F352952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 160 | 240 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_10041767|Ga0207639_100417673 |
| Length | 153 |
| Sequence | MRGSADTQREARPQTPACSPPIPDCDNHPVDPQRKRKIRLVVALSLVYTSFSAASEAKEPSQLVGLSSSSSIDMTGKVVPGSIRHRGEELRFRVVDREGGGPALPVTYMGTVPDPFRGGREIVLTGAVDNGTFVGEPDTLVTKCPSKFTTNAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 25 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 83 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 86 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 87 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 89 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 90 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 91 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 92 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 93 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 94 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 95 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 149 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 160 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 13.75 |
| Rhizosphere | 84.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1009116 | 3300002074 | Bacteria | 1169 |
| 2 | JGI24034J26672_10001036 | 3300002239 | Bacteria | 3624 |
| 3 | JGI24751J29686_10054955 | 3300002459 | Bacteria | 821 |
| 4 | Ga0070683_100000336 | 3300005329 | Bacteria | 32282 |
| 5 | Ga0070683_100076871 | 3300005329 | Bacteria | 3122 |
| 6 | Ga0070683_101096847 | 3300005329 | Bacteria | 764 |
| 7 | Ga0070680_100373991 | 3300005336 | Bacteria | 1213 |
| 8 | Ga0070682_100000045 | 3300005337 | Bacteria | 131960 |
| 9 | Ga0068868_100000082 | 3300005338 | Bacteria | 57070 |
| 10 | Ga0070660_101004042 | 3300005339 | Bacteria | 705 |
| 11 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 12 | Ga0070714_100440275 | 3300005435 | Bacteria | 1237 |
| 13 | Ga0070711_100063744 | 3300005439 | Bacteria | 2573 |
| 14 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 15 | Ga0070681_10086903 | 3300005458 | Bacteria | 3080 |
| 16 | Ga0070679_100001522 | 3300005530 | Bacteria | 20653 |
| 17 | Ga0070684_100001272 | 3300005535 | Bacteria | 18055 |
| 18 | Ga0070684_100013689 | 3300005535 | Bacteria | 6545 |
| 19 | Ga0070684_100266784 | 3300005535 | Bacteria | 1567 |
| 20 | Ga0070684_100835338 | 3300005535 | Bacteria | 862 |
| 21 | Ga0070693_100006288 | 3300005547 | Bacteria | 5755 |
| 22 | Ga0068855_100223784 | 3300005563 | Bacteria | 2109 |
| 23 | Ga0070664_100065881 | 3300005564 | Bacteria | 3092 |
| 24 | Ga0070664_100664130 | 3300005564 | Bacteria | 969 |
| 25 | Ga0068857_100493071 | 3300005577 | Bacteria | 1149 |
| 26 | Ga0068857_100742089 | 3300005577 | Bacteria | 935 |
| 27 | Ga0068854_100000136 | 3300005578 | Bacteria | 51080 |
| 28 | Ga0068854_100005170 | 3300005578 | Bacteria | 8229 |
| 29 | Ga0068856_100000757 | 3300005614 | Bacteria | 35080 |
| 30 | Ga0068856_100379948 | 3300005614 | Bacteria | 1432 |
| 31 | Ga0068852_100465043 | 3300005616 | Bacteria | 1254 |
| 32 | Ga0068852_100570295 | 3300005616 | Bacteria | 1134 |
| 33 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 34 | Ga0068866_10000237 | 3300005718 | Bacteria | 25933 |
| 35 | Ga0068870_11298348 | 3300005840 | Bacteria | 530 |
| 36 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 37 | Ga0068858_100000091 | 3300005842 | Bacteria | 93802 |
| 38 | Ga0068858_100000216 | 3300005842 | Bacteria | 62188 |
| 39 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 40 | Ga0070715_10213930 | 3300006163 | Unclassified | 987 |
| 41 | Ga0070712_100010232 | 3300006175 | Bacteria | 5914 |
| 42 | Ga0068865_100000165 | 3300006881 | Bacteria | 36517 |
| 43 | Ga0111539_13435422 | 3300009094 | Unclassified | 509 |
| 44 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 45 | Ga0105245_10014976 | 3300009098 | Bacteria | 6756 |
| 46 | Ga0105245_12260771 | 3300009098 | Bacteria | 597 |
| 47 | Ga0105247_10356388 | 3300009101 | Bacteria | 1030 |
| 48 | Ga0105243_12651072 | 3300009148 | Bacteria | 541 |
| 49 | Ga0105242_10067981 | 3300009176 | Bacteria | 2947 |
| 50 | Ga0105242_11369335 | 3300009176 | Bacteria | 734 |
| 51 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 52 | Ga0105249_11923112 | 3300009553 | Unclassified | 664 |
| 53 | Ga0105249_12397608 | 3300009553 | Bacteria | 600 |
