F353000

General Info

Members Datasets Scaffolds Average Seq Length
240 171 480 387

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10023231|Ga0307405_100232313
Length 469
Sequence MAYEFKLPDIGEGVVEGEVVSWKVAVGERIVVDQPLVEIMTDKATVEIPSPRAGVVRMLGFKEGDICPVGAVLVVIEEGDKPSSSAGTTLDQAPSANLGRKRPASDDRPTLRMSMDGAVARERVKATPATRRLARELGVELGHVEPTGKRGRVTTDDVRRVVDTSPTQRGFEQPAATHQAPTQPVGPRPGTRPAAAQQAKAQHSDEPTLVTLRVPESAGPPAPVREHAPVAVASQGAEERIPFRGLRKRIADNMVRSRHTAAHFTYVEEVDMTDLVEVRDRARQRAADRGLKLTFLPFLIKAVVSGLKRWPQLNAALDETTQEIVRKKYYHIGIASQGPQGLMVTVLRDADRRSIFDLAAEIQRLAQAVQDGNVRREELTGSTFTITSLGKLGGVLATPILNFPEVGIIGVHEMKQRPAVHNGEIVIRWLMNLSISLDHRLVDGWDGAMFLQEVKSLLEDPTTMFLEMV

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
135 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
136 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
137 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
158 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
167 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 0
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10023231 3300031731 Bacteria 3521
2 rootH1_10168151 3300003323 Bacteria 2805
3 Ga0070683_100053654 3300005329 Bacteria 3736
4 Ga0070690_100020334 3300005330 Bacteria 4044
5 Ga0070690_100021322 3300005330 Bacteria 3954
6 Ga0068869_100018482 3300005334 Bacteria 4746
7 Ga0068869_100075681 3300005334 Bacteria 2502
8 Ga0070680_100000519 3300005336 Bacteria 26424
9 Ga0070682_100046181 3300005337 Bacteria 2702
10 Ga0070660_100004537 3300005339 Bacteria 9597
11 Ga0070661_100004858 3300005344 Bacteria 9256
12 Ga0070669_100026734 3300005353 Bacteria 4152
13 Ga0070667_100005887 3300005367 Bacteria 10212
14 Ga0070701_10066562 3300005438 Bacteria 1915
15 Ga0070711_100049193 3300005439 Bacteria 2887
16 Ga0070700_100071851 3300005441 Bacteria 2210
17 Ga0070694_100083883 3300005444 Bacteria 2221
18 Ga0070681_10000619 3300005458 Bacteria 29107
19 Ga0070681_10050664 3300005458 Bacteria 4143
20 Ga0068867_100010388 3300005459 Bacteria 6569
21 Ga0070706_100000243 3300005467 Bacteria 66436
22 Ga0070698_100003104 3300005471 Bacteria 18306
23 Ga0070679_100001338 3300005530 Bacteria 21747
24 Ga0070679_100033607 3300005530 Bacteria 5079
25 Ga0070672_100023973 3300005543 Bacteria 4501
26 Ga0070672_100033926 3300005543 Bacteria 3868
27 Ga0070672_100102791 3300005543 Bacteria 2320
28 Ga0070696_100012964 3300005546 Bacteria 5596
29 Ga0070665_100105653 3300005548 Bacteria 2818
30 Ga0070665_100192107 3300005548 Bacteria 2042
31 Ga0068855_100005710 3300005563 Bacteria 15198
32 Ga0068855_100016169 3300005563 Bacteria 8970
33 Ga0068854_100096401 3300005578 Bacteria 2210
34 Ga0068856_100026601 3300005614 Bacteria 5642
35 Ga0068856_100183474 3300005614 Bacteria 2106
36 Ga0070702_100011612 3300005615 Bacteria 4386
37 Ga0068860_100053547 3300005843 Bacteria 3837
38 Ga0068862_100036432 3300005844 Bacteria 4170
39 Ga0081455_10002953 3300005937 Bacteria 19885
40 Ga0070717_10026048 3300006028 Bacteria 4660
41 Ga0070717_10034935 3300006028 Bacteria 4066
