F352952

General Info

Members Datasets Scaffolds Average Seq Length
240 160 240 131

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10041767|Ga0207639_100417673
Length 153
Sequence MRGSADTQREARPQTPACSPPIPDCDNHPVDPQRKRKIRLVVALSLVYTSFSAASEAKEPSQLVGLSSSSSIDMTGKVVPGSIRHRGEELRFRVVDREGGGPALPVTYMGTVPDPFRGGREIVLTGAVDNGTFVGEPDTLVTKCPSKFTTNAS

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 13.75
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1009116 3300002074 Bacteria 1169
2 JGI24034J26672_10001036 3300002239 Bacteria 3624
3 JGI24751J29686_10054955 3300002459 Bacteria 821
4 Ga0070683_100000336 3300005329 Bacteria 32282
5 Ga0070683_100076871 3300005329 Bacteria 3122
6 Ga0070683_101096847 3300005329 Bacteria 764
7 Ga0070680_100373991 3300005336 Bacteria 1213
8 Ga0070682_100000045 3300005337 Bacteria 131960
9 Ga0068868_100000082 3300005338 Bacteria 57070
10 Ga0070660_101004042 3300005339 Bacteria 705
11 Ga0070674_100000008 3300005356 Bacteria 143844
12 Ga0070714_100440275 3300005435 Bacteria 1237
13 Ga0070711_100063744 3300005439 Bacteria 2573
14 Ga0070662_100000004 3300005457 Bacteria 195534
15 Ga0070681_10086903 3300005458 Bacteria 3080
16 Ga0070679_100001522 3300005530 Bacteria 20653
17 Ga0070684_100001272 3300005535 Bacteria 18055
18 Ga0070684_100013689 3300005535 Bacteria 6545
19 Ga0070684_100266784 3300005535 Bacteria 1567
20 Ga0070684_100835338 3300005535 Bacteria 862
21 Ga0070693_100006288 3300005547 Bacteria 5755
22 Ga0068855_100223784 3300005563 Bacteria 2109
23 Ga0070664_100065881 3300005564 Bacteria 3092
24 Ga0070664_100664130 3300005564 Bacteria 969
25 Ga0068857_100493071 3300005577 Bacteria 1149
26 Ga0068857_100742089 3300005577 Bacteria 935
27 Ga0068854_100000136 3300005578 Bacteria 51080
28 Ga0068854_100005170 3300005578 Bacteria 8229
29 Ga0068856_100000757 3300005614 Bacteria 35080
30 Ga0068856_100379948 3300005614 Bacteria 1432
31 Ga0068852_100465043 3300005616 Bacteria 1254
32 Ga0068852_100570295 3300005616 Bacteria 1134
33 Ga0068864_100000045 3300005618 Bacteria 154739
34 Ga0068866_10000237 3300005718 Bacteria 25933
35 Ga0068870_11298348 3300005840 Bacteria 530
36 Ga0068863_100000021 3300005841 Bacteria 198088
37 Ga0068858_100000091 3300005842 Bacteria 93802
38 Ga0068858_100000216 3300005842 Bacteria 62188
39 Ga0070715_10000001 3300006163 Bacteria 693690
40 Ga0070715_10213930 3300006163 Unclassified 987
41 Ga0070712_100010232 3300006175 Bacteria 5914
42 Ga0068865_100000165 3300006881 Bacteria 36517
43 Ga0111539_13435422 3300009094 Unclassified 509
44 Ga0105245_10000016 3300009098 Bacteria 204372
45 Ga0105245_10014976 3300009098 Bacteria 6756
46 Ga0105245_12260771 3300009098 Bacteria 597
47 Ga0105247_10356388 3300009101 Bacteria 1030
48 Ga0105243_12651072 3300009148 Bacteria 541
49 Ga0105242_10067981 3300009176 Bacteria 2947
50 Ga0105242_11369335 3300009176 Bacteria 734
51 Ga0105249_10000068 3300009553 Bacteria 148594
52 Ga0105249_11923112 3300009553 Unclassified 664
53 Ga0105249_12397608 3300009553 Bacteria 600
54 Ga0105239_10435295 3300010375 Bacteria 1487
55 Ga0157370_10019814 3300013104 Bacteria 6732
56 Ga0157370_10901961 3300013104 Bacteria 802
57 Ga0157374_10047779 3300013296 Bacteria 3969
58 Ga0157372_10000129 3300013307 Bacteria 82491
59 Ga0157375_10001152 3300013308 Bacteria 22842
60 Ga0157375_10993482 3300013308 Unclassified 979
61 Ga0157375_11053043 3300013308 Bacteria 951
62 Ga0163163_10661659 3300014325 Bacteria 1108
63 Ga0157380_10001196 3300014326 Bacteria 16795
64 Ga0157376_11865692 3300014969 Bacteria 638
65 Ga0163161_10000035 3300017792 Bacteria 155979