| 54 | Ga0105239_10435295 | 3300010375 | Bacteria | 1487 |
| 55 | Ga0157370_10019814 | 3300013104 | Bacteria | 6732 |
| 56 | Ga0157370_10901961 | 3300013104 | Bacteria | 802 |
| 57 | Ga0157374_10047779 | 3300013296 | Bacteria | 3969 |
| 58 | Ga0157372_10000129 | 3300013307 | Bacteria | 82491 |
| 59 | Ga0157375_10001152 | 3300013308 | Bacteria | 22842 |
| 60 | Ga0157375_10993482 | 3300013308 | Unclassified | 979 |
| 61 | Ga0157375_11053043 | 3300013308 | Bacteria | 951 |
| 62 | Ga0163163_10661659 | 3300014325 | Bacteria | 1108 |
| 63 | Ga0157380_10001196 | 3300014326 | Bacteria | 16795 |
| 64 | Ga0157376_11865692 | 3300014969 | Bacteria | 638 |
| 65 | Ga0163161_10000035 | 3300017792 | Bacteria | 155979 |
| 66 | Ga0163161_10024890 | 3300017792 | Bacteria | 4232 |
| 67 | Ga0207682_10000031 | 3300025893 | Bacteria | 57806 |
| 68 | Ga0207642_10000122 | 3300025899 | Bacteria | 21318 |
| 69 | Ga0207685_10000082 | 3300025905 | Bacteria | 18011 |
| 70 | Ga0207643_10856085 | 3300025908 | Bacteria | 589 |
| 71 | Ga0207707_10071007 | 3300025912 | Bacteria | 3034 |
| 72 | Ga0207693_10006565 | 3300025915 | Bacteria | 9624 |
| 73 | Ga0207660_10062377 | 3300025917 | Bacteria | 2685 |
| 74 | Ga0207652_10005524 | 3300025921 | Bacteria | 10249 |
| 75 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 76 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 77 | Ga0207700_10067053 | 3300025928 | Bacteria | 2745 |
| 78 | Ga0207664_10113796 | 3300025929 | Bacteria | 2254 |
| 79 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 80 | Ga0207686_10010146 | 3300025934 | Bacteria | 5122 |
| 81 | Ga0207686_10039588 | 3300025934 | Bacteria | 2861 |
| 82 | Ga0207686_10513108 | 3300025934 | Bacteria | 932 |
| 83 | Ga0207709_11558964 | 3300025935 | Bacteria | 548 |
| 84 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 85 | Ga0207704_10000093 | 3300025938 | Bacteria | 52224 |
| 86 | Ga0207661_10000224 | 3300025944 | Bacteria | 36954 |
| 87 | Ga0207661_10004878 | 3300025944 | Bacteria | 9402 |
| 88 | Ga0207661_10017445 | 3300025944 | Bacteria | 5314 |
| 89 | Ga0207661_10528724 | 3300025944 | Bacteria | 1079 |
| 90 | Ga0207661_10774367 | 3300025944 | Bacteria | 883 |
| 91 | Ga0207679_10051574 | 3300025945 | Bacteria | 3012 |
| 92 | Ga0207667_10184731 | 3300025949 | Bacteria | 2140 |
| 93 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 94 | Ga0207668_10997021 | 3300025972 | Bacteria | 748 |
| 95 | Ga0207640_10007209 | 3300025981 | Bacteria | 6129 |
| 96 | Ga0207677_10000519 | 3300026023 | Bacteria | 24757 |
| 97 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 98 | Ga0207703_10000152 | 3300026035 | Bacteria | 79658 |
| 99 | Ga0207639_10041767 | 3300026041 | Bacteria | 3434 |
| 100 | Ga0207639_10341658 | 3300026041 | Bacteria | 1335 |
| 101 | Ga0207678_10708898 | 3300026067 | Bacteria | 886 |
| 102 | Ga0207708_10140495 | 3300026075 | Bacteria | 1894 |
| 103 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 104 | Ga0207702_10003484 | 3300026078 | Bacteria | 14344 |
| 105 | Ga0207641_10000151 | 3300026088 | Bacteria | 99225 |
| 106 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 107 | Ga0207674_10875456 | 3300026116 | Bacteria | 866 |
| 108 | Ga0207683_10683202 | 3300026121 | Bacteria | 951 |
| 109 | Ga0207698_10027046 | 3300026142 | Bacteria | 4067 |
| 110 | Ga0207698_10306501 | 3300026142 | Bacteria | 1481 |
| 111 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 112 | Ga0265326_10096351 | 3300028558 | Bacteria | 839 |
| 113 | Ga0265319_1000122 | 3300028563 | Bacteria | 58869 |
| 114 | Ga0265338_10000706 | 3300028800 | Bacteria | 56988 |
| 115 | Ga0265332_10207328 | 3300031238 | Bacteria | 814 |
| 116 | Ga0265325_10039094 | 3300031241 | Bacteria | 2500 |
| 117 | Ga0307415_100061447 | 3300032126 | Bacteria | 2601 |
| 118 | Ga0373937_0056286 | 3300036401 | Bacteria | 3611 |
| 119 | Ga0451800_0719914 | 3300041459 | Unclassified | 509 |
| 120 | Ga0451802_0331405 | 3300041460 | Unclassified | 690 |
| 121 | Ga0451807_1599059 | 3300041486 | Bacteria | 982 |
| 122 | Ga0451845_0741283 | 3300041501 | Bacteria | 531 |
| 123 | Ga0451853_2516419 | 3300041512 | Bacteria | 3773 |
| 124 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 125 | Ga0466963_0030778 | 3300044694 | Bacteria | 3465 |
| 126 | Ga0466957_0110381 | 3300044842 | Bacteria | 1743 |
| 127 | Ga0466967_0000009 | 3300045976 | Bacteria | 122610 |