42 Ga0075430_100191782 3300006846 Bacteria 1698
43 Ga0075431_100169534 3300006847 Bacteria 2243
44 Ga0075429_100029302 3300006880 Bacteria 4781
45 Ga0068865_100001388 3300006881 Bacteria 14068
46 Ga0099794_10000078 3300007265 Bacteria 36028
47 Ga0105240_10000921 3300009093 Bacteria 52415
48 Ga0111539_10035202 3300009094 Bacteria 6064
49 Ga0111539_10066210 3300009094 Bacteria 4267
50 Ga0105245_10018884 3300009098 Bacteria 6033
51 Ga0114129_10129644 3300009147 Bacteria 3466
52 Ga0114129_10221385 3300009147 Bacteria 2553
53 Ga0105243_10013823 3300009148 Bacteria 6109
54 Ga0105242_10007443 3300009176 Bacteria 8430
55 Ga0105248_10053140 3300009177 Bacteria 4546
56 Ga0105249_10058566 3300009553 Bacteria 3530
57 Ga0105246_10004012 3300011119 Bacteria 8936
58 Ga0157370_10000715 3300013104 Bacteria 41556
59 Ga0157369_10004931 3300013105 Bacteria 15632
60 Ga0157378_10111444 3300013297 Bacteria 2509
61 Ga0157377_10004622 3300014745 Bacteria 6366
62 Ga0157376_10101911 3300014969 Bacteria 2510
63 Ga0213876_10020546 3300021384 Bacteria 3490
64 Ga0207688_10004726 3300025901 Bacteria 7416
65 Ga0207645_10007343 3300025907 Bacteria 7791
66 Ga0207684_10000113 3300025910 Bacteria 150344
67 Ga0207707_10000038 3300025912 Bacteria 143359
68 Ga0207695_10023205 3300025913 Bacteria 7019
69 Ga0207660_10020331 3300025917 Bacteria 4452
70 Ga0207660_10045110 3300025917 Bacteria 3104
71 Ga0207657_10004620 3300025919 Bacteria 14541
72 Ga0207649_10007600 3300025920 Bacteria 5894
73 Ga0207652_10095000 3300025921 Bacteria 2625
74 Ga0207659_10012339 3300025926 Bacteria 5434
75 Ga0207687_10000230 3300025927 Bacteria 38174
76 Ga0207687_10006541 3300025927 Bacteria 7694
77 Ga0207690_10184531 3300025932 Bacteria 1573
78 Ga0207706_10000113 3300025933 Bacteria 87078
79 Ga0207709_10009860 3300025935 Bacteria 5257
80 Ga0207670_10016374 3300025936 Bacteria 4454
81 Ga0207669_10016129 3300025937 Bacteria 3787
82 Ga0207691_10007905 3300025940 Bacteria 10241
83 Ga0207691_10019282 3300025940 Bacteria 6456
84 Ga0207689_10044176 3300025942 Bacteria 3683
85 Ga0207689_10051271 3300025942 Bacteria 3401
86 Ga0207689_10223294 3300025942 Bacteria 1557
87 Ga0207661_10070751 3300025944 Bacteria 2849
88 Ga0207667_10005680 3300025949 Bacteria 15206
89 Ga0207667_10009653 3300025949 Bacteria 11352
90 Ga0207667_10009751 3300025949 Bacteria 11292
91 Ga0207668_10104093 3300025972 Bacteria 2115
92 Ga0207658_10041385 3300025986 Bacteria 3336
93 Ga0207708_10001185 3300026075 Bacteria 19625
94 Ga0207702_10058189 3300026078 Archaea 3288
95 Ga0207641_10042950 3300026088 Bacteria 3794
96 Ga0207641_10142095 3300026088 Bacteria 2167
97 Ga0207648_10001447 3300026089 Bacteria 26146
98 Ga0207674_10304547 3300026116 Bacteria 1543
99 Ga0207683_10078201 3300026121 Bacteria 2931
100 Ga0209973_1000524 3300027252 Bacteria 2930
101 Ga0209996_1000194 3300027395 Bacteria 7807
102 Ga0209995_1000281 3300027471 Bacteria 8022
103 Ga0209968_1000072 3300027526 Bacteria 18128
104 Ga0210002_1000340 3300027617 Bacteria 6387
105 Ga0209588_1000004 3300027671 Bacteria 228800