66 Ga0163161_10024890 3300017792 Bacteria 4232
67 Ga0207682_10000031 3300025893 Bacteria 57806
68 Ga0207642_10000122 3300025899 Bacteria 21318
69 Ga0207685_10000082 3300025905 Bacteria 18011
70 Ga0207643_10856085 3300025908 Bacteria 589
71 Ga0207707_10071007 3300025912 Bacteria 3034
72 Ga0207693_10006565 3300025915 Bacteria 9624
73 Ga0207660_10062377 3300025917 Bacteria 2685
74 Ga0207652_10005524 3300025921 Bacteria 10249
75 Ga0207694_10000004 3300025924 Bacteria 967075
76 Ga0207687_10000018 3300025927 Bacteria 236159
77 Ga0207700_10067053 3300025928 Bacteria 2745
78 Ga0207664_10113796 3300025929 Bacteria 2254
79 Ga0207706_10000012 3300025933 Bacteria 195475
80 Ga0207686_10010146 3300025934 Bacteria 5122
81 Ga0207686_10039588 3300025934 Bacteria 2861
82 Ga0207686_10513108 3300025934 Bacteria 932
83 Ga0207709_11558964 3300025935 Bacteria 548
84 Ga0207669_10000004 3300025937 Bacteria 196828
85 Ga0207704_10000093 3300025938 Bacteria 52224
86 Ga0207661_10000224 3300025944 Bacteria 36954
87 Ga0207661_10004878 3300025944 Bacteria 9402
88 Ga0207661_10017445 3300025944 Bacteria 5314
89 Ga0207661_10528724 3300025944 Bacteria 1079
90 Ga0207661_10774367 3300025944 Bacteria 883
91 Ga0207679_10051574 3300025945 Bacteria 3012
92 Ga0207667_10184731 3300025949 Bacteria 2140
93 Ga0207712_10000007 3300025961 Bacteria 539589
94 Ga0207668_10997021 3300025972 Bacteria 748
95 Ga0207640_10007209 3300025981 Bacteria 6129
96 Ga0207677_10000519 3300026023 Bacteria 24757
97 Ga0207703_10000023 3300026035 Bacteria 222018
98 Ga0207703_10000152 3300026035 Bacteria 79658
99 Ga0207639_10041767 3300026041 Bacteria 3434
100 Ga0207639_10341658 3300026041 Bacteria 1335
101 Ga0207678_10708898 3300026067 Bacteria 886
102 Ga0207708_10140495 3300026075 Bacteria 1894
103 Ga0207702_10000060 3300026078 Bacteria 125473
104 Ga0207702_10003484 3300026078 Bacteria 14344
105 Ga0207641_10000151 3300026088 Bacteria 99225
106 Ga0207676_10000016 3300026095 Bacteria 311561
107 Ga0207674_10875456 3300026116 Bacteria 866
108 Ga0207683_10683202 3300026121 Bacteria 951
109 Ga0207698_10027046 3300026142 Bacteria 4067
110 Ga0207698_10306501 3300026142 Bacteria 1481
111 Ga0268266_10000047 3300028379 Bacteria 310996
112 Ga0265326_10096351 3300028558 Bacteria 839
113 Ga0265319_1000122 3300028563 Bacteria 58869
114 Ga0265338_10000706 3300028800 Bacteria 56988
115 Ga0265332_10207328 3300031238 Bacteria 814
116 Ga0265325_10039094 3300031241 Bacteria 2500
117 Ga0307415_100061447 3300032126 Bacteria 2601
118 Ga0373937_0056286 3300036401 Bacteria 3611
119 Ga0451800_0719914 3300041459 Unclassified 509
120 Ga0451802_0331405 3300041460 Unclassified 690
121 Ga0451807_1599059 3300041486 Bacteria 982
122 Ga0451845_0741283 3300041501 Bacteria 531
123 Ga0451853_2516419 3300041512 Bacteria 3773
124 Ga0466963_0000001 3300044694 Bacteria 110556
125 Ga0466963_0030778 3300044694 Bacteria 3465
126 Ga0466957_0110381 3300044842 Bacteria 1743
127 Ga0466967_0000009 3300045976 Bacteria 122610
128 Ga0466967_1130897 3300045976 Bacteria 780
129 Ga0495592_0459716 3300046454 Bacteria 796
130 Ga0495603_0000144 3300046455 Bacteria 35341
131 Ga0495603_0001027 3300046455 Bacteria 16113
132 Ga0495603_0007614 3300046455 Bacteria 6518
133 Ga0495629_0808583 3300046459 Unclassified 618
134 Ga0495641_0000044 3300046461 Bacteria 77415
135 Ga0495641_0019025 3300046461 Bacteria 3527
136 Ga0495641_0081828 3300046461 Bacteria 1446
137 Ga0495641_0227926 3300046461 Bacteria 836
138 Ga0495651_0268487 3300046462 Bacteria 1158
139 Ga0495653_0202545 3300046463 Bacteria 1346
140 Ga0495653_0489040 3300046463 Bacteria 769
141 Ga0495662_0672600 3300046476 Bacteria 505
142 Ga0495596_0330518 3300046500 Unclassified 593
143 Ga0495608_0000583 3300046511 Bacteria 25062
144 Ga0495620_0000144 3300046515 Bacteria 58204
145 Ga0495628_0000891 3300046516 Bacteria 27515
146 Ga0495628_0030627 3300046516 Bacteria 4356
147 Ga0495628_0092384 3300046516 Bacteria 2341
148 Ga0495628_0238031 3300046516 Bacteria 1362
149 Ga0495628_0238626 3300046516 Bacteria 1360
150 Ga0495630_0000056 3300046517 Bacteria 91477
151 Ga0495630_1044054 3300046517 Bacteria 620
152 Ga0495587_0002239 3300046536 Bacteria 12930
153 Ga0495598_0148171 3300046537 Bacteria 817
154 Ga0495621_0001829 3300046539 Bacteria 5599
155 Ga0495645_0315645 3300046543 Bacteria 1016
156 Ga0495667_0000018 3300046559 Bacteria 188610
157 Ga0495667_0229834 3300046559 Bacteria 1183
158 Ga0495668_0036089 3300046616 Bacteria 2771
159 Ga0495634_0000018 3300046642 Bacteria 121323
160 Ga0495634_0187964 3300046642 Bacteria 1290
161 Ga0495635_0000016 3300046663 Bacteria 214088
162 Ga0495661_0361358 3300046665 Unclassified 713
163 Ga0495657_0506083 3300046675 Bacteria 704
164 Ga0495647_0000008 3300046681 Bacteria 101193
165 Ga0495647_0000631 3300046681 Bacteria 10396
166 Ga0495647_0011686 3300046681 Bacteria 3012
167 Ga0495658_0004778 3300046683 Bacteria 6643
168 Ga0495658_0148165 3300046683 Bacteria 1440
169 Ga0495658_0329971 3300046683 Bacteria 968
170 Ga0495669_0000211 3300046684 Bacteria 35387
171 Ga0495613_0000113 3300046689 Bacteria 79559
172 Ga0495613_0000803 3300046689 Bacteria 24344
173 Ga0495624_0000008 3300046690 Bacteria 145035
174 Ga0495624_0008756 3300046690 Bacteria 7039
175 Ga0495649_0024848 3300046694 Bacteria 3339
176 Ga0495600_0062863 3300046809 Bacteria 2426
177 Ga0495600_0079406 3300046809 Bacteria 2142
178 Ga0495600_0361691 3300046809 Bacteria 908
179 Ga0495604_0000019 3300047317 Bacteria 175064
180 Ga0495604_0012279 3300047317 Bacteria 6810
181 Ga0495676_0062651 3300047321 Bacteria 2902
182 Ga0495676_0434141 3300047321 Bacteria 868
183 Ga0495680_0000773 3300047322 Bacteria 35829
184 Ga0495680_0001716 3300047322 Bacteria 23253
185 Ga0495680_0011368 3300047322 Bacteria 7881
186 Ga0495679_022369 3300047446 Bacteria 2164
187 Ga0495685_029696 3300047447 Bacteria 1880
188 Ga0495684_0154398 3300047471 Bacteria 1715
189 Ga0495686_0120508 3300047472 Bacteria 1564
190 Ga0495593_0027886 3300047673 Bacteria 3105
191 Ga0495602_0000533 3300048088 Bacteria 35335
192 Ga0495602_0126997 3300048088 Bacteria 2041
193 Ga0496100_0000002 3300048903 Bacteria 489057
194 Ga0496101_0000001 3300048904 Bacteria 489057
195 Ga0496104_0000009 3300048907 Bacteria 488055
196 Ga0496104_0000650 3300048907 Bacteria 29817
197 Ga0496105_0000007 3300048908 Bacteria 339658
198 Ga0496105_0000347 3300048908 Bacteria 30490
199 Ga0496106_0000061 3300048909 Bacteria 86524
200 Ga0496106_0000997 3300048909 Bacteria 20676
201 Ga0496106_0334070 3300048909 Bacteria 1217
202 Ga0496107_0000013 3300048910 Bacteria 178284
203 Ga0496107_0105665 3300048910 Bacteria 2067
204 Ga0496108_0000001 3300048911 Bacteria 919044
205 Ga0496108_0923492 3300048911 Bacteria 748
206 Ga0496108_1016465 3300048911 Bacteria 707
207 Ga0496109_0000003 3300048912 Bacteria 420862
208 Ga0496110_0000087 3300048913 Bacteria 48905
209 Ga0496110_0044439 3300048913 Bacteria 3879
210 Ga0496110_0344278 3300048913 Bacteria 1358
211 Ga0496110_0614443 3300048913 Bacteria 985
212 Ga0496110_1395016 3300048913 Bacteria 610
213 Ga0496111_0000010 3300048914 Bacteria 92600
214 Ga0496112_0000003 3300048915 Bacteria 660147
215 Ga0496112_0012119 3300048915 Bacteria 7911
216 Ga0496113_0000014 3300048916 Bacteria 79850
217 Ga0496113_0302902 3300048916 Bacteria 1280
218 Ga0496113_0855893 3300048916 Bacteria 720
219 Ga0496114_0000014 3300048917 Bacteria 297902
220 Ga0496114_0117487 3300048917 Bacteria 2284
221 Ga0496115_0000003 3300048918 Bacteria 354994
222 Ga0496115_0000125 3300048918 Bacteria 69936
223 Ga0496116_0003693 3300048919 Bacteria 14987
224 Ga0501031_0650498 3300049568 Bacteria 677
225 Ga0501034_0157713 3300049571 Bacteria 2242
226 Ga0501042_0302347 3300049578 Bacteria 1156
227 Ga0501070_0031626 3300049586 Bacteria 4434
228 nmdc:mga0qj67_769354_c1 3300050509 Bacteria 763
229 Ga0495601_0022106 3300053077 Bacteria 3903
230 Ga0495601_0060271 3300053077 Bacteria 2408
231 Ga0495601_0237335 3300053077 Bacteria 1190
232 Ga0495612_0005643 3300053078 Bacteria 5171
233 Ga0495655_0058618 3300053083 Bacteria 1043
234 Ga0495595_0000103 3300053084 Bacteria 38598
235 Ga0495619_0000025 3300053085 Bacteria 167905
236 Ga0495619_0000031 3300053085 Bacteria 145508
237 Ga0495619_0009830 3300053085 Bacteria 6030
238 Ga0495619_0038104 3300053085 Bacteria 3134
239 Ga0500614_012555 3300053123 Bacteria 1851
240 Ga0501082_0742866 3300060353 Bacteria 859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100493071 Ga0068857_1004930712 108
2 3300006175 Ga0070712_100010232 Ga0070712_1000102324 108
3 3300025915 Ga0207693_10006565 Ga0207693_100065656 108
4 3300025944 Ga0207661_10000224 Ga0207661_100002242 108
5 3300026116 Ga0207674_10875456 Ga0207674_108754562 108
6 3300025917 Ga0207660_10062377 Ga0207660_100623771 111
7 3300005329 Ga0070683_100076871 Ga0070683_1000768713 112
8 3300005535 Ga0070684_100001272 Ga0070684_1000012727 112
9 3300025924 Ga0207694_10000004 Ga0207694_10000004498 112
10 3300025934 Ga0207686_10513108 Ga0207686_105131082 112
11 3300025944 Ga0207661_10017445 Ga0207661_100174453 112
12 3300005618 Ga0068864_100000045 Ga0068864_100000045141 113
13 3300026095 Ga0207676_10000016 Ga0207676_1000001623 113
14 3300026067 Ga0207678_10708898 Ga0207678_107088982 114
15 3300013104 Ga0157370_10019814 Ga0157370_100198142 116
16 3300005842 Ga0068858_100000091 Ga0068858_10000009132 119
17 3300025972 Ga0207668_10997021 Ga0207668_109970211 119
18 3300026035 Ga0207703_10000152 Ga0207703_1000015233 119
19 3300032126 Ga0307415_100061447 Ga0307415_1000614473 119
20 3300047321 Ga0495676_0434141 Ga0495676_0434141_259_657 119
21 3300009553 Ga0105249_11923112 Ga0105249_119231122 120
22 3300013308 Ga0157375_10993482 Ga0157375_109934821 120
23 3300025934 Ga0207686_10010146 Ga0207686_100101463 120
24 3300046559 Ga0495667_0229834 Ga0495667_0229834_744_1148 120
25 3300048919 Ga0496116_0003693 Ga0496116_0003693_262_711 120
26 3300053085 Ga0495619_0000025 Ga0495619_0000025_20339_20743 120
27 3300013296 Ga0157374_10047779 Ga0157374_100477792 122
28 3300014969 Ga0157376_11865692 Ga0157376_118656922 122
29 3300026041 Ga0207639_10341658 Ga0207639_103416582 122
30 3300044694 Ga0466963_0030778 Ga0466963_0030778_1411_1812 122
31 3300045976 Ga0466967_1130897 Ga0466967_1130897_185_586 122
32 3300046461 Ga0495641_0227926 Ga0495641_0227926_57_452 122
33 3300047317 Ga0495604_0012279 Ga0495604_0012279_4521_4916 122
34 3300047472 Ga0495686_0120508 Ga0495686_0120508_91_489 122
35 3300005336 Ga0070680_100373991 Ga0070680_1003739912 123
36 3300005356 Ga0070674_100000008 Ga0070674_10000000818 123
37 3300005458 Ga0070681_10086903 Ga0070681_100869032 123
38 3300005530 Ga0070679_100001522 Ga0070679_10000152221 123
39 3300005535 Ga0070684_100013689 Ga0070684_1000136892 123
40 3300005614 Ga0068856_100379948 Ga0068856_1003799482 123
41 3300005718 Ga0068866_10000237 Ga0068866_1000023714 123
42 3300005842 Ga0068858_100000216 Ga0068858_10000021635 123
43 3300009101 Ga0105247_10356388 Ga0105247_103563882 123
44 3300009148 Ga0105243_12651072 Ga0105243_126510721 123
45 3300009176 Ga0105242_10067981 Ga0105242_100679812 123
46 3300009176 Ga0105242_11369335 Ga0105242_113693352 123
47 3300009553 Ga0105249_12397608 Ga0105249_123976082 123
48 3300013104 Ga0157370_10901961 Ga0157370_109019611 123
49 3300025899 Ga0207642_10000122 Ga0207642_100001224 123
50 3300025912 Ga0207707_10071007 Ga0207707_100710072 123
51 3300025921 Ga0207652_10005524 Ga0207652_1000552411 123
52 3300025934 Ga0207686_10039588 Ga0207686_100395884 123
53 3300025935 Ga0207709_11558964 Ga0207709_115589641 123
54 3300025937 Ga0207669_10000004 Ga0207669_10000004190 123
55 3300025944 Ga0207661_10004878 Ga0207661_100048783 123
56 3300026035 Ga0207703_10000023 Ga0207703_10000023181 123
57 3300026041 Ga0207639_10041767 Ga0207639_100417673 123
58 3300026078 Ga0207702_10003484 Ga0207702_1000348413 123
59 3300028379 Ga0268266_10000047 Ga0268266_10000047271 123
60 3300041512 Ga0451853_2516419 Ga0451853_2516419_1213_1611 123
61 3300044694 Ga0466963_0000001 Ga0466963_0000001_56623_57021 123
62 3300046455 Ga0495603_0007614 Ga0495603_0007614_86_484 123
63 3300046461 Ga0495641_0000044 Ga0495641_0000044_51983_52381 123
64 3300046461 Ga0495641_0081828 Ga0495641_0081828_484_882 123
65 3300046462 Ga0495651_0268487 Ga0495651_0268487_123_521 123
66 3300046516 Ga0495628_0238031 Ga0495628_0238031_555_953 123
67 3300046517 Ga0495630_1044054 Ga0495630_1044054_71_469 123
68 3300046539 Ga0495621_0001829 Ga0495621_0001829_2765_3163 123
69 3300046543 Ga0495645_0315645 Ga0495645_0315645_332_730 123
70 3300046616 Ga0495668_0036089 Ga0495668_0036089_1652_2050 123
71 3300046663 Ga0495635_0000016 Ga0495635_0000016_143964_144362 123
72 3300046689 Ga0495613_0000803 Ga0495613_0000803_83_481 123
73 3300046690 Ga0495624_0008756 Ga0495624_0008756_6282_6680 123
74 3300046694 Ga0495649_0024848 Ga0495649_0024848_59_457 123
75 3300046809 Ga0495600_0062863 Ga0495600_0062863_45_443 123
76 3300046809 Ga0495600_0361691 Ga0495600_0361691_364_762 123
77 3300047321 Ga0495676_0062651 Ga0495676_0062651_2428_2826 123
78 3300047322 Ga0495680_0000773 Ga0495680_0000773_984_1382 123
79 3300047322 Ga0495680_0011368 Ga0495680_0011368_7395_7793 123
80 3300047446 Ga0495679_022369 Ga0495679_022369_1722_2120 123
81 3300047447 Ga0495685_029696 Ga0495685_029696_30_428 123
82 3300048088 Ga0495602_0126997 Ga0495602_0126997_283_687 123
83 3300048911 Ga0496108_0923492 Ga0496108_0923492_35_436 123
84 3300048913 Ga0496110_0044439 Ga0496110_0044439_3398_3796 123
85 3300048913 Ga0496110_1395016 Ga0496110_1395016_33_434 123
86 3300048915 Ga0496112_0000003 Ga0496112_0000003_23947_24348 123
87 3300048916 Ga0496113_0855893 Ga0496113_0855893_30_428 123
88 3300050509 nmdc:mga0qj67_769354_c1 nmdc:mga0qj67_769354_c1_153_560 123
89 3300053077 Ga0495601_0237335 Ga0495601_0237335_72_470 123
90 3300053078 Ga0495612_0005643 Ga0495612_0005643_13_411 123
91 3300053123 Ga0500614_012555 Ga0500614_012555_1386_1784 123
92 3300002074 JGI24748J21848_1009116 JGI24748J21848_10091162 124
93 3300002239 JGI24034J26672_10001036 JGI24034J26672_100010363 124
94 3300002459 JGI24751J29686_10054955 JGI24751J29686_100549552 124
95 3300005329 Ga0070683_100000336 Ga0070683_1000003365 124
96 3300005329 Ga0070683_101096847 Ga0070683_1010968472 124