| 128 | Ga0466967_1130897 | 3300045976 | Bacteria | 780 |
| 129 | Ga0495592_0459716 | 3300046454 | Bacteria | 796 |
| 130 | Ga0495603_0000144 | 3300046455 | Bacteria | 35341 |
| 131 | Ga0495603_0001027 | 3300046455 | Bacteria | 16113 |
| 132 | Ga0495603_0007614 | 3300046455 | Bacteria | 6518 |
| 133 | Ga0495629_0808583 | 3300046459 | Unclassified | 618 |
| 134 | Ga0495641_0000044 | 3300046461 | Bacteria | 77415 |
| 135 | Ga0495641_0019025 | 3300046461 | Bacteria | 3527 |
| 136 | Ga0495641_0081828 | 3300046461 | Bacteria | 1446 |
| 137 | Ga0495641_0227926 | 3300046461 | Bacteria | 836 |
| 138 | Ga0495651_0268487 | 3300046462 | Bacteria | 1158 |
| 139 | Ga0495653_0202545 | 3300046463 | Bacteria | 1346 |
| 140 | Ga0495653_0489040 | 3300046463 | Bacteria | 769 |
| 141 | Ga0495662_0672600 | 3300046476 | Bacteria | 505 |
| 142 | Ga0495596_0330518 | 3300046500 | Unclassified | 593 |
| 143 | Ga0495608_0000583 | 3300046511 | Bacteria | 25062 |
| 144 | Ga0495620_0000144 | 3300046515 | Bacteria | 58204 |
| 145 | Ga0495628_0000891 | 3300046516 | Bacteria | 27515 |
| 146 | Ga0495628_0030627 | 3300046516 | Bacteria | 4356 |
| 147 | Ga0495628_0092384 | 3300046516 | Bacteria | 2341 |
| 148 | Ga0495628_0238031 | 3300046516 | Bacteria | 1362 |
| 149 | Ga0495628_0238626 | 3300046516 | Bacteria | 1360 |
| 150 | Ga0495630_0000056 | 3300046517 | Bacteria | 91477 |
| 151 | Ga0495630_1044054 | 3300046517 | Bacteria | 620 |
| 152 | Ga0495587_0002239 | 3300046536 | Bacteria | 12930 |
| 153 | Ga0495598_0148171 | 3300046537 | Bacteria | 817 |
| 154 | Ga0495621_0001829 | 3300046539 | Bacteria | 5599 |
| 155 | Ga0495645_0315645 | 3300046543 | Bacteria | 1016 |
| 156 | Ga0495667_0000018 | 3300046559 | Bacteria | 188610 |
| 157 | Ga0495667_0229834 | 3300046559 | Bacteria | 1183 |
| 158 | Ga0495668_0036089 | 3300046616 | Bacteria | 2771 |
| 159 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 160 | Ga0495634_0187964 | 3300046642 | Bacteria | 1290 |
| 161 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 162 | Ga0495661_0361358 | 3300046665 | Unclassified | 713 |
| 163 | Ga0495657_0506083 | 3300046675 | Bacteria | 704 |
| 164 | Ga0495647_0000008 | 3300046681 | Bacteria | 101193 |
| 165 | Ga0495647_0000631 | 3300046681 | Bacteria | 10396 |
| 166 | Ga0495647_0011686 | 3300046681 | Bacteria | 3012 |
| 167 | Ga0495658_0004778 | 3300046683 | Bacteria | 6643 |
| 168 | Ga0495658_0148165 | 3300046683 | Bacteria | 1440 |
| 169 | Ga0495658_0329971 | 3300046683 | Bacteria | 968 |
| 170 | Ga0495669_0000211 | 3300046684 | Bacteria | 35387 |
| 171 | Ga0495613_0000113 | 3300046689 | Bacteria | 79559 |
| 172 | Ga0495613_0000803 | 3300046689 | Bacteria | 24344 |
| 173 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 174 | Ga0495624_0008756 | 3300046690 | Bacteria | 7039 |
| 175 | Ga0495649_0024848 | 3300046694 | Bacteria | 3339 |
| 176 | Ga0495600_0062863 | 3300046809 | Bacteria | 2426 |
| 177 | Ga0495600_0079406 | 3300046809 | Bacteria | 2142 |
| 178 | Ga0495600_0361691 | 3300046809 | Bacteria | 908 |
| 179 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 180 | Ga0495604_0012279 | 3300047317 | Bacteria | 6810 |
| 181 | Ga0495676_0062651 | 3300047321 | Bacteria | 2902 |
| 182 | Ga0495676_0434141 | 3300047321 | Bacteria | 868 |
| 183 | Ga0495680_0000773 | 3300047322 | Bacteria | 35829 |
| 184 | Ga0495680_0001716 | 3300047322 | Bacteria | 23253 |
| 185 | Ga0495680_0011368 | 3300047322 | Bacteria | 7881 |
| 186 | Ga0495679_022369 | 3300047446 | Bacteria | 2164 |
| 187 | Ga0495685_029696 | 3300047447 | Bacteria | 1880 |
| 188 | Ga0495684_0154398 | 3300047471 | Bacteria | 1715 |
| 189 | Ga0495686_0120508 | 3300047472 | Bacteria | 1564 |
| 190 | Ga0495593_0027886 | 3300047673 | Bacteria | 3105 |
| 191 | Ga0495602_0000533 | 3300048088 | Bacteria | 35335 |
| 192 | Ga0495602_0126997 | 3300048088 | Bacteria | 2041 |
| 193 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 194 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 195 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 196 | Ga0496104_0000650 | 3300048907 | Bacteria | 29817 |
| 197 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 198 | Ga0496105_0000347 | 3300048908 | Bacteria | 30490 |
| 199 | Ga0496106_0000061 | 3300048909 | Bacteria | 86524 |
| 200 | Ga0496106_0000997 | 3300048909 | Bacteria | 20676 |
