F353071

General Info

Members Datasets Scaffolds Average Seq Length
240 174 480 294

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0303249|Ga0436360_0303249_236_1147
Length 295
Sequence MLKVTPTGETLGATVEGLDLRQPMSDRTFATMLTALARHGVLRIPDQHIDAVQLKAFAARFGSLEINVANRFHELGHPEVMILSNVVENGQPIGFADAGQDWHTDMSYSETIAFANVLYALKVPRRDGRVLGNTEFANMYAAYEGLPEGLRQQLEGMTVLHDFNKFWEAMRGRPGSTRPPLSEVSHPIFLTHPVTGKKVLYANPGYAVRINELSPSESDEMLAFLFAHQLRREYRYAYRWSEDDVLIWDDICