F352902

General Info

Members Datasets Scaffolds Average Seq Length
240 159 238 276

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10003245|Ga0213876_100032453
Length 310
Sequence MNVPRAKPPTGYKRHITTDVNPNQLVATTGGSMPKFRKAHELLIEPGRTEKNYWGDLWRYRELFYILAWRDISVRYKQTAIGVLWALLRPFLAMVIFVVVFGRIAKMPSNGIPYPILVFSAMLPWQFFSSSLSEASTSLVGNANLISKIYFPRLIIPAGAVITSLVDFLISAALLGVLMIWLRFVPDWRLITLPLFTLLAFLAALGPGLLLAALTVKFRDFRYVIPFIVQFGLFISPVGFSSDVIPENWRLVYSLNPIVGVIDGFRWAICRGEAHIYAPGFILSVGIVGLFLLIGIRYFRNTEKTFADVI

Samples

Sample ID Description Type Environment
1 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
2 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
135 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
136 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
137 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
138 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
139 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
140 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
141 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 0.42
Rhizosphere 87.92
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10038943 3300003320 Unclassified 2276
2 rootH2_10056441 3300003320 Bacteria 3163
3 rootH2_10175112 3300003320 Bacteria 2141
4 rootL2_10354980 3300003322 Unclassified 1935
5 rootH1_10064251 3300003323 Bacteria 29046
6 rootH1_10279533 3300003323 Bacteria 3974
7 rootH1_10336301 3300003323 Bacteria 1582
8 Ga0070680_100012303 3300005336 Bacteria 6646
9 Ga0070689_100005458 3300005340 Bacteria 8684
10 Ga0070689_100030569 3300005340 Bacteria 4089
11 Ga0070689_100067047 3300005340 Unclassified 2797
12 Ga0070674_100008778 3300005356 Bacteria 6031
13 Ga0070688_100066291 3300005365 Bacteria 2297
14 Ga0070713_100005673 3300005436 Bacteria 8568
15 Ga0070708_100028169 3300005445 Bacteria 4831
16 Ga0070708_100061790 3300005445 Bacteria 3348
17 Ga0070681_10042472 3300005458 Bacteria 4556
18 Ga0070681_10078311 3300005458 Bacteria 3262
19 Ga0070681_10125714 3300005458 Bacteria 2497
20 Ga0070681_10252356 3300005458 Bacteria 1676
21 Ga0070706_100325772 3300005467 Unclassified 1433
22 Ga0070707_100021657 3300005468 Bacteria 6077
23 Ga0070707_100253491 3300005468 Bacteria 1712
24 Ga0070707_100292829 3300005468 Bacteria 1582
25 Ga0070698_100017573 3300005471 Bacteria 7538
26 Ga0070698_100096660 3300005471 Bacteria 2930
27 Ga0070698_100324859 3300005471 Bacteria 1470
28 Ga0070699_100040736 3300005518 Bacteria 4021
29 Ga0070699_100387556 3300005518 Bacteria 1262
30 Ga0070679_100264829 3300005530 Bacteria 1674
31 Ga0070684_100167134 3300005535 Bacteria 1997
32 Ga0070697_100232316 3300005536 Bacteria 1573
33 Ga0068853_100000539 3300005539 Bacteria 25719
34 Ga0068855_100010383 3300005563 Bacteria 11234
35 Ga0068855_100025784 3300005563 Bacteria 7030
36 Ga0068855_100503939 3300005563 Bacteria 1315
37 Ga0068857_100131602 3300005577 Bacteria 2256
38 Ga0068857_100752819 3300005577 Bacteria 928
39 Ga0068856_100078489 3300005614 Bacteria 3273
40 Ga0068852_100280116 3300005616 Bacteria 1607
41 Ga0068859_100094821 3300005617 Bacteria 3037
42 Ga0068859_100604072 3300005617 Unclassified 1190
43 Ga0081455_10010393 3300005937 Bacteria 9455
44 Ga0081455_10036304 3300005937 Bacteria 4390
45 Ga0081539_10002218 3300005985 Bacteria 28319
46 Ga0070717_10015482 3300006028 Bacteria 5892
47 Ga0068871_100483203 3300006358 Bacteria 1114
48 Ga0075428_100196333 3300006844 Bacteria 2182
49 Ga0075430_100137009 3300006846 Bacteria 2039
50 Ga0075430_100242178 3300006846 Bacteria 1494
51 Ga0075431_100140613 3300006847 Bacteria 2488