| 201 | Ga0496106_0334070 | 3300048909 | Bacteria | 1217 |
| 202 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 203 | Ga0496107_0105665 | 3300048910 | Bacteria | 2067 |
| 204 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 205 | Ga0496108_0923492 | 3300048911 | Bacteria | 748 |
| 206 | Ga0496108_1016465 | 3300048911 | Bacteria | 707 |
| 207 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 208 | Ga0496110_0000087 | 3300048913 | Bacteria | 48905 |
| 209 | Ga0496110_0044439 | 3300048913 | Bacteria | 3879 |
| 210 | Ga0496110_0344278 | 3300048913 | Bacteria | 1358 |
| 211 | Ga0496110_0614443 | 3300048913 | Bacteria | 985 |
| 212 | Ga0496110_1395016 | 3300048913 | Bacteria | 610 |
| 213 | Ga0496111_0000010 | 3300048914 | Bacteria | 92600 |
| 214 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 215 | Ga0496112_0012119 | 3300048915 | Bacteria | 7911 |
| 216 | Ga0496113_0000014 | 3300048916 | Bacteria | 79850 |
| 217 | Ga0496113_0302902 | 3300048916 | Bacteria | 1280 |
| 218 | Ga0496113_0855893 | 3300048916 | Bacteria | 720 |
| 219 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 220 | Ga0496114_0117487 | 3300048917 | Bacteria | 2284 |
| 221 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 222 | Ga0496115_0000125 | 3300048918 | Bacteria | 69936 |
| 223 | Ga0496116_0003693 | 3300048919 | Bacteria | 14987 |
| 224 | Ga0501031_0650498 | 3300049568 | Bacteria | 677 |
| 225 | Ga0501034_0157713 | 3300049571 | Bacteria | 2242 |
| 226 | Ga0501042_0302347 | 3300049578 | Bacteria | 1156 |
| 227 | Ga0501070_0031626 | 3300049586 | Bacteria | 4434 |
| 228 | nmdc:mga0qj67_769354_c1 | 3300050509 | Bacteria | 763 |
| 229 | Ga0495601_0022106 | 3300053077 | Bacteria | 3903 |
| 230 | Ga0495601_0060271 | 3300053077 | Bacteria | 2408 |
| 231 | Ga0495601_0237335 | 3300053077 | Bacteria | 1190 |
| 232 | Ga0495612_0005643 | 3300053078 | Bacteria | 5171 |
| 233 | Ga0495655_0058618 | 3300053083 | Bacteria | 1043 |
| 234 | Ga0495595_0000103 | 3300053084 | Bacteria | 38598 |
| 235 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 236 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 237 | Ga0495619_0009830 | 3300053085 | Bacteria | 6030 |
| 238 | Ga0495619_0038104 | 3300053085 | Bacteria | 3134 |
| 239 | Ga0500614_012555 | 3300053123 | Bacteria | 1851 |
| 240 | Ga0501082_0742866 | 3300060353 | Bacteria | 859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_100493071 | Ga0068857_1004930712 | 108 |
| 2 | 3300006175 | Ga0070712_100010232 | Ga0070712_1000102324 | 108 |
| 3 | 3300025915 | Ga0207693_10006565 | Ga0207693_100065656 | 108 |
| 4 | 3300025944 | Ga0207661_10000224 | Ga0207661_100002242 | 108 |
| 5 | 3300026116 | Ga0207674_10875456 | Ga0207674_108754562 | 108 |
| 6 | 3300025917 | Ga0207660_10062377 | Ga0207660_100623771 | 111 |
| 7 | 3300005329 | Ga0070683_100076871 | Ga0070683_1000768713 | 112 |
| 8 | 3300005535 | Ga0070684_100001272 | Ga0070684_1000012727 | 112 |
| 9 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004498 | 112 |
| 10 | 3300025934 | Ga0207686_10513108 | Ga0207686_105131082 | 112 |
| 11 | 3300025944 | Ga0207661_10017445 | Ga0207661_100174453 | 112 |
| 12 | 3300005618 | Ga0068864_100000045 | Ga0068864_100000045141 | 113 |
| 13 | 3300026095 | Ga0207676_10000016 | Ga0207676_1000001623 | 113 |
| 14 | 3300026067 | Ga0207678_10708898 | Ga0207678_107088982 | 114 |
| 15 | 3300013104 | Ga0157370_10019814 | Ga0157370_100198142 | 116 |
| 16 | 3300005842 | Ga0068858_100000091 | Ga0068858_10000009132 | 119 |
| 17 | 3300025972 | Ga0207668_10997021 | Ga0207668_109970211 | 119 |
| 18 | 3300026035 | Ga0207703_10000152 | Ga0207703_1000015233 | 119 |
| 19 | 3300032126 | Ga0307415_100061447 | Ga0307415_1000614473 | 119 |
| 20 | 3300047321 | Ga0495676_0434141 | Ga0495676_0434141_259_657 | 119 |
| 21 | 3300009553 | Ga0105249_11923112 | Ga0105249_119231122 | 120 |
| 22 | 3300013308 | Ga0157375_10993482 | Ga0157375_109934821 | 120 |
| 23 | 3300025934 | Ga0207686_10010146 | Ga0207686_100101463 | 120 |
| 24 | 3300046559 | Ga0495667_0229834 | Ga0495667_0229834_744_1148 | 120 |
| 25 | 3300048919 | Ga0496116_0003693 | Ga0496116_0003693_262_711 | 120 |
| 26 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_20339_20743 | 120 |
| 27 | 3300013296 | Ga0157374_10047779 | Ga0157374_100477792 | 122 |
| 28 | 3300014969 | Ga0157376_11865692 | Ga0157376_118656922 | 122 |