97 3300005337 Ga0070682_100000045 Ga0070682_100000045129 124
98 3300005338 Ga0068868_100000082 Ga0068868_10000008226 124
99 3300005339 Ga0070660_101004042 Ga0070660_1010040421 124
100 3300005435 Ga0070714_100440275 Ga0070714_1004402751 124
101 3300005439 Ga0070711_100063744 Ga0070711_1000637443 124
102 3300005457 Ga0070662_100000004 Ga0070662_10000000458 124
103 3300005535 Ga0070684_100266784 Ga0070684_1002667841 124
104 3300005535 Ga0070684_100835338 Ga0070684_1008353382 124
105 3300005547 Ga0070693_100006288 Ga0070693_1000062885 124
106 3300005563 Ga0068855_100223784 Ga0068855_1002237842 124
107 3300005564 Ga0070664_100065881 Ga0070664_1000658813 124
108 3300005564 Ga0070664_100664130 Ga0070664_1006641302 124
109 3300005577 Ga0068857_100742089 Ga0068857_1007420892 124
110 3300005578 Ga0068854_100000136 Ga0068854_10000013622 124
111 3300005578 Ga0068854_100005170 Ga0068854_1000051703 124
112 3300005614 Ga0068856_100000757 Ga0068856_10000075723 124
113 3300005616 Ga0068852_100465043 Ga0068852_1004650432 124
114 3300005616 Ga0068852_100570295 Ga0068852_1005702952 124
115 3300005840 Ga0068870_11298348 Ga0068870_112983482 124
116 3300005841 Ga0068863_100000021 Ga0068863_100000021181 124
117 3300006163 Ga0070715_10000001 Ga0070715_10000001293 124
118 3300006163 Ga0070715_10213930 Ga0070715_102139302 124
119 3300006881 Ga0068865_100000165 Ga0068865_1000001658 124
120 3300009094 Ga0111539_13435422 Ga0111539_134354221 124
121 3300009098 Ga0105245_10000016 Ga0105245_1000001630 124
122 3300009098 Ga0105245_10014976 Ga0105245_100149765 124
123 3300009098 Ga0105245_12260771 Ga0105245_122607711 124
124 3300009553 Ga0105249_10000068 Ga0105249_10000068147 124
125 3300010375 Ga0105239_10435295 Ga0105239_104352952 124
126 3300013307 Ga0157372_10000129 Ga0157372_1000012976 124
127 3300013308 Ga0157375_10001152 Ga0157375_1000115218 124
128 3300013308 Ga0157375_11053043 Ga0157375_110530431 124
129 3300014325 Ga0163163_10661659 Ga0163163_106616592 124
130 3300014326 Ga0157380_10001196 Ga0157380_100011969 124
131 3300017792 Ga0163161_10000035 Ga0163161_10000035103 124
132 3300017792 Ga0163161_10024890 Ga0163161_100248904 124
133 3300025893 Ga0207682_10000031 Ga0207682_1000003126 124
134 3300025905 Ga0207685_10000082 Ga0207685_1000008217 124
135 3300025908 Ga0207643_10856085 Ga0207643_108560852 124
136 3300025927 Ga0207687_10000018 Ga0207687_10000018194 124
137 3300025928 Ga0207700_10067053 Ga0207700_100670532 124
138 3300025929 Ga0207664_10113796 Ga0207664_101137963 124
139 3300025933 Ga0207706_10000012 Ga0207706_10000012160 124
140 3300025938 Ga0207704_10000093 Ga0207704_1000009310 124
141 3300025944 Ga0207661_10528724 Ga0207661_105287241 124
142 3300025944 Ga0207661_10774367 Ga0207661_107743672 124
143 3300025945 Ga0207679_10051574 Ga0207679_100515742 124
144 3300025949 Ga0207667_10184731 Ga0207667_101847313 124
145 3300025961 Ga0207712_10000007 Ga0207712_10000007300 124
146 3300025981 Ga0207640_10007209 Ga0207640_100072092 124
147 3300026023 Ga0207677_10000519 Ga0207677_100005196 124
148 3300026075 Ga0207708_10140495 Ga0207708_101404952 124
149 3300026078 Ga0207702_10000060 Ga0207702_1000006048 124
150 3300026088 Ga0207641_10000151 Ga0207641_1000015177 124
151 3300026121 Ga0207683_10683202 Ga0207683_106832022 124
152 3300026142 Ga0207698_10027046 Ga0207698_100270464 124
153 3300026142 Ga0207698_10306501 Ga0207698_103065012 124
154 3300028558 Ga0265326_10096351 Ga0265326_100963512 124
155 3300028563 Ga0265319_1000122 Ga0265319_10001229 124
156 3300028800 Ga0265338_10000706 Ga0265338_100007069 124