106 Ga0209971_1002518 3300027682 Bacteria 4394
107 Ga0209966_1000359 3300027695 Bacteria 13919
108 Ga0209998_10000602 3300027717 Bacteria 9649
109 Ga0209974_10001781 3300027876 Bacteria 7857
110 Ga0209974_10004701 3300027876 Bacteria 4849
111 Ga0207428_10031763 3300027907 Bacteria 4352
112 Ga0207428_10042234 3300027907 Bacteria 3687
113 Ga0268266_10006393 3300028379 Bacteria 10795
114 Ga0268264_10207186 3300028381 Bacteria 1798
115 Ga0265319_1000055 3300028563 Bacteria 89661
116 Ga0265319_1008365 3300028563 Bacteria 4545
117 Ga0265334_10039499 3300028573 Bacteria 1852
118 Ga0265318_10000027 3300028577 Bacteria 153682
119 Ga0265318_10000239 3300028577 Bacteria 47921
120 Ga0265318_10004507 3300028577 Bacteria 6737
121 Ga0307515_10015429 3300028794 Bacteria 14077
122 Ga0265338_10033063 3300028800 Bacteria 5028
123 Ga0265338_10137491 3300028800 Bacteria 1918
124 Ga0265330_10000036 3300031235 Bacteria 121416
125 Ga0265330_10000208 3300031235 Bacteria 45603
126 Ga0265330_10011004 3300031235 Bacteria 4247
127 Ga0265332_10000066 3300031238 Bacteria 89999
128 Ga0265332_10000399 3300031238 Bacteria 31504
129 Ga0265332_10001924 3300031238 Bacteria 10994
130 Ga0265332_10010188 3300031238 Bacteria 4184
131 Ga0265328_10004606 3300031239 Bacteria 5969
132 Ga0265320_10000018 3300031240 Bacteria 183411
133 Ga0265320_10000093 3300031240 Bacteria 74621
134 Ga0265320_10026780 3300031240 Bacteria 3013
135 Ga0265325_10000186 3300031241 Bacteria 44210
136 Ga0265329_10000009 3300031242 Bacteria 74040
137 Ga0265340_10000526 3300031247 Bacteria 21115
138 Ga0265340_10000607 3300031247 Bacteria 20008
139 Ga0265339_10005009 3300031249 Bacteria 8913
140 Ga0265339_10033945 3300031249 Bacteria 2870
141 Ga0265331_10000046 3300031250 Bacteria 183360
142 Ga0265331_10000467 3300031250 Bacteria 38771
143 Ga0265331_10003501 3300031250 Bacteria 10112
144 Ga0265316_10000154 3300031344 Bacteria 76008
145 Ga0265316_10000615 3300031344 Bacteria 39611
146 Ga0265316_10001871 3300031344 Bacteria 22114
147 Ga0265316_10010882 3300031344 Bacteria 8260
148 Ga0307513_10006138 3300031456 Bacteria 15767
149 Ga0307509_10000052 3300031507 Bacteria 164947
150 Ga0307509_10003287 3300031507 Bacteria 24839
151 Ga0307509_10061645 3300031507 Bacteria 3958
152 Ga0307509_10070482 3300031507 Bacteria 3650
153 Ga0265313_10000064 3300031595 Bacteria 103797
154 Ga0265313_10000287 3300031595 Bacteria 55386
155 Ga0265313_10001158 3300031595 Bacteria 25185
156 Ga0307508_10002985 3300031616 Bacteria 17449
157 Ga0265314_10000137 3300031711 Bacteria 109629
158 Ga0265314_10000184 3300031711 Bacteria 92453
159 Ga0265342_10000140 3300031712 Bacteria 80974
160 Ga0307516_10010319 3300031730 Bacteria 10281
161 Ga0307516_10014642 3300031730 Bacteria 8286
162 Ga0307416_100245726 3300032002 Bacteria 1738
163 Ga0373950_0000003 3300034818 Bacteria 541085
164 Ga0373958_0004876 3300034819 Bacteria 2009
165 Ga0373949_0000309 3300035090 Bacteria 17527
166 Ga0373936_0000037 3300035113 Bacteria 98939
167 Ga0373941_0009736 3300035115 Bacteria 2428