52 Ga0097620_100094822 3300006931 Bacteria 3037
53 Ga0097620_100604030 3300006931 Unclassified 1190
54 Ga0075435_100366420 3300007076 Bacteria 1237
55 Ga0105240_10000226 3300009093 Bacteria 112655
56 Ga0105240_10024870 3300009093 Bacteria 7883
57 Ga0105240_10046590 3300009093 Bacteria 5493
58 Ga0105240_10072317 3300009093 Bacteria 4262
59 Ga0111539_10067107 3300009094 Bacteria 4237
60 Ga0114129_10146997 3300009147 Bacteria 3228
61 Ga0105241_10195472 3300009174 Unclassified 1686
62 Ga0105241_10435174 3300009174 Bacteria 1157
63 Ga0105237_10013668 3300009545 Bacteria 8502
64 Ga0105237_10102027 3300009545 Bacteria 2861
65 Ga0105238_10002776 3300009551 Bacteria 17473
66 Ga0105238_10006147 3300009551 Bacteria 11919
67 Ga0105238_10030315 3300009551 Bacteria 5505
68 Ga0105238_10134101 3300009551 Bacteria 2454
69 Ga0105249_10029392 3300009553 Unclassified 4963
70 Ga0105239_10029890 3300010375 Bacteria 5992
71 Ga0105239_10216471 3300010375 Unclassified 2148
72 Ga0105239_10549306 3300010375 Bacteria 1315
73 Ga0157370_10214454 3300013104 Bacteria 1784
74 Ga0157369_10005840 3300013105 Bacteria 14306
75 Ga0157369_10025761 3300013105 Bacteria 6525
76 Ga0157374_10202570 3300013296 Bacteria 1944
77 Ga0163162_10000151 3300013306 Bacteria 64454
78 Ga0163162_10000834 3300013306 Bacteria 28679
79 Ga0163162_10103036 3300013306 Bacteria 2948
80 Ga0163162_10186067 3300013306 Bacteria 2204
81 Ga0157375_10000006 3300013308 Bacteria 384086
82 Ga0163163_10000153 3300014325 Bacteria 71877
83 Ga0163163_10039701 3300014325 Bacteria 4595
84 Ga0157379_10073823 3300014968 Unclassified 3053
85 Ga0157379_10318385 3300014968 Bacteria 1420
86 Ga0163161_10052311 3300017792 Unclassified 2960
87 Ga0213872_10020123 3300021361 Bacteria 3075
88 Ga0213872_10113044 3300021361 Unclassified 1205
89 Ga0213876_10002530 3300021384 Bacteria 10702
90 Ga0213876_10003245 3300021384 Bacteria 9330
91 Ga0213871_10024350 3300021441 Bacteria 1532
92 Ga0213871_10037798 3300021441 Unclassified 1286
93 Ga0207692_10069116 3300025898 Unclassified 1855
94 Ga0207695_10000313 3300025913 Bacteria 117072
95 Ga0207695_10033382 3300025913 Bacteria 5614
96 Ga0207695_10034626 3300025913 Bacteria 5488
97 Ga0207695_10276217 3300025913 Unclassified 1575
98 Ga0207695_10301431 3300025913 Unclassified 1494
99 Ga0207660_10058853 3300025917 Bacteria 2756
100 Ga0207657_10103310 3300025919 Bacteria 2362
101 Ga0207652_10030381 3300025921 Bacteria 4524
102 Ga0207652_10133271 3300025921 Bacteria 2217
103 Ga0207646_10004105 3300025922 Bacteria 16042
104 Ga0207646_10021970 3300025922 Bacteria 5886
105 Ga0207646_10496587 3300025922 Unclassified 1100
106 Ga0207694_10020388 3300025924 Bacteria 5016
107 Ga0207694_10034591 3300025924 Bacteria 3875
108 Ga0207694_10041939 3300025924 Bacteria 3528
109 Ga0207694_10099844 3300025924 Bacteria 2299
110 Ga0207700_10065071 3300025928 Bacteria 2780
111 Ga0207670_10049963 3300025936 Unclassified 2800
112 Ga0207670_10124292 3300025936 Bacteria 1880
113 Ga0207689_10282426 3300025942 Bacteria 1375
114 Ga0207667_10007796 3300025949 Bacteria 12797
115 Ga0207667_10030876 3300025949 Bacteria 5790
116 Ga0207667_10312278 3300025949 Bacteria 1606
117 Ga0207712_10025074 3300025961 Unclassified 3958
118 Ga0207639_10006585 3300026041 Bacteria 7898
119 Ga0207702_10274862 3300026078 Bacteria 1590
120 Ga0207674_10011071 3300026116 Bacteria 10143
121 Ga0207674_10767615 3300026116 Bacteria 930
122 Ga0207675_100256818 3300026118 Bacteria 1693
123 Ga0207698_10174981 3300026142 Bacteria 1894
124 Ga0207428_10004064 3300027907 Bacteria 14028
125 Ga0268266_10308496 3300028379 Bacteria 1478
126 Ga0307515_10001093 3300028794 Bacteria 62142
127 Ga0265338_10273310 3300028800 Unclassified 1238
128 Ga0265329_10085966 3300031242 Unclassified 997
129 Ga0265327_10000514 3300031251 Bacteria 66685
130 Ga0265327_10000735 3300031251 Bacteria 51211
131 Ga0265316_10000222 3300031344 Bacteria 66528
132 Ga0307408_100000810 3300031548 Bacteria 25013
133 Ga0307514_10186093 3300031649 Unclassified 1331
134 Ga0307405_10255406 3300031731 Bacteria 1306
135 Ga0307406_10147863 3300031901 Bacteria 1672
136 Ga0307412_10002488 3300031911 Bacteria 10259
137 Ga0307412_10014151 3300031911 Unclassified 4698
138 Ga0307409_100100915 3300031995 Bacteria 2393
139 Ga0307414_10542962 3300032004 Bacteria 1035
140 Ga0307415_100103750 3300032126 Bacteria 2093
141 Ga0307510_10002707 3300033180 Bacteria 20249
142 Ga0373923_0038936 3300035111 Bacteria 1950
143 Ga0373956_0058010 3300035119 Bacteria 1750
144 Ga0373955_0010804 3300035172 Bacteria 4329
145 Ga0373927_0021637 3300035695 Unclassified 4216
146 Ga0373933_0015632 3300035724 Bacteria 4233
147 Ga0373937_0004642 3300036401 Bacteria 11665
148 Ga0316582_0059325 3300036647 Bacteria 2450
149 Ga0373925_0063381 3300037068 Unclassified 2781
150 Ga0395899_0031262 3300037312 Bacteria 4002
151 Ga0395898_0068453 3300037466 Bacteria 3435
152 Ga0395898_0496260 3300037466 Unclassified 1161
153 Ga0436364_1354739 3300037853 Bacteria 3931
154 Ga0395901_0072869 3300038443 Bacteria 3581
155 Ga0436365_0397642 3300039437 Bacteria 11934
156 Ga0436365_1047973 3300039437 Bacteria 60576
157 Ga0436365_1718574 3300039437 Unclassified 1305
158 Ga0436360_0116530 3300039438 Bacteria 1482
159 Ga0436360_0443683 3300039438 Bacteria 1339
160 Ga0436360_0747772 3300039438 Unclassified 2690
161 Ga0436360_1343778 3300039438 Bacteria 2130
162 Ga0436361_0033945 3300039447 Bacteria 2377
163 Ga0436361_0039481 3300039447 Bacteria 11428
164 Ga0436361_0252506 3300039447 Bacteria 13984
165 Ga0436361_0975938 3300039447 Bacteria 4455
166 Ga0436361_0991173 3300039447 Bacteria 1328
167 Ga0436361_1045855 3300039447 Bacteria 1707
168 Ga0436363_1361073 3300039450 Unclassified 1185
169 Ga0436362_0032231 3300039453 Bacteria 1247
170 Ga0451577_0000134 3300042876 Bacteria 165856
171 Ga0451577_0299483 3300042876 Bacteria 1457
172 Ga0466964_0066942 3300044706 Unclassified 1509
173 Ga0453684_0000426 3300044712 Bacteria 172005
174 Ga0453684_0009353 3300044712 Bacteria 17175
175 Ga0453684_0031499 3300044712 Bacteria 7451
176 Ga0453684_0034702 3300044712 Bacteria 6992
177 Ga0453684_0088858 3300044712 Bacteria 3824
178 Ga0453684_0131332 3300044712 Bacteria 3004
179 Ga0453684_0379183 3300044712 Bacteria 1588
180 Ga0451576_0077822 3300045051 Bacteria 3452
181 Ga0495641_0110117 3300046461 Bacteria 1229
182 Ga0495653_0266575 3300046463 Unclassified 1130
183 Ga0495608_0365817 3300046511 Bacteria 886
184 Ga0495630_0000305 3300046517 Bacteria 39378
185 Ga0495586_0000271 3300046535 Bacteria 33410
186 Ga0495634_0070397 3300046642 Bacteria 2306
187 Ga0495623_0129577 3300046679 Bacteria 1512
188 Ga0495674_0000767 3300047319 Bacteria 30476
189 Ga0495672_0201027 3300047320 Bacteria 996
190 Ga0495676_0091065 3300047321 Bacteria 2281
191 Ga0495680_0139366 3300047322 Bacteria 1776
192 Ga0495602_0156923 3300048088 Bacteria 1781
193 Ga0496109_0000017 3300048912 Bacteria 200904
194 Ga0496122_0002799 3300048925 Bacteria 23967
195 Ga0496123_0000689 3300048926 Bacteria 55748
196 Ga0496124_0000385 3300048927 Bacteria 80586
197 Ga0501032_0047859 3300049569 Bacteria 2887
198 Ga0501034_0005603 3300049571 Bacteria 13677
199 Ga0501036_0003080 3300049572 Bacteria 13296
200 Ga0501038_0023546 3300049574 Bacteria 5504
201 Ga0501043_0000552 3300049579 Bacteria 33516
202 Ga0501046_0001254 3300049580 Bacteria 24556
203 Ga0501047_0001218 3300049581 Bacteria 25507
204 Ga0501048_0002570 3300049582 Bacteria 13892
205 Ga0501073_0000922 3300049589 Bacteria 21190
206 Ga0501074_0002261 3300049590 Bacteria 13392
207 Ga0501074_0368106 3300049590 Bacteria 1020
208 Ga0501217_008566 3300049661 Bacteria 2212
209 Ga0501235_002247 3300049669 Unclassified 4154
210 Ga0501243_017982 3300049675 Bacteria 1149
211 Ga0501249_023638 3300049679 Bacteria 1350
212 Ga0501257_040607 3300049686 Bacteria 1142
213 Ga0501258_002609 3300049687 Bacteria 1597
214 Ga0501259_017837 3300049688 Unclassified 1234
215 Ga0501221_008525 3300049704 Unclassified 1783
216 Ga0501080_0000977 3300049742 Bacteria 23417
217 Ga0501083_0025600 3300049744 Bacteria 4084
218 Ga0501274_001645 3300049771 Bacteria 1718
219 Ga0501035_0004468 3300049822 Bacteria 13275
220 Ga0501045_0060312 3300049824 Bacteria 2781
221 nmdc:mga05p37_111357_c1 3300050507 Bacteria 3367
222 nmdc:mga05p37_121615_c1 3300050507 Bacteria 3206
223 nmdc:mga0qj67_226797_c1 3300050509 Bacteria 1516
224 nmdc:mga06r32_137004_c1 3300050510 Bacteria 2423
225 nmdc:mga06r32_152358_c1 3300050510 Unclassified 2291
226 nmdc:mga06r32_201340_c1 3300050510 Bacteria 1979
227 nmdc:mga06r32_268736_c1 3300050510 Bacteria 1693
228 nmdc:mga08y16_14520_c1 3300050511 Bacteria 8287
229 nmdc:mga0rr50_291161_c1 3300050513 Bacteria 1364
230 nmdc:mga0a205_250532_c1 3300050515 Bacteria 1650
231 Ga0495601_0078483 3300053077 Unclassified 2116
232 Ga0500610_0131553 3300053079 Bacteria 1272
233 Ga0495619_0145569 3300053085 Bacteria 1633
234 Ga0500641_0002423 3300053096 Bacteria 6618
235 Ga0500641_0114393 3300053096 Bacteria 1162
236 Ga0500650_0127492 3300053098 Bacteria 1184
237 Ga0500562_036904 3300053108 Bacteria 1297
238 Ga0500616_0004434 3300053153 Bacteria 10007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10336301 rootH1_103363012 256
2 3300032004 Ga0307414_10542962 Ga0307414_105429621 259
3 3300031731 Ga0307405_10255406 Ga0307405_102554062 262
4 3300031901 Ga0307406_10147863 Ga0307406_101478632 262
5 3300031911 Ga0307412_10014151 Ga0307412_100141512 262
6 3300031995 Ga0307409_100100915 Ga0307409_1001009152 262
7 3300032126 Ga0307415_100103750 Ga0307415_1001037502 262
8 3300044712 Ga0453684_0034702 Ga0453684_0034702_119_910 262
9 3300049661 Ga0501217_008566 Ga0501217_008566_319_1131 262
10 3300049669 Ga0501235_002247 Ga0501235_002247_2901_3713 262
11 3300049675 Ga0501243_017982 Ga0501243_017982_74_886 262
12 3300049679 Ga0501249_023638 Ga0501249_023638_340_1152 262
13 3300049686 Ga0501257_040607 Ga0501257_040607_187_999 262
14 3300049687 Ga0501258_002609 Ga0501258_002609_649_1461 262
15 3300049688 Ga0501259_017837 Ga0501259_017837_248_1060 262
16 3300049704 Ga0501221_008525 Ga0501221_008525_939_1751 262
17 3300049771 Ga0501274_001645 Ga0501274_001645_705_1517 262
18 3300003320 rootH2_10175112 rootH2_101751122 263
19 3300005518 Ga0070699_100040736 Ga0070699_1000407363 265
20 3300005937 Ga0081455_10036304 Ga0081455_100363042 268
21 3300005563 Ga0068855_100503939 Ga0068855_1005039392 269
22 3300025949 Ga0207667_10312278 Ga0207667_103122781 269
23 3300005445 Ga0070708_100028169 Ga0070708_1000281691 270
24 3300005467 Ga0070706_100325772 Ga0070706_1003257722 270
25 3300005471 Ga0070698_100324859 Ga0070698_1003248592 270
26 3300042876 Ga0451577_0000134 Ga0451577_0000134_42108_42923 270
27 3300044706 Ga0466964_0066942 Ga0466964_0066942_554_1366 270
28 3300044712 Ga0453684_0000426 Ga0453684_0000426_129060_129875 270
29 3300050507 nmdc:mga05p37_121615_c1 nmdc:mga05p37_121615_c1_910_1743 270
30 3300005356 Ga0070674_100008778 Ga0070674_1000087783 271
31 3300005436 Ga0070713_100005673 Ga0070713_1000056736 271
32 3300005445 Ga0070708_100061790 Ga0070708_1000617902 271
33 3300005468 Ga0070707_100253491 Ga0070707_1002534912 271
34 3300005468 Ga0070707_100292829 Ga0070707_1002928291 271
35 3300005471 Ga0070698_100017573 Ga0070698_1000175733 271
36 3300005536 Ga0070697_100232316 Ga0070697_1002323162 271
37 3300005563 Ga0068855_100010383 Ga0068855_1000103837 271
38 3300005577 Ga0068857_100131602 Ga0068857_1001316022 271
39 3300006028 Ga0070717_10015482 Ga0070717_100154827 271
40 3300009093 Ga0105240_10024870 Ga0105240_100248705 271
41 3300009174 Ga0105241_10435174 Ga0105241_104351742 271
42 3300009545 Ga0105237_10013668 Ga0105237_100136682 271
43 3300009545 Ga0105237_10102027 Ga0105237_101020271 271
44 3300009551 Ga0105238_10002776 Ga0105238_1000277617 271
45 3300009551 Ga0105238_10134101 Ga0105238_101341012 271
46 3300010375 Ga0105239_10216471 Ga0105239_102164712 271
47 3300013105 Ga0157369_10025761 Ga0157369_100257615 271
48 3300021361 Ga0213872_10020123 Ga0213872_100201234 271
49 3300021361 Ga0213872_10113044 Ga0213872_101130441 271
50 3300021384 Ga0213876_10002530 Ga0213876_100025306 271
51 3300021441 Ga0213871_10024350 Ga0213871_100243502 271
52 3300021441 Ga0213871_10037798 Ga0213871_100377982 271
53 3300025898 Ga0207692_10069116 Ga0207692_100691162 271
54 3300025913 Ga0207695_10276217 Ga0207695_102762172 271
55 3300025913 Ga0207695_10301431 Ga0207695_103014311 271
56 3300025922 Ga0207646_10496587 Ga0207646_104965871 271
57 3300025924 Ga0207694_10020388 Ga0207694_100203884 271
58 3300025924 Ga0207694_10099844 Ga0207694_100998442 271
59 3300025928 Ga0207700_10065071 Ga0207700_100650712 271
60 3300025949 Ga0207667_10007796 Ga0207667_100077966 271
61 3300026116 Ga0207674_10011071 Ga0207674_100110716 271
62 3300028800 Ga0265338_10273310 Ga0265338_102733101 271
63 3300031251 Ga0265327_10000735 Ga0265327_1000073512 271
64 3300033180 Ga0307510_10002707 Ga0307510_1000270718 271
65 3300037312 Ga0395899_0031262 Ga0395899_0031262_362_1180 271
66 3300037466 Ga0395898_0068453 Ga0395898_0068453_2367_3185 271
67 3300037853 Ga0436364_1354739 Ga0436364_1354739_1385_2206 271
68 3300038443 Ga0395901_0072869 Ga0395901_0072869_2708_3526 271
69 3300039437 Ga0436365_1047973 Ga0436365_1047973_54990_55811 271
70 3300039438 Ga0436360_0116530 Ga0436360_0116530_130_948 271
71 3300039438 Ga0436360_0443683 Ga0436360_0443683_438_1256 271
72 3300039438 Ga0436360_0747772 Ga0436360_0747772_311_1132 271
73 3300039438 Ga0436360_1343778 Ga0436360_1343778_210_1031 271
74 3300039447 Ga0436361_0033945 Ga0436361_0033945_428_1246 271
75 3300039447 Ga0436361_0039481 Ga0436361_0039481_1689_2507 271
76 3300039447 Ga0436361_0252506 Ga0436361_0252506_4444_5265 271
77 3300039447 Ga0436361_0975938 Ga0436361_0975938_2051_2872 271
78 3300039447 Ga0436361_0991173 Ga0436361_0991173_471_1292 271
79 3300039447 Ga0436361_1045855 Ga0436361_1045855_731_1552 271
80 3300039450 Ga0436363_1361073 Ga0436363_1361073_255_1073 271
81 3300039453 Ga0436362_0032231 Ga0436362_0032231_136_954 271
82 3300046461 Ga0495641_0110117 Ga0495641_0110117_25_843 271
83 3300046517 Ga0495630_0000305 Ga0495630_0000305_8060_8878 271
84 3300046535 Ga0495586_0000271 Ga0495586_0000271_8080_8898 271
85 3300046642 Ga0495634_0070397 Ga0495634_0070397_951_1769 271
86 3300047319 Ga0495674_0000767 Ga0495674_0000767_26503_27321 271
87 3300047321 Ga0495676_0091065 Ga0495676_0091065_1382_2200 271
88 3300005340 Ga0070689_100005458 Ga0070689_1000054585 272
89 3300005340 Ga0070689_100030569 Ga0070689_1000305695 272
90 3300005340 Ga0070689_100067047 Ga0070689_1000670473 272
91 3300005365 Ga0070688_100066291 Ga0070688_1000662911 272
92 3300005458 Ga0070681_10042472 Ga0070681_100424723 272
93 3300005468 Ga0070707_100021657 Ga0070707_1000216575 272
94 3300005471 Ga0070698_100096660 Ga0070698_1000966605 272
95 3300005577 Ga0068857_100752819 Ga0068857_1007528192 272
96 3300006844 Ga0075428_100196333 Ga0075428_1001963332 272
97 3300006846 Ga0075430_100137009 Ga0075430_1001370092 272
98 3300009093 Ga0105240_10000226 Ga0105240_1000022627 272
99 3300009147 Ga0114129_10146997 Ga0114129_101469974 272
100 3300013296 Ga0157374_10202570 Ga0157374_102025702 272
101 3300013306 Ga0163162_10186067 Ga0163162_101860672 272
102 3300025913 Ga0207695_10000313 Ga0207695_1000031372 272
103 3300025922 Ga0207646_10021970 Ga0207646_100219705 272
104 3300025936 Ga0207670_10049963 Ga0207670_100499631 272
105 3300025936 Ga0207670_10124292 Ga0207670_101242922 272
106 3300026116 Ga0207674_10767615 Ga0207674_107676151 272
107 3300028794 Ga0307515_10001093 Ga0307515_1000109354 272
108 3300031649 Ga0307514_10186093 Ga0307514_101860932 272
109 3300046463 Ga0495653_0266575 Ga0495653_0266575_109_930 272
110 3300048925 Ga0496122_0002799 Ga0496122_0002799_11606_12427 272
111 3300048926 Ga0496123_0000689 Ga0496123_0000689_43361_44182 272
112 3300048927 Ga0496124_0000385 Ga0496124_0000385_9009_9830 272
113 3300050510 nmdc:mga06r32_152358_c1 nmdc:mga06r32_152358_c1_1152_1973 272
114 3300053153 Ga0500616_0004434 Ga0500616_0004434_198_1019 272
115 3300005336 Ga0070680_100012303 Ga0070680_1000123033 273
116 3300005458 Ga0070681_10125714 Ga0070681_101257142 273
117 3300005535 Ga0070684_100167134 Ga0070684_1001671341 273
118 3300005539 Ga0068853_100000539 Ga0068853_10000053914 273
119 3300005616 Ga0068852_100280116 Ga0068852_1002801162 273
120 3300005617 Ga0068859_100094821 Ga0068859_1000948212 273
121 3300006931 Ga0097620_100094822 Ga0097620_1000948222 273
122 3300009093 Ga0105240_10046590 Ga0105240_100465906 273
123 3300009093 Ga0105240_10072317 Ga0105240_100723175 273
124 3300009174 Ga0105241_10195472 Ga0105241_101954722 273
125 3300010375 Ga0105239_10029890 Ga0105239_100298906 273
126 3300010375 Ga0105239_10549306 Ga0105239_105493062 273
127 3300013306 Ga0163162_10000151 Ga0163162_100001518 273
128 3300013306 Ga0163162_10103036 Ga0163162_101030362 273
129 3300013308 Ga0157375_10000006 Ga0157375_10000006267 273
130 3300014325 Ga0163163_10000153 Ga0163163_100001538 273
131 3300025913 Ga0207695_10033382 Ga0207695_100333822 273
132 3300025913 Ga0207695_10034626 Ga0207695_100346262 273
133 3300025917 Ga0207660_10058853 Ga0207660_100588532 273
134 3300025919 Ga0207657_10103310 Ga0207657_101033102 273
135 3300025921 Ga0207652_10030381 Ga0207652_100303813 273
136 3300026041 Ga0207639_10006585 Ga0207639_100065852 273
137 3300026118 Ga0207675_100256818 Ga0207675_1002568182 273
138 3300026142 Ga0207698_10174981 Ga0207698_101749812 273
139 3300031242 Ga0265329_10085966 Ga0265329_100859661 273
140 3300031251 Ga0265327_10000514 Ga0265327_1000051425 273
141 3300031344 Ga0265316_10000222 Ga0265316_1000022230 273
142 3300031548 Ga0307408_100000810 Ga0307408_1000008106 273
143 3300031911 Ga0307412_10002488 Ga0307412_100024887 273
144 3300035119 Ga0373956_0058010 Ga0373956_0058010_708_1532 273
145 3300035172 Ga0373955_0010804 Ga0373955_0010804_1165_1989 273
146 3300035724 Ga0373933_0015632 Ga0373933_0015632_410_1234 273
147 3300036647 Ga0316582_0059325 Ga0316582_0059325_410_1234 273