| 29 | 3300026041 | Ga0207639_10341658 | Ga0207639_103416582 | 122 |
| 30 | 3300044694 | Ga0466963_0030778 | Ga0466963_0030778_1411_1812 | 122 |
| 31 | 3300045976 | Ga0466967_1130897 | Ga0466967_1130897_185_586 | 122 |
| 32 | 3300046461 | Ga0495641_0227926 | Ga0495641_0227926_57_452 | 122 |
| 33 | 3300047317 | Ga0495604_0012279 | Ga0495604_0012279_4521_4916 | 122 |
| 34 | 3300047472 | Ga0495686_0120508 | Ga0495686_0120508_91_489 | 122 |
| 35 | 3300005336 | Ga0070680_100373991 | Ga0070680_1003739912 | 123 |
| 36 | 3300005356 | Ga0070674_100000008 | Ga0070674_10000000818 | 123 |
| 37 | 3300005458 | Ga0070681_10086903 | Ga0070681_100869032 | 123 |
| 38 | 3300005530 | Ga0070679_100001522 | Ga0070679_10000152221 | 123 |
| 39 | 3300005535 | Ga0070684_100013689 | Ga0070684_1000136892 | 123 |
| 40 | 3300005614 | Ga0068856_100379948 | Ga0068856_1003799482 | 123 |
| 41 | 3300005718 | Ga0068866_10000237 | Ga0068866_1000023714 | 123 |
| 42 | 3300005842 | Ga0068858_100000216 | Ga0068858_10000021635 | 123 |
| 43 | 3300009101 | Ga0105247_10356388 | Ga0105247_103563882 | 123 |
| 44 | 3300009148 | Ga0105243_12651072 | Ga0105243_126510721 | 123 |
| 45 | 3300009176 | Ga0105242_10067981 | Ga0105242_100679812 | 123 |
| 46 | 3300009176 | Ga0105242_11369335 | Ga0105242_113693352 | 123 |
| 47 | 3300009553 | Ga0105249_12397608 | Ga0105249_123976082 | 123 |
| 48 | 3300013104 | Ga0157370_10901961 | Ga0157370_109019611 | 123 |
| 49 | 3300025899 | Ga0207642_10000122 | Ga0207642_100001224 | 123 |
| 50 | 3300025912 | Ga0207707_10071007 | Ga0207707_100710072 | 123 |
| 51 | 3300025921 | Ga0207652_10005524 | Ga0207652_1000552411 | 123 |
| 52 | 3300025934 | Ga0207686_10039588 | Ga0207686_100395884 | 123 |
| 53 | 3300025935 | Ga0207709_11558964 | Ga0207709_115589641 | 123 |
| 54 | 3300025937 | Ga0207669_10000004 | Ga0207669_10000004190 | 123 |
| 55 | 3300025944 | Ga0207661_10004878 | Ga0207661_100048783 | 123 |
| 56 | 3300026035 | Ga0207703_10000023 | Ga0207703_10000023181 | 123 |
| 57 | 3300026041 | Ga0207639_10041767 | Ga0207639_100417673 | 123 |
| 58 | 3300026078 | Ga0207702_10003484 | Ga0207702_1000348413 | 123 |
| 59 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047271 | 123 |
| 60 | 3300041512 | Ga0451853_2516419 | Ga0451853_2516419_1213_1611 | 123 |
| 61 | 3300044694 | Ga0466963_0000001 | Ga0466963_0000001_56623_57021 | 123 |
| 62 | 3300046455 | Ga0495603_0007614 | Ga0495603_0007614_86_484 | 123 |
| 63 | 3300046461 | Ga0495641_0000044 | Ga0495641_0000044_51983_52381 | 123 |
| 64 | 3300046461 | Ga0495641_0081828 | Ga0495641_0081828_484_882 | 123 |
| 65 | 3300046462 | Ga0495651_0268487 | Ga0495651_0268487_123_521 | 123 |
| 66 | 3300046516 | Ga0495628_0238031 | Ga0495628_0238031_555_953 | 123 |
| 67 | 3300046517 | Ga0495630_1044054 | Ga0495630_1044054_71_469 | 123 |
| 68 | 3300046539 | Ga0495621_0001829 | Ga0495621_0001829_2765_3163 | 123 |
| 69 | 3300046543 | Ga0495645_0315645 | Ga0495645_0315645_332_730 | 123 |
| 70 | 3300046616 | Ga0495668_0036089 | Ga0495668_0036089_1652_2050 | 123 |
| 71 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_143964_144362 | 123 |
| 72 | 3300046689 | Ga0495613_0000803 | Ga0495613_0000803_83_481 | 123 |
| 73 | 3300046690 | Ga0495624_0008756 | Ga0495624_0008756_6282_6680 | 123 |
| 74 | 3300046694 | Ga0495649_0024848 | Ga0495649_0024848_59_457 | 123 |
| 75 | 3300046809 | Ga0495600_0062863 | Ga0495600_0062863_45_443 | 123 |
| 76 | 3300046809 | Ga0495600_0361691 | Ga0495600_0361691_364_762 | 123 |
| 77 | 3300047321 | Ga0495676_0062651 | Ga0495676_0062651_2428_2826 | 123 |
| 78 | 3300047322 | Ga0495680_0000773 | Ga0495680_0000773_984_1382 | 123 |
| 79 | 3300047322 | Ga0495680_0011368 | Ga0495680_0011368_7395_7793 | 123 |
| 80 | 3300047446 | Ga0495679_022369 | Ga0495679_022369_1722_2120 | 123 |
| 81 | 3300047447 | Ga0495685_029696 | Ga0495685_029696_30_428 | 123 |
| 82 | 3300048088 | Ga0495602_0126997 | Ga0495602_0126997_283_687 | 123 |
| 83 | 3300048911 | Ga0496108_0923492 | Ga0496108_0923492_35_436 | 123 |
| 84 | 3300048913 | Ga0496110_0044439 | Ga0496110_0044439_3398_3796 | 123 |
| 85 | 3300048913 | Ga0496110_1395016 | Ga0496110_1395016_33_434 | 123 |
| 86 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_23947_24348 | 123 |
| 87 | 3300048916 | Ga0496113_0855893 | Ga0496113_0855893_30_428 | 123 |
| 88 | 3300050509 | nmdc:mga0qj67_769354_c1 | nmdc:mga0qj67_769354_c1_153_560 | 123 |