168 Ga0373961_0000207 3300035241 Bacteria 27765
169 Ga0373931_0012165 3300035691 Bacteria 4166
170 Ga0373937_0132097 3300036401 Bacteria 2332
171 Ga0395899_0016756 3300037312 Bacteria 5587
172 Ga0395900_0006277 3300037418 Bacteria 12401
173 Ga0395905_0084378 3300037471 Bacteria 2976
174 Ga0395901_0096211 3300038443 Bacteria 3103
175 Ga0436365_1073667 3300039437 Bacteria 6786
176 Ga0439432_006759 3300042006 Bacteria 4084
177 Ga0451577_0033820 3300042876 Bacteria 4609
178 Ga0453683_0000453 3300044673 Bacteria 47152
179 Ga0453684_0015428 3300044712 Bacteria 12088
180 Ga0451576_0033937 3300045051 Bacteria 5421
181 Ga0451576_0113108 3300045051 Bacteria 2825
182 Ga0451576_0137532 3300045051 Bacteria 2548
183 Ga0451576_0140255 3300045051 Bacteria 2521
184 Ga0451576_0159376 3300045051 Bacteria 2354
185 Ga0501291_001272 3300049514 Bacteria 2919
186 Ga0501295_003738 3300049518 Bacteria 1905
187 Ga0501298_002373 3300049521 Bacteria 2841
188 Ga0501299_004815 3300049522 Bacteria 2042
189 Ga0501299_005215 3300049522 Bacteria 1986
190 Ga0501031_0001448 3300049568 Bacteria 14734
191 Ga0501031_0012122 3300049568 Bacteria 5620
192 Ga0501036_0026969 3300049572 Bacteria 4855
193 Ga0501036_0051160 3300049572 Bacteria 3498
194 Ga0501036_0083499 3300049572 Bacteria 2700
195 Ga0501036_0087197 3300049572 Bacteria 2638
196 Ga0501037_0013950 3300049573 Bacteria 5923
197 Ga0501037_0047609 3300049573 Bacteria 3141
198 Ga0501038_0022613 3300049574 Bacteria 5631
199 Ga0501038_0119635 3300049574 Bacteria 2174
200 Ga0501039_0012675 3300049575 Bacteria 6443
201 Ga0501039_0019062 3300049575 Bacteria 5263
202 Ga0501041_0002980 3300049577 Bacteria 9709
203 Ga0501041_0052754 3300049577 Bacteria 2479
204 Ga0501042_0002168 3300049578 Bacteria 11950
205 Ga0501042_0007594 3300049578 Bacteria 7113
206 Ga0501046_0028425 3300049580 Bacteria 4553
207 Ga0501046_0029261 3300049580 Bacteria 4478
208 Ga0501047_0025841 3300049581 Bacteria 5647
209 Ga0501048_0009389 3300049582 Bacteria 7344
210 Ga0501067_0000092 3300049583 Bacteria 52348
211 Ga0501070_0102158 3300049586 Bacteria 2371
212 Ga0501071_0069719 3300049587 Bacteria 2561
213 Ga0501071_0109116 3300049587 Unclassified 2044
214 Ga0501072_0065364 3300049588 Bacteria 2868
215 Ga0501073_0000088 3300049589 Bacteria 58271
216 Ga0501073_0115037 3300049589 Bacteria 1865
217 Ga0501076_0005596 3300049592 Bacteria 9051
218 Ga0501227_000512 3300049665 Bacteria 8324
219 Ga0501221_008108 3300049704 Bacteria 1819
220 Ga0501080_0402242 3300049742 Archaea 1232
221 Ga0501266_004078 3300049763 Bacteria 1807
222 Ga0501279_002936 3300049775 Bacteria 2220
223 Ga0501035_0038344 3300049822 Bacteria 4339
224 Ga0501035_0088021 3300049822 Bacteria 2737
225 Ga0501044_0007055 3300049823 Bacteria 12362
226 nmdc:mga09592_189590_c1 3300050508 Bacteria 1780
227 nmdc:mga09592_33367_c1 3300050508 Bacteria 4296
228 nmdc:mga09592_41240_c1 3300050508 Bacteria 3881
229 nmdc:mga0qj67_126089_c1 3300050509 Bacteria 2072
230 nmdc:mga0qj67_55806_c1 3300050509 Bacteria 3130