157 3300031238 Ga0265332_10207328 Ga0265332_102073282 124
158 3300031241 Ga0265325_10039094 Ga0265325_100390942 124
159 3300036401 Ga0373937_0056286 Ga0373937_0056286_495_908 124
160 3300041459 Ga0451800_0719914 Ga0451800_0719914_34_435 124
161 3300041460 Ga0451802_0331405 Ga0451802_0331405_239_640 124
162 3300041486 Ga0451807_1599059 Ga0451807_1599059_319_720 124
163 3300041501 Ga0451845_0741283 Ga0451845_0741283_53_454 124
164 3300044842 Ga0466957_0110381 Ga0466957_0110381_1215_1622 124
165 3300045976 Ga0466967_0000009 Ga0466967_0000009_22534_22941 124
166 3300046454 Ga0495592_0459716 Ga0495592_0459716_113_526 124
167 3300046455 Ga0495603_0000144 Ga0495603_0000144_2552_2953 124
168 3300046455 Ga0495603_0001027 Ga0495603_0001027_14681_15094 124
169 3300046459 Ga0495629_0808583 Ga0495629_0808583_132_542 124
170 3300046461 Ga0495641_0019025 Ga0495641_0019025_2812_3216 124
171 3300046463 Ga0495653_0202545 Ga0495653_0202545_320_721 124
172 3300046463 Ga0495653_0489040 Ga0495653_0489040_131_544 124
173 3300046476 Ga0495662_0672600 Ga0495662_0672600_57_458 124
174 3300046500 Ga0495596_0330518 Ga0495596_0330518_161_562 124
175 3300046511 Ga0495608_0000583 Ga0495608_0000583_24101_24502 124
176 3300046515 Ga0495620_0000144 Ga0495620_0000144_24826_25227 124
177 3300046516 Ga0495628_0000891 Ga0495628_0000891_10464_10865 124
178 3300046516 Ga0495628_0030627 Ga0495628_0030627_163_573 124
179 3300046516 Ga0495628_0092384 Ga0495628_0092384_1855_2256 124
180 3300046516 Ga0495628_0238626 Ga0495628_0238626_31_435 124
181 3300046517 Ga0495630_0000056 Ga0495630_0000056_61746_62150 124
182 3300046536 Ga0495587_0002239 Ga0495587_0002239_52_453 124
183 3300046537 Ga0495598_0148171 Ga0495598_0148171_364_765 124
184 3300046559 Ga0495667_0000018 Ga0495667_0000018_182526_182927 124
185 3300046642 Ga0495634_0000018 Ga0495634_0000018_79647_80048 124
186 3300046642 Ga0495634_0187964 Ga0495634_0187964_424_834 124
187 3300046665 Ga0495661_0361358 Ga0495661_0361358_29_430 124
188 3300046675 Ga0495657_0506083 Ga0495657_0506083_278_691 124
189 3300046681 Ga0495647_0000008 Ga0495647_0000008_34229_34630 124
190 3300046681 Ga0495647_0000631 Ga0495647_0000631_7264_7668 124
191 3300046681 Ga0495647_0011686 Ga0495647_0011686_460_873 124
192 3300046683 Ga0495658_0004778 Ga0495658_0004778_5478_5885 124
193 3300046683 Ga0495658_0148165 Ga0495658_0148165_662_1072 124
194 3300046683 Ga0495658_0329971 Ga0495658_0329971_341_754 124
195 3300046684 Ga0495669_0000211 Ga0495669_0000211_11254_11658 124
196 3300046689 Ga0495613_0000113 Ga0495613_0000113_40335_40769 124
197 3300046690 Ga0495624_0000008 Ga0495624_0000008_77683_78084 124
198 3300046809 Ga0495600_0079406 Ga0495600_0079406_186_599 124
199 3300047317 Ga0495604_0000019 Ga0495604_0000019_145477_145878 124
200 3300047322 Ga0495680_0001716 Ga0495680_0001716_685_1086 124
201 3300047471 Ga0495684_0154398 Ga0495684_0154398_1260_1661 124
202 3300047673 Ga0495593_0027886 Ga0495593_0027886_2632_3033 124
203 3300048088 Ga0495602_0000533 Ga0495602_0000533_10974_11375 124
204 3300048903 Ga0496100_0000002 Ga0496100_0000002_294969_295373 124
205 3300048904 Ga0496101_0000001 Ga0496101_0000001_294969_295373 124
206 3300048907 Ga0496104_0000009 Ga0496104_0000009_172875_173279 124
207 3300048907 Ga0496104_0000650 Ga0496104_0000650_1327_1728 124
208 3300048908 Ga0496105_0000007 Ga0496105_0000007_314777_315181 124
209 3300048908 Ga0496105_0000347 Ga0496105_0000347_30069_30470 124
210 3300048909 Ga0496106_0000061 Ga0496106_0000061_55869_56273 124
211 3300048909 Ga0496106_0000997 Ga0496106_0000997_19765_20166 124