| 89 | 3300053077 | Ga0495601_0237335 | Ga0495601_0237335_72_470 | 123 |
| 90 | 3300053078 | Ga0495612_0005643 | Ga0495612_0005643_13_411 | 123 |
| 91 | 3300053123 | Ga0500614_012555 | Ga0500614_012555_1386_1784 | 123 |
| 92 | 3300002074 | JGI24748J21848_1009116 | JGI24748J21848_10091162 | 124 |
| 93 | 3300002239 | JGI24034J26672_10001036 | JGI24034J26672_100010363 | 124 |
| 94 | 3300002459 | JGI24751J29686_10054955 | JGI24751J29686_100549552 | 124 |
| 95 | 3300005329 | Ga0070683_100000336 | Ga0070683_1000003365 | 124 |
| 96 | 3300005329 | Ga0070683_101096847 | Ga0070683_1010968472 | 124 |
| 97 | 3300005337 | Ga0070682_100000045 | Ga0070682_100000045129 | 124 |
| 98 | 3300005338 | Ga0068868_100000082 | Ga0068868_10000008226 | 124 |
| 99 | 3300005339 | Ga0070660_101004042 | Ga0070660_1010040421 | 124 |
| 100 | 3300005435 | Ga0070714_100440275 | Ga0070714_1004402751 | 124 |
| 101 | 3300005439 | Ga0070711_100063744 | Ga0070711_1000637443 | 124 |
| 102 | 3300005457 | Ga0070662_100000004 | Ga0070662_10000000458 | 124 |
| 103 | 3300005535 | Ga0070684_100266784 | Ga0070684_1002667841 | 124 |
| 104 | 3300005535 | Ga0070684_100835338 | Ga0070684_1008353382 | 124 |
| 105 | 3300005547 | Ga0070693_100006288 | Ga0070693_1000062885 | 124 |
| 106 | 3300005563 | Ga0068855_100223784 | Ga0068855_1002237842 | 124 |
| 107 | 3300005564 | Ga0070664_100065881 | Ga0070664_1000658813 | 124 |
| 108 | 3300005564 | Ga0070664_100664130 | Ga0070664_1006641302 | 124 |
| 109 | 3300005577 | Ga0068857_100742089 | Ga0068857_1007420892 | 124 |
| 110 | 3300005578 | Ga0068854_100000136 | Ga0068854_10000013622 | 124 |
| 111 | 3300005578 | Ga0068854_100005170 | Ga0068854_1000051703 | 124 |
| 112 | 3300005614 | Ga0068856_100000757 | Ga0068856_10000075723 | 124 |
| 113 | 3300005616 | Ga0068852_100465043 | Ga0068852_1004650432 | 124 |
| 114 | 3300005616 | Ga0068852_100570295 | Ga0068852_1005702952 | 124 |
| 115 | 3300005840 | Ga0068870_11298348 | Ga0068870_112983482 | 124 |
| 116 | 3300005841 | Ga0068863_100000021 | Ga0068863_100000021181 | 124 |
| 117 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001293 | 124 |
| 118 | 3300006163 | Ga0070715_10213930 | Ga0070715_102139302 | 124 |
| 119 | 3300006881 | Ga0068865_100000165 | Ga0068865_1000001658 | 124 |
| 120 | 3300009094 | Ga0111539_13435422 | Ga0111539_134354221 | 124 |
| 121 | 3300009098 | Ga0105245_10000016 | Ga0105245_1000001630 | 124 |
| 122 | 3300009098 | Ga0105245_10014976 | Ga0105245_100149765 | 124 |
| 123 | 3300009098 | Ga0105245_12260771 | Ga0105245_122607711 | 124 |
| 124 | 3300009553 | Ga0105249_10000068 | Ga0105249_10000068147 | 124 |
| 125 | 3300010375 | Ga0105239_10435295 | Ga0105239_104352952 | 124 |
| 126 | 3300013307 | Ga0157372_10000129 | Ga0157372_1000012976 | 124 |
| 127 | 3300013308 | Ga0157375_10001152 | Ga0157375_1000115218 | 124 |
| 128 | 3300013308 | Ga0157375_11053043 | Ga0157375_110530431 | 124 |
| 129 | 3300014325 | Ga0163163_10661659 | Ga0163163_106616592 | 124 |
| 130 | 3300014326 | Ga0157380_10001196 | Ga0157380_100011969 | 124 |
| 131 | 3300017792 | Ga0163161_10000035 | Ga0163161_10000035103 | 124 |
| 132 | 3300017792 | Ga0163161_10024890 | Ga0163161_100248904 | 124 |
| 133 | 3300025893 | Ga0207682_10000031 | Ga0207682_1000003126 | 124 |
| 134 | 3300025905 | Ga0207685_10000082 | Ga0207685_1000008217 | 124 |
| 135 | 3300025908 | Ga0207643_10856085 | Ga0207643_108560852 | 124 |
| 136 | 3300025927 | Ga0207687_10000018 | Ga0207687_10000018194 | 124 |
| 137 | 3300025928 | Ga0207700_10067053 | Ga0207700_100670532 | 124 |
| 138 | 3300025929 | Ga0207664_10113796 | Ga0207664_101137963 | 124 |
| 139 | 3300025933 | Ga0207706_10000012 | Ga0207706_10000012160 | 124 |
| 140 | 3300025938 | Ga0207704_10000093 | Ga0207704_1000009310 | 124 |
| 141 | 3300025944 | Ga0207661_10528724 | Ga0207661_105287241 | 124 |
| 142 | 3300025944 | Ga0207661_10774367 | Ga0207661_107743672 | 124 |
| 143 | 3300025945 | Ga0207679_10051574 | Ga0207679_100515742 | 124 |
| 144 | 3300025949 | Ga0207667_10184731 | Ga0207667_101847313 | 124 |
| 145 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007300 | 124 |
| 146 | 3300025981 | Ga0207640_10007209 | Ga0207640_100072092 | 124 |
| 147 | 3300026023 | Ga0207677_10000519 | Ga0207677_100005196 | 124 |
| 148 | 3300026075 | Ga0207708_10140495 | Ga0207708_101404952 | 124 |
| 149 | 3300026078 | Ga0207702_10000060 | Ga0207702_1000006048 | 124 |