231 nmdc:mga08y16_68413_c1 3300050511 Bacteria 3703
232 nmdc:mga0rr50_18126_c1 3300050513 Bacteria 4721
233 nmdc:mga0a205_9713_c1 3300050515 Bacteria 8812
234 Ga0500640_000129 3300053095 Bacteria 14473
235 Ga0500572_002774 3300053111 Bacteria 4134
236 Ga0500595_001594 3300053119 Bacteria 11965
237 Ga0500614_000066 3300053123 Bacteria 22909
238 Ga0500568_0007991 3300053139 Bacteria 5137
239 Ga0500568_0016555 3300053139 Bacteria 3274
240 Ga0501084_0107073 3300054114 Bacteria 2349
241 Ga0307405_10023231
242 rootH1_10168151
243 Ga0070683_100053654
244 Ga0070690_100020334
245 Ga0070690_100021322
246 Ga0068869_100018482
247 Ga0068869_100075681
248 Ga0070680_100000519
249 Ga0070682_100046181
250 Ga0070660_100004537
251 Ga0070661_100004858
252 Ga0070669_100026734
253 Ga0070667_100005887
254 Ga0070701_10066562
255 Ga0070711_100049193
256 Ga0070700_100071851
257 Ga0070694_100083883
258 Ga0070681_10000619
259 Ga0070681_10050664
260 Ga0068867_100010388
261 Ga0070706_100000243
262 Ga0070698_100003104
263 Ga0070679_100001338
264 Ga0070679_100033607
265 Ga0070672_100023973
266 Ga0070672_100033926
267 Ga0070672_100102791
268 Ga0070696_100012964
269 Ga0070665_100105653
270 Ga0070665_100192107
271 Ga0068855_100005710
272 Ga0068855_100016169
273 Ga0068854_100096401
274 Ga0068856_100026601
275 Ga0068856_100183474
276 Ga0070702_100011612
277 Ga0068860_100053547
278 Ga0068862_100036432
279 Ga0081455_10002953
280 Ga0070717_10026048
281 Ga0070717_10034935
282 Ga0075430_100191782
283 Ga0075431_100169534
284 Ga0075429_100029302
285 Ga0068865_100001388
286 Ga0099794_10000078
287 Ga0105240_10000921
288 Ga0111539_10035202
289 Ga0111539_10066210
290 Ga0105245_10018884
291 Ga0114129_10129644
292 Ga0114129_10221385
293 Ga0105243_10013823
294 Ga0105242_10007443
295 Ga0105248_10053140
296 Ga0105249_10058566
297 Ga0105246_10004012
298 Ga0157370_10000715
299 Ga0157369_10004931
300 Ga0157378_10111444
301 Ga0157377_10004622
302 Ga0157376_10101911
303 Ga0213876_10020546
304 Ga0207688_10004726
305 Ga0207645_10007343
306 Ga0207684_10000113
307 Ga0207707_10000038
308 Ga0207695_10023205
309 Ga0207660_10020331
310 Ga0207660_10045110
311 Ga0207657_10004620
312 Ga0207649_10007600
313 Ga0207652_10095000
314 Ga0207659_10012339
315 Ga0207687_10000230
316 Ga0207687_10006541
317 Ga0207690_10184531
318 Ga0207706_10000113
319 Ga0207709_10009860
320 Ga0207670_10016374
321 Ga0207669_10016129
322 Ga0207691_10007905
323 Ga0207691_10019282
324 Ga0207689_10044176
325 Ga0207689_10051271
326 Ga0207689_10223294
327 Ga0207661_10070751
328 Ga0207667_10005680
329 Ga0207667_10009653
330 Ga0207667_10009751
331 Ga0207668_10104093
332 Ga0207658_10041385
333 Ga0207708_10001185
334 Ga0207702_10058189
335 Ga0207641_10042950
336 Ga0207641_10142095
337 Ga0207648_10001447
338 Ga0207674_10304547
339 Ga0207683_10078201
340 Ga0209973_1000524
341 Ga0209996_1000194
342 Ga0209995_1000281
343 Ga0209968_1000072
344 Ga0210002_1000340
345 Ga0209588_1000004
346 Ga0209971_1002518
347 Ga0209966_1000359
348 Ga0209998_10000602
349 Ga0209974_10001781
350 Ga0209974_10004701
351 Ga0207428_10031763
352 Ga0207428_10042234
353 Ga0268266_10006393
354 Ga0268264_10207186
355 Ga0265319_1000055
356 Ga0265319_1008365
357 Ga0265334_10039499
358 Ga0265318_10000027
359 Ga0265318_10000239
360 Ga0265318_10004507
361 Ga0307515_10015429
362 Ga0265338_10033063
363 Ga0265338_10137491
364 Ga0265330_10000036
365 Ga0265330_10000208
366 Ga0265330_10011004
367 Ga0265332_10000066
368 Ga0265332_10000399
369 Ga0265332_10001924
370 Ga0265332_10010188
371 Ga0265328_10004606
372 Ga0265320_10000018
373 Ga0265320_10000093
374 Ga0265320_10026780
375 Ga0265325_10000186
376 Ga0265329_10000009
377 Ga0265340_10000526
378 Ga0265340_10000607
379 Ga0265339_10005009
380 Ga0265339_10033945
381 Ga0265331_10000046
382 Ga0265331_10000467
383 Ga0265331_10003501
384 Ga0265316_10000154
385 Ga0265316_10000615
386 Ga0265316_10001871
387 Ga0265316_10010882
388 Ga0307513_10006138
389 Ga0307509_10000052
390 Ga0307509_10003287
391 Ga0307509_10061645
392 Ga0307509_10070482
393 Ga0265313_10000064
394 Ga0265313_10000287
395 Ga0265313_10001158
396 Ga0307508_10002985
397 Ga0265314_10000137
398 Ga0265314_10000184
399 Ga0265342_10000140
400 Ga0307516_10010319
401 Ga0307516_10014642
402 Ga0307416_100245726
403 Ga0373950_0000003
404 Ga0373958_0004876
405 Ga0373949_0000309
406 Ga0373936_0000037
407 Ga0373941_0009736
408 Ga0373961_0000207
409 Ga0373931_0012165
410 Ga0373937_0132097
411 Ga0395899_0016756
412 Ga0395900_0006277
413 Ga0395905_0084378
414 Ga0395901_0096211
415 Ga0436365_1073667
416 Ga0439432_006759
417 Ga0451577_0033820
418 Ga0453683_0000453
419 Ga0453684_0015428
420 Ga0451576_0033937
421 Ga0451576_0113108
422 Ga0451576_0137532
423 Ga0451576_0140255
424 Ga0451576_0159376
425 Ga0501291_001272
426 Ga0501295_003738
427 Ga0501298_002373
428 Ga0501299_004815
429 Ga0501299_005215
430 Ga0501031_0001448
431 Ga0501031_0012122
432 Ga0501036_0026969
433 Ga0501036_0051160
434 Ga0501036_0083499
435 Ga0501036_0087197
436 Ga0501037_0013950
437 Ga0501037_0047609
438 Ga0501038_0022613
439 Ga0501038_0119635
440 Ga0501039_0012675
441 Ga0501039_0019062
442 Ga0501041_0002980
443 Ga0501041_0052754
444 Ga0501042_0002168
445 Ga0501042_0007594
446 Ga0501046_0028425
447 Ga0501046_0029261
448 Ga0501047_0025841
449 Ga0501048_0009389
450 Ga0501067_0000092
451 Ga0501070_0102158
452 Ga0501071_0069719
453 Ga0501071_0109116
454 Ga0501072_0065364
455 Ga0501073_0000088
456 Ga0501073_0115037
457 Ga0501076_0005596
458 Ga0501227_000512
459 Ga0501221_008108
460 Ga0501080_0402242
461 Ga0501266_004078
462 Ga0501279_002936
463 Ga0501035_0038344
464 Ga0501035_0088021
465 Ga0501044_0007055
466 nmdc:mga09592_189590_c1
467 nmdc:mga09592_33367_c1
468 nmdc:mga09592_41240_c1
469 nmdc:mga0qj67_126089_c1
470 nmdc:mga0qj67_55806_c1
471 nmdc:mga08y16_68413_c1
472 nmdc:mga0rr50_18126_c1
473 nmdc:mga0a205_9713_c1
474 Ga0500640_000129
475 Ga0500572_002774
476 Ga0500595_001594
477 Ga0500614_000066
478 Ga0500568_0007991
479 Ga0500568_0016555
480 Ga0501084_0107073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