148 3300039437 Ga0436365_1718574 Ga0436365_1718574_246_1070 273
149 3300042876 Ga0451577_0299483 Ga0451577_0299483_378_1202 273
150 3300044712 Ga0453684_0031499 Ga0453684_0031499_4988_5812 273
151 3300046511 Ga0495608_0365817 Ga0495608_0365817_14_838 273
152 3300046679 Ga0495623_0129577 Ga0495623_0129577_438_1262 273
153 3300047322 Ga0495680_0139366 Ga0495680_0139366_264_1088 273
154 3300048088 Ga0495602_0156923 Ga0495602_0156923_590_1414 273
155 3300049569 Ga0501032_0047859 Ga0501032_0047859_1106_1933 273
156 3300049571 Ga0501034_0005603 Ga0501034_0005603_7594_8421 273
157 3300049572 Ga0501036_0003080 Ga0501036_0003080_1219_2046 273
158 3300049574 Ga0501038_0023546 Ga0501038_0023546_1598_2425 273
159 3300049579 Ga0501043_0000552 Ga0501043_0000552_20980_21807 273
160 3300049580 Ga0501046_0001254 Ga0501046_0001254_1600_2427 273
161 3300049581 Ga0501047_0001218 Ga0501047_0001218_20533_21360 273
162 3300049582 Ga0501048_0002570 Ga0501048_0002570_10433_11260 273
163 3300049589 Ga0501073_0000922 Ga0501073_0000922_19424_20251 273
164 3300049590 Ga0501074_0002261 Ga0501074_0002261_7594_8421 273
165 3300049742 Ga0501080_0000977 Ga0501080_0000977_4364_5191 273
166 3300049744 Ga0501083_0025600 Ga0501083_0025600_241_1068 273
167 3300049822 Ga0501035_0004468 Ga0501035_0004468_639_1466 273
168 3300049824 Ga0501045_0060312 Ga0501045_0060312_1602_2429 273
169 3300053077 Ga0495601_0078483 Ga0495601_0078483_148_972 273
170 3300053085 Ga0495619_0145569 Ga0495619_0145569_548_1372 273
171 3300053096 Ga0500641_0002423 Ga0500641_0002423_1355_2188 273
172 3300003323 rootH1_10279533 rootH1_102795332 274
173 3300005937 Ga0081455_10010393 Ga0081455_100103933 274
174 3300006846 Ga0075430_100242178 Ga0075430_1002421781 274
175 3300006847 Ga0075431_100140613 Ga0075431_1001406133 274
176 3300007076 Ga0075435_100366420 Ga0075435_1003664202 274
177 3300009094 Ga0111539_10067107 Ga0111539_100671074 274
178 3300009551 Ga0105238_10030315 Ga0105238_100303152 274
179 3300014325 Ga0163163_10039701 Ga0163163_100397015 274
180 3300014968 Ga0157379_10318385 Ga0157379_103183852 274
181 3300025924 Ga0207694_10041939 Ga0207694_100419392 274
182 3300027907 Ga0207428_10004064 Ga0207428_100040645 274
183 3300035695 Ga0373927_0021637 Ga0373927_0021637_150_989 274
184 3300037068 Ga0373925_0063381 Ga0373925_0063381_1253_2092 274
185 3300044712 Ga0453684_0379183 Ga0453684_0379183_30_860 274
186 3300045051 Ga0451576_0077822 Ga0451576_0077822_711_1541 274
187 3300048912 Ga0496109_0000017 Ga0496109_0000017_122005_122853 274
188 3300049590 Ga0501074_0368106 Ga0501074_0368106_68_931 274
189 3300050507 nmdc:mga05p37_111357_c1 nmdc:mga05p37_111357_c1_43_906 274
190 3300050509 nmdc:mga0qj67_226797_c1 nmdc:mga0qj67_226797_c1_534_1397 274
191 3300050510 nmdc:mga06r32_137004_c1 nmdc:mga06r32_137004_c1_1068_1931 274
192 3300050510 nmdc:mga06r32_201340_c1 nmdc:mga06r32_201340_c1_279_1142 274
193 3300050510 nmdc:mga06r32_268736_c1 nmdc:mga06r32_268736_c1_575_1438 274
194 3300050511 nmdc:mga08y16_14520_c1 nmdc:mga08y16_14520_c1_407_1270 274
195 3300050513 nmdc:mga0rr50_291161_c1 nmdc:mga0rr50_291161_c1_397_1260 274
196 3300050515 nmdc:mga0a205_250532_c1 nmdc:mga0a205_250532_c1_179_1042 274
197 3300053079 Ga0500610_0131553 Ga0500610_0131553_201_1040 274
198 3300053096 Ga0500641_0114393 Ga0500641_0114393_214_1053 274
199 3300053098 Ga0500650_0127492 Ga0500650_0127492_284_1117 274
200 3300053108 Ga0500562_036904 Ga0500562_036904_57_896 274
201 iso_pu_bacteria 2913912277 2913916825 274
202 iso_pu_bacteria 2913939268 2913940591 274
203 3300003322 rootL2_10354980 rootL2_103549801 275
204 3300044712 Ga0453684_0131332 Ga0453684_0131332_292_1125 275
205 3300021384 Ga0213876_10003245 Ga0213876_100032453 276
206 3300025942 Ga0207689_10282426 Ga0207689_102824261 276
207 3300039437 Ga0436365_0397642 Ga0436365_0397642_4524_5456 276
208 3300044712 Ga0453684_0009353 Ga0453684_0009353_15350_16210 276
209 3300047320 Ga0495672_0201027 Ga0495672_0201027_85_930 276
210 3300003320 rootH2_10038943 rootH2_100389433 277
211 3300003320 rootH2_10056441 rootH2_100564411 277
212 3300003323 rootH1_10064251 rootH1_1006425123 277
213 3300005458 Ga0070681_10078311 Ga0070681_100783112 277
214 3300005458 Ga0070681_10252356 Ga0070681_102523561 277
215 3300005518 Ga0070699_100387556 Ga0070699_1003875562 277
216 3300005530 Ga0070679_100264829 Ga0070679_1002648292 277
217 3300005563 Ga0068855_100025784 Ga0068855_1000257846 277
218 3300005614 Ga0068856_100078489 Ga0068856_1000784893 277
219 3300005617 Ga0068859_100604072 Ga0068859_1006040722 277
220 3300005985 Ga0081539_10002218 Ga0081539_1000221822 277
221 3300006358 Ga0068871_100483203 Ga0068871_1004832031 277
222 3300006931 Ga0097620_100604030 Ga0097620_1006040302 277
223 3300009551 Ga0105238_10006147 Ga0105238_100061473 277
224 3300009553 Ga0105249_10029392 Ga0105249_100293923 277
225 3300013104 Ga0157370_10214454 Ga0157370_102144542 277
226 3300013105 Ga0157369_10005840 Ga0157369_100058404 277
227 3300013306 Ga0163162_10000834 Ga0163162_100008343 277
228 3300014968 Ga0157379_10073823 Ga0157379_100738232 277
229 3300017792 Ga0163161_10052311 Ga0163161_100523112 277
230 3300025921 Ga0207652_10133271 Ga0207652_101332712 277
231 3300025922 Ga0207646_10004105 Ga0207646_1000410510 277
232 3300025924 Ga0207694_10034591 Ga0207694_100345912 277
233 3300025949 Ga0207667_10030876 Ga0207667_100308762 277
234 3300025961 Ga0207712_10025074 Ga0207712_100250742 277
235 3300026078 Ga0207702_10274862 Ga0207702_102748622 277
236 3300028379 Ga0268266_10308496 Ga0268266_103084961 277
237 3300035111 Ga0373923_0038936 Ga0373923_0038936_204_1049 277
238 3300036401 Ga0373937_0004642 Ga0373937_0004642_3042_3887 277
239 3300037466 Ga0395898_0496260 Ga0395898_0496260_254_1099 277
240 3300044712 Ga0453684_0088858 Ga0453684_0088858_1660_2640 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

62

270

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8982 29 277
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8939 29 275
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8882 29 277
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8646 29 275
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8524 29 277
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6702 74 265 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6652 74 265 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6061 74 263 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4904 74 265 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4899 74 265 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A1F2ZW44-F1-model_v4 Transport permease protein 0.9776 36 277 GO:0005886
GO:0015920
GO:0140359
AF-A0A017HNL4-F1-model_v4 O-antigen export system, permease protein 0.9767 55 277 GO:0015920
GO:0016020
GO:0140359
AF-A0A7C9BN38-F1-model_v4 Transport permease protein 0.9751 9 277 GO:0005886
GO:0015920
GO:0140359
AF-A0A2V9SZP2-F1-model_v4 Phosphate ABC transporter permease 0.9739 64 277 GO:0015920
GO:0016020
GO:0140359
AF-A0A2V8S0D6-F1-model_v4 Transport permease protein 0.972 22 277 GO:0015920
GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
85.69 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map