| 150 | 3300026088 | Ga0207641_10000151 | Ga0207641_1000015177 | 124 |
| 151 | 3300026121 | Ga0207683_10683202 | Ga0207683_106832022 | 124 |
| 152 | 3300026142 | Ga0207698_10027046 | Ga0207698_100270464 | 124 |
| 153 | 3300026142 | Ga0207698_10306501 | Ga0207698_103065012 | 124 |
| 154 | 3300028558 | Ga0265326_10096351 | Ga0265326_100963512 | 124 |
| 155 | 3300028563 | Ga0265319_1000122 | Ga0265319_10001229 | 124 |
| 156 | 3300028800 | Ga0265338_10000706 | Ga0265338_100007069 | 124 |
| 157 | 3300031238 | Ga0265332_10207328 | Ga0265332_102073282 | 124 |
| 158 | 3300031241 | Ga0265325_10039094 | Ga0265325_100390942 | 124 |
| 159 | 3300036401 | Ga0373937_0056286 | Ga0373937_0056286_495_908 | 124 |
| 160 | 3300041459 | Ga0451800_0719914 | Ga0451800_0719914_34_435 | 124 |
| 161 | 3300041460 | Ga0451802_0331405 | Ga0451802_0331405_239_640 | 124 |
| 162 | 3300041486 | Ga0451807_1599059 | Ga0451807_1599059_319_720 | 124 |
| 163 | 3300041501 | Ga0451845_0741283 | Ga0451845_0741283_53_454 | 124 |
| 164 | 3300044842 | Ga0466957_0110381 | Ga0466957_0110381_1215_1622 | 124 |
| 165 | 3300045976 | Ga0466967_0000009 | Ga0466967_0000009_22534_22941 | 124 |
| 166 | 3300046454 | Ga0495592_0459716 | Ga0495592_0459716_113_526 | 124 |
| 167 | 3300046455 | Ga0495603_0000144 | Ga0495603_0000144_2552_2953 | 124 |
| 168 | 3300046455 | Ga0495603_0001027 | Ga0495603_0001027_14681_15094 | 124 |
| 169 | 3300046459 | Ga0495629_0808583 | Ga0495629_0808583_132_542 | 124 |
| 170 | 3300046461 | Ga0495641_0019025 | Ga0495641_0019025_2812_3216 | 124 |
| 171 | 3300046463 | Ga0495653_0202545 | Ga0495653_0202545_320_721 | 124 |
| 172 | 3300046463 | Ga0495653_0489040 | Ga0495653_0489040_131_544 | 124 |
| 173 | 3300046476 | Ga0495662_0672600 | Ga0495662_0672600_57_458 | 124 |
| 174 | 3300046500 | Ga0495596_0330518 | Ga0495596_0330518_161_562 | 124 |
| 175 | 3300046511 | Ga0495608_0000583 | Ga0495608_0000583_24101_24502 | 124 |
| 176 | 3300046515 | Ga0495620_0000144 | Ga0495620_0000144_24826_25227 | 124 |
| 177 | 3300046516 | Ga0495628_0000891 | Ga0495628_0000891_10464_10865 | 124 |
| 178 | 3300046516 | Ga0495628_0030627 | Ga0495628_0030627_163_573 | 124 |
| 179 | 3300046516 | Ga0495628_0092384 | Ga0495628_0092384_1855_2256 | 124 |
| 180 | 3300046516 | Ga0495628_0238626 | Ga0495628_0238626_31_435 | 124 |
| 181 | 3300046517 | Ga0495630_0000056 | Ga0495630_0000056_61746_62150 | 124 |
| 182 | 3300046536 | Ga0495587_0002239 | Ga0495587_0002239_52_453 | 124 |
| 183 | 3300046537 | Ga0495598_0148171 | Ga0495598_0148171_364_765 | 124 |
| 184 | 3300046559 | Ga0495667_0000018 | Ga0495667_0000018_182526_182927 | 124 |
| 185 | 3300046642 | Ga0495634_0000018 | Ga0495634_0000018_79647_80048 | 124 |
| 186 | 3300046642 | Ga0495634_0187964 | Ga0495634_0187964_424_834 | 124 |
| 187 | 3300046665 | Ga0495661_0361358 | Ga0495661_0361358_29_430 | 124 |
| 188 | 3300046675 | Ga0495657_0506083 | Ga0495657_0506083_278_691 | 124 |
| 189 | 3300046681 | Ga0495647_0000008 | Ga0495647_0000008_34229_34630 | 124 |
| 190 | 3300046681 | Ga0495647_0000631 | Ga0495647_0000631_7264_7668 | 124 |
| 191 | 3300046681 | Ga0495647_0011686 | Ga0495647_0011686_460_873 | 124 |
| 192 | 3300046683 | Ga0495658_0004778 | Ga0495658_0004778_5478_5885 | 124 |
| 193 | 3300046683 | Ga0495658_0148165 | Ga0495658_0148165_662_1072 | 124 |
| 194 | 3300046683 | Ga0495658_0329971 | Ga0495658_0329971_341_754 | 124 |
| 195 | 3300046684 | Ga0495669_0000211 | Ga0495669_0000211_11254_11658 | 124 |
| 196 | 3300046689 | Ga0495613_0000113 | Ga0495613_0000113_40335_40769 | 124 |
| 197 | 3300046690 | Ga0495624_0000008 | Ga0495624_0000008_77683_78084 | 124 |
| 198 | 3300046809 | Ga0495600_0079406 | Ga0495600_0079406_186_599 | 124 |
| 199 | 3300047317 | Ga0495604_0000019 | Ga0495604_0000019_145477_145878 | 124 |
| 200 | 3300047322 | Ga0495680_0001716 | Ga0495680_0001716_685_1086 | 124 |
| 201 | 3300047471 | Ga0495684_0154398 | Ga0495684_0154398_1260_1661 | 124 |
| 202 | 3300047673 | Ga0495593_0027886 | Ga0495593_0027886_2632_3033 | 124 |
| 203 | 3300048088 | Ga0495602_0000533 | Ga0495602_0000533_10974_11375 | 124 |
| 204 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_294969_295373 | 124 |
| 205 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_294969_295373 | 124 |
| 206 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_172875_173279 | 124 |