235

466

0.99

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

3

76

0.98

PF02817

E3_binding

e3 binding domain

124

159

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y8n-assembly1.cif.gz_B-2 crystal structure of the pdk3-l2 complex 0.9582 3 77
1w88-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.958 108 145
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.9577 5 78
1y8p-assembly1.cif.gz_B crystal structure of the pdk3-l2 complex 0.9576 1 78
3rnm-assembly1.cif.gz_E the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) 0.9564 110 145
ID Description Score Start End Superfamily
af_B6TJY4_106_181_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 1.002 4 79 2.40.50.100
af_Q9VXY3_38_114_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9983 4 79 2.40.50.100
af_Q54TR7_75_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9922 1 78 2.40.50.100
af_B6TJY4_106_181_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9893 4 79 2.40.50.100
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9867 7 78 2.40.50.100
ID Description Score Start End GO Terms
AF-T1BEM6-F1-model_v4 Biotin/lipoyl attachment domain protein 0.9871 4 78 GO:0005737
GO:0016407
GO:0031405
AF-A0A1V5BXX3-F1-model_v4 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) 0.9867 4 79 GO:0004742
GO:0005737
GO:0031405
AF-A0A3G9M7X5-F1-model_v4 deleted 0.9851 3 77
AF-A0A6J4TNW2-F1-model_v4 Lipoyl-binding domain-containing protein 0.9783 2 78 GO:0006086
GO:0045254
AF-D8RJG0-F1-model_v4 Lipoyl-binding domain-containing protein 0.9773 2 77 GO:0006086
GO:0045254

Map