212 3300048909 Ga0496106_0334070 Ga0496106_0334070_541_942 124
213 3300048910 Ga0496107_0000013 Ga0496107_0000013_122013_122417 124
214 3300048910 Ga0496107_0105665 Ga0496107_0105665_381_782 124
215 3300048911 Ga0496108_0000001 Ga0496108_0000001_584468_584872 124
216 3300048911 Ga0496108_1016465 Ga0496108_1016465_284_694 124
217 3300048912 Ga0496109_0000003 Ga0496109_0000003_259014_259418 124
218 3300048913 Ga0496110_0000087 Ga0496110_0000087_10519_10920 124
219 3300048913 Ga0496110_0344278 Ga0496110_0344278_776_1177 124
220 3300048913 Ga0496110_0614443 Ga0496110_0614443_204_614 124
221 3300048914 Ga0496111_0000010 Ga0496111_0000010_38027_38428 124
222 3300048915 Ga0496112_0012119 Ga0496112_0012119_815_1216 124
223 3300048916 Ga0496113_0000014 Ga0496113_0000014_9068_9469 124
224 3300048916 Ga0496113_0302902 Ga0496113_0302902_536_946 124
225 3300048917 Ga0496114_0000014 Ga0496114_0000014_231130_231531 124
226 3300048917 Ga0496114_0117487 Ga0496114_0117487_1511_1912 124
227 3300048918 Ga0496115_0000003 Ga0496115_0000003_209245_209646 124
228 3300048918 Ga0496115_0000125 Ga0496115_0000125_52789_53190 124
229 3300049568 Ga0501031_0650498 Ga0501031_0650498_22_423 124
230 3300049571 Ga0501034_0157713 Ga0501034_0157713_1397_1798 124
231 3300049578 Ga0501042_0302347 Ga0501042_0302347_488_889 124
232 3300049586 Ga0501070_0031626 Ga0501070_0031626_1278_1682 124
233 3300053077 Ga0495601_0022106 Ga0495601_0022106_1464_1898 124
234 3300053077 Ga0495601_0060271 Ga0495601_0060271_1462_1869 124
235 3300053083 Ga0495655_0058618 Ga0495655_0058618_563_964 124
236 3300053084 Ga0495595_0000103 Ga0495595_0000103_30771_31172 124
237 3300053085 Ga0495619_0000031 Ga0495619_0000031_68252_68653 124
238 3300053085 Ga0495619_0009830 Ga0495619_0009830_1001_1411 124
239 3300053085 Ga0495619_0038104 Ga0495619_0038104_735_1148 124
240 3300060353 Ga0501082_0742866 Ga0501082_0742866_26_427 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

36

151

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ce8-assembly1.cif.gz_E cytochrome c maturation complex ccmabcde 0.8239 29 115
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8138 41 115
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8024 30 114
8x70-assembly4.cif.gz_D the crystal structure of ifi16 from biortus. 0.7876 27 115
3f8t-assembly1.cif.gz_A crystal structure analysis of a full-length mcm homolog from methanopyrus kandleri 0.7728 34 113
ID Description Score Start End Superfamily
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8138 41 115 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8024 30 114 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7974 34 114 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7795 39 117 2.40.50.140
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7743 28 121 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V8Z3B8-F1-model_v4 Cytochrome c maturation protein CcmE 0.9043 29 116 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-Q68WF0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.8976 29 116 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A0K8P2I1-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.8962 29 118 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A2I0NJJ1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.8958 27 119 GO:0005886
GO:0017004
GO:0020037
AF-A0A838HMP1-F1-model_v4 Cytochrome c maturation protein CcmE 0.8943 27 106 GO:0005886
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
79.65 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map