| 207 | 3300048907 | Ga0496104_0000650 | Ga0496104_0000650_1327_1728 | 124 |
| 208 | 3300048908 | Ga0496105_0000007 | Ga0496105_0000007_314777_315181 | 124 |
| 209 | 3300048908 | Ga0496105_0000347 | Ga0496105_0000347_30069_30470 | 124 |
| 210 | 3300048909 | Ga0496106_0000061 | Ga0496106_0000061_55869_56273 | 124 |
| 211 | 3300048909 | Ga0496106_0000997 | Ga0496106_0000997_19765_20166 | 124 |
| 212 | 3300048909 | Ga0496106_0334070 | Ga0496106_0334070_541_942 | 124 |
| 213 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_122013_122417 | 124 |
| 214 | 3300048910 | Ga0496107_0105665 | Ga0496107_0105665_381_782 | 124 |
| 215 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_584468_584872 | 124 |
| 216 | 3300048911 | Ga0496108_1016465 | Ga0496108_1016465_284_694 | 124 |
| 217 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_259014_259418 | 124 |
| 218 | 3300048913 | Ga0496110_0000087 | Ga0496110_0000087_10519_10920 | 124 |
| 219 | 3300048913 | Ga0496110_0344278 | Ga0496110_0344278_776_1177 | 124 |
| 220 | 3300048913 | Ga0496110_0614443 | Ga0496110_0614443_204_614 | 124 |
| 221 | 3300048914 | Ga0496111_0000010 | Ga0496111_0000010_38027_38428 | 124 |
| 222 | 3300048915 | Ga0496112_0012119 | Ga0496112_0012119_815_1216 | 124 |
| 223 | 3300048916 | Ga0496113_0000014 | Ga0496113_0000014_9068_9469 | 124 |
| 224 | 3300048916 | Ga0496113_0302902 | Ga0496113_0302902_536_946 | 124 |
| 225 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_231130_231531 | 124 |
| 226 | 3300048917 | Ga0496114_0117487 | Ga0496114_0117487_1511_1912 | 124 |
| 227 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_209245_209646 | 124 |
| 228 | 3300048918 | Ga0496115_0000125 | Ga0496115_0000125_52789_53190 | 124 |
| 229 | 3300049568 | Ga0501031_0650498 | Ga0501031_0650498_22_423 | 124 |
| 230 | 3300049571 | Ga0501034_0157713 | Ga0501034_0157713_1397_1798 | 124 |
| 231 | 3300049578 | Ga0501042_0302347 | Ga0501042_0302347_488_889 | 124 |
| 232 | 3300049586 | Ga0501070_0031626 | Ga0501070_0031626_1278_1682 | 124 |
| 233 | 3300053077 | Ga0495601_0022106 | Ga0495601_0022106_1464_1898 | 124 |
| 234 | 3300053077 | Ga0495601_0060271 | Ga0495601_0060271_1462_1869 | 124 |
| 235 | 3300053083 | Ga0495655_0058618 | Ga0495655_0058618_563_964 | 124 |
| 236 | 3300053084 | Ga0495595_0000103 | Ga0495595_0000103_30771_31172 | 124 |
| 237 | 3300053085 | Ga0495619_0000031 | Ga0495619_0000031_68252_68653 | 124 |
| 238 | 3300053085 | Ga0495619_0009830 | Ga0495619_0009830_1001_1411 | 124 |
| 239 | 3300053085 | Ga0495619_0038104 | Ga0495619_0038104_735_1148 | 124 |
| 240 | 3300060353 | Ga0501082_0742866 | Ga0501082_0742866_26_427 | 124 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ce8-assembly1.cif.gz_E | cytochrome c maturation complex ccmabcde | 0.8239 | 29 | 115 |
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.8138 | 41 | 115 |
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.8024 | 30 | 114 |
| 8x70-assembly4.cif.gz_D | the crystal structure of ifi16 from biortus. | 0.7876 | 27 | 115 |
| 3f8t-assembly1.cif.gz_A | crystal structure analysis of a full-length mcm homolog from methanopyrus kandleri | 0.7728 | 34 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8138 | 41 | 115 | 2.40.50.140 |
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8024 | 30 | 114 | 2.40.50.140 |
| 3f8tA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7974 | 34 | 114 | 2.40.50.140 |
| af_P87307_123_212_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7795 | 39 | 117 | 2.40.50.140 |
| af_K7VHZ3_96_226_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7743 | 28 | 121 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8Z3B8-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9043 | 29 | 116 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-Q68WF0-F1-model_v4 | Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) | 0.8976 | 29 | 116 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A0K8P2I1-F1-model_v4 | Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) | 0.8962 | 29 | 118 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A2I0NJJ1-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.8958 | 27 | 119 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A838HMP1-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.8943 | 27 | 106 |
GO:0005886
GO:0017004 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar