 Ga0207711_10000970 Ga0207711_1000097012 317
84 3300025949 Ga0207667_10070624 Ga0207667_100706243 317
85 3300025960 Ga0207651_10011638 Ga0207651_100116384 317
86 3300025986 Ga0207658_10019290 Ga0207658_100192902 317
87 3300026023 Ga0207677_10000206 Ga0207677_1000020619 317
88 3300026035 Ga0207703_10001244 Ga0207703_1000124412 317
89 3300026041 Ga0207639_10003834 Ga0207639_100038342 317
90 3300026088 Ga0207641_10197054 Ga0207641_101970543 317
91 3300026095 Ga0207676_10000386 Ga0207676_1000038619 317
92 3300028379 Ga0268266_10053925 Ga0268266_100539252 317
93 3300028381 Ga0268264_10001587 Ga0268264_1000158715 317
94 3300035118 Ga0373954_0002282 Ga0373954_0002282_6947_7927 317
95 3300035725 Ga0373947_0020648 Ga0373947_0020648_1762_2718 317
96 3300036401 Ga0373937_0074707 Ga0373937_0074707_173_1153 317
97 3300037068 Ga0373925_0063667 Ga0373925_0063667_1634_2590 317
98 3300039447 Ga0436361_0794733 Ga0436361_0794733_24_986 317
99 3300044712 Ga0453684_0023286 Ga0453684_0023286_5740_6699 317
100 3300044712 Ga0453684_0089833 Ga0453684_0089833_2047_3018 317
101 3300044712 Ga0453684_0114818 Ga0453684_0114818_875_1840 317
102 3300044712 Ga0453684_0306054 Ga0453684_0306054_345_1298 317
103 3300048907 Ga0496104_0145860 Ga0496104_0145860_1093_2073 317
104 3300048926 Ga0496123_0008662 Ga0496123_0008662_1859_2815 317
105 3300048928 Ga0496125_0000542 Ga0496125_0000542_28820_29776 317
106 3300050507 nmdc:mga05p37_37594_c1 nmdc:mga05p37_37594_c1_2483_3436 317
107 3300050512 nmdc:mga0n895_52677_c1 nmdc:mga0n895_52677_c1_1368_2321 317
108 3300050514 nmdc:mga08x19_98554_c1 nmdc:mga08x19_98554_c1_886_1842 317
109 iso_pu_bacteria 2516653085 2517081508 317
110 iso_pu_bacteria 2585427526 2585526596 317
111 iso_pu_bacteria 2718217927 2719384947 317
112 iso_pu_bacteria 2718217997 2719664694 317
113 iso_pu_bacteria 2718218199 2720491114 317
114 iso_pu_bacteria 2718218232 2720612481 317
115 iso_pu_bacteria 2718218423 2721398667 317
116 iso_pu_bacteria 2721755556 2723026140 317
117 iso_pu_bacteria 2721755809 2724037480 317
118 iso_pu_bacteria 2721755823 2724109404 317
119 iso_pu_bacteria 2728369352 2730107076 317
120 iso_pu_bacteria 2791355265 2793355125 317
121 iso_pu_bacteria 2802429605 2805926503 317
122 iso_pu_bacteria 2838016132 2838017363 317
123 iso_pu_bacteria 2838048938 2838049155 317
124 iso_pu_bacteria 2838061910 2838063399 317
125 iso_pu_bacteria 2838668709 2838670922 317
126 iso_pu_bacteria 2838686498 2838688527 317
127 iso_pu_bacteria 2838701080 2838703293 317
128 iso_pu_bacteria 2838729681 2838736896 317
129 iso_pu_bacteria 2838742623 2838746798 317
130 iso_pu_bacteria 2841851746 2841852268 317
131 iso_pu_bacteria 2842146304 2842147483 317
132 iso_pu_bacteria 2842156927 2842158658 317
133 iso_pu_bacteria 2842180545 2842182272 317
134 iso_pu_bacteria 2842192696 2842198024 317
135 iso_pu_bacteria 2842229732 2842234717 317
136 iso_pu_bacteria 2842243621 2842248448 317
137 iso_pu_bacteria 2842250916 2842252549 317
138 iso_pu_bacteria 2842257432 2842262379 317
139 iso_pu_bacteria 2842271015 2842272523 317
140 iso_pu_bacteria 2842304105 2842310904 317
141 iso_pu_bacteria 2842311132 2842314820 317
142 iso_pu_bacteria 2842317721 2842318577 317
143 iso_pu_bacteria 2842395702 2842398178 317
144 iso_pu_bacteria 2842447887 2842452617 317
145 iso_pu_bacteria 2842489311 2842493832 317
146 iso_pu_bacteria 2842495871 2842497212 317
147 iso_pu_bacteria 2844454524 2844461420 317
148 iso_pu_bacteria 2933570622 2933577399 317
149 iso_pu_bacteria 8005275841 8005279668 317
150 iso_pu_bacteria 8005395548 8005400300 317
151 iso_pu_bacteria 8005430974 8005437156 317
152 iso_pu_bacteria 8005619151 8005620603 317
153 iso_pu_bacteria 8005695170 8005698701 317
154 iso_pu_bacteria 8018176218 8018182586 317
155 iso_pu_bacteria 8024501048 8024503177 317
156 iso_pu_bacteria 8056382006 8056384671 317
157 3300003323 rootH1_10164923 rootH1_101649234 318
158 3300003790 Ga0055528_1002119 Ga0055528_10021198 318
159 3300003792 Ga0055540_1029508 Ga0055540_10295081 318
160 3300003794 Ga0055531_10000007 Ga0055531_10000007197 318
161 3300005353 Ga0070669_100047295 Ga0070669_1000472953 318
162 3300005366 Ga0070659_100041743 Ga0070659_1000417433 318
163 3300005367 Ga0070667_100030603 Ga0070667_1000306034 318
164 3300005468 Ga0070707_100001508 Ga0070707_10000150815 318
165 3300005518 Ga0070699_100020489 Ga0070699_1000204894 318
166 3300005543 Ga0070672_100234818 Ga0070672_1002348182 318
167 3300006178 Ga0075367_10022886 Ga0075367_100228864 318
168 3300007265 Ga0099794_10084951 Ga0099794_100849511 318
169 3300009092 Ga0105250_10015292 Ga0105250_100152924 318
170 3300009093 Ga0105240_10013204 Ga0105240_100132048 318
171 3300013306 Ga0163162_10000585 Ga0163162_1000058528 318
172 3300013306 Ga0163162_10067129 Ga0163162_100671294 318
173 3300013308 Ga0157375_10185532 Ga0157375_101855323 318
174 3300017792 Ga0163161_10022744 Ga0163161_100227442 318
175 3300025258 Ga0209129_1005065 Ga0209129_10050654 318
176 3300025273 Ga0209673_1002354 Ga0209673_10023549 318
177 3300025294 Ga0209025_1065146 Ga0209025_10651462 318
178 3300025297 Ga0209758_1002328 Ga0209758_100232819 318
179 3300025299 Ga0209256_1013915 Ga0209256_10139151 318
180 3300025303 Ga0209051_1006408 Ga0209051_10064084 318
181 3300025303 Ga0209051_1032346 Ga0209051_10323461 318
182 3300025304 Ga0209257_1000021 Ga0209257_100002131 318
183 3300025728 Ga0207655_1003666 Ga0207655_10036664 318
184 3300025913 Ga0207695_10029730 Ga0207695_100297306 318
185 3300025922 Ga0207646_10002835 Ga0207646_1000283515 318
186 3300025923 Ga0207681_10007422 Ga0207681_100074223 318
187 3300025932 Ga0207690_10077515 Ga0207690_100775152 318
188 3300025940 Ga0207691_10240359 Ga0207691_102403592 318
189 3300025986 Ga0207658_10029536 Ga0207658_100295364 318
190 3300028800 Ga0265338_10001525 Ga0265338_100015258 318
191 3300031250 Ga0265331_10009181 Ga0265331_100091812 318
192 3300031250 Ga0265331_10055529 Ga0265331_100555292 318
193 3300037471 Ga0395905_0005588 Ga0395905_0005588_8178_9137 318
194 3300039062 Ga0400483_224703 Ga0400483_224703_1523_2482 318
195 3300039447 Ga0436361_0811061 Ga0436361_0811061_128792_129751 318
196 3300044712 Ga0453684_0028773 Ga0453684_0028773_2462_3421 318
197 3300046452 Ga0495617_011223 Ga0495617_011223_1150_2106 318
198 3300046491 Ga0495584_0000511 Ga0495584_0000511_19758_20714 318
199 3300046491 Ga0495584_0015899 Ga0495584_0015899_2768_3724 318
200 3300046492 Ga0495585_0004565 Ga0495585_0004565_2293_3249 318
201 3300046492 Ga0495585_0006751 Ga0495585_0006751_4636_5592 318
202 3300046507 Ga0495606_0104633 Ga0495606_0104633_608_1579 318
203 3300046512 Ga0495610_0011551 Ga0495610_0011551_1859_2830 318
204 3300046513 Ga0495616_0016554 Ga0495616_0016554_2708_3664 318
205 3300046518 Ga0495631_0039286 Ga0495631_0039286_290_1246 318
206 3300046522 Ga0495643_0006006 Ga0495643_0006006_5144_6115 318
207 3300046542 Ga0495597_0000834 Ga0495597_0000834_9460_10416 318
208 3300046557 Ga0495622_0002744 Ga0495622_0002744_2179_3135 318
209 3300046558 Ga0495633_0002543 Ga0495633_0002543_4754_5710 318
210 3300046648 Ga0495611_0002210 Ga0495611_0002210_2228_3184 318
211 3300046665 Ga0495661_0007280 Ga0495661_0007280_4692_5648 318
212 3300046674 Ga0495588_0001986 Ga0495588_0001986_6006_6962 318
213 3300046675 Ga0495657_0052485 Ga0495657_0052485_1662_2633 318
214 3300046691 Ga0495670_0017136 Ga0495670_0017136_603_1559 318
215 3300046694 Ga0495649_0022586 Ga0495649_0022586_1420_2379 318
216 3300046809 Ga0495600_0006235 Ga0495600_0006235_2651_3622 318
217 3300047321 Ga0495676_0000093 Ga0495676_0000093_16181_17137 318
218 3300047472 Ga0495686_0215559 Ga0495686_0215559_24_995 318
219 3300048903 Ga0496100_0003277 Ga0496100_0003277_6827_7786 318
220 3300048904 Ga0496101_0006948 Ga0496101_0006948_1397_2356 318
221 3300048905 Ga0496102_0027264 Ga0496102_0027264_3198_4157 318
222 3300048906 Ga0496103_0008681 Ga0496103_0008681_2279_3238 318
223 3300048908 Ga0496105_0005455 Ga0496105_0005455_1269_2228 318
224 3300048911 Ga0496108_0099297 Ga0496108_0099297_1006_1983 318
225 3300048912 Ga0496109_0019728 Ga0496109_0019728_2294_3271 318
226 3300048912 Ga0496109_0041663 Ga0496109_0041663_161_1120 318
227 3300048914 Ga0496111_0011447 Ga0496111_0011447_3294_4253 318
228 3300048915 Ga0496112_0045130 Ga0496112_0045130_839_1816 318
229 3300048917 Ga0496114_0176505 Ga0496114_0176505_432_1391 318
230 3300048924 Ga0496121_0011434 Ga0496121_0011434_7950_8921 318
231 3300048925 Ga0496122_0166811 Ga0496122_0166811_51_1016 318
232 3300048927 Ga0496124_0014314 Ga0496124_0014314_4849_5814 318
233 3300049460 Ga0495682_0001416 Ga0495682_0001416_10013_10969 318
234 3300050491 nmdc:mga00v17_175471_c1 nmdc:mga00v17_175471_c1_235_1194 318
235 3300053086 Ga0500578_0012282 Ga0500578_0012282_1996_2967 318
236 3300053090 Ga0500646_0008857 Ga0500646_0008857_1289_2248 318
237 3300053109 Ga0500569_000485 Ga0500569_000485_2867_3838 318
238 3300053151 Ga0500604_0000001 Ga0500604_0000001_31185_32141 318
239 3300053153 Ga0500616_0003150 Ga0500616_0003150_9910_10881 318
240 3300053177 Ga0500636_0034558 Ga0500636_0034558_42_1013 318

Structural Annotation

Top 5 Hits

ID Description Score Start End
8spo-assembly1.cif.gz_A tetramerized activation of mapsparta bound with nad+ 0.7416 155 201
4qqs-assembly1.cif.gz_A crystal structure of a thermostable family-43 glycoside hydrolase 0.7333 18 315
5muj-assembly1.cif.gz_A bt0996 rgii chain b complex 0.7321 3 318
7zei-assembly4.cif.gz_D thermostable gh159 glycoside hydrolase from caldicellulosiruptor at 1.7 a 0.7316 4 317
5mui-assembly1.cif.gz_A glycoside hydrolase bt_0996 0.729 3 318
ID Description Score Start End Superfamily
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.863 155 318 2.115.10.20
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8325 155 318 2.115.10.20
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8128 1 149 2.115.10.20
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8078 1 149 2.115.10.20
4qqsA00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7333 18 315 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A6H9Y517-F1-model_v4 Glycosylase 0.9724 1 318
AF-A0A2S7UVM6-F1-model_v4 Glycosylase 0.9723 1 318
AF-A0A2S7UVM6-F1-model_v4 Glycosylase 0.9693 1 318
AF-A0A352A7B3-F1-model_v4 Glycosylase 0.962 1 317
AF-A0A2H0YX23-F1-model_v4 Glycosylase 0.9617 76 318

Feature Viewer

pLDDT pTM Quality
91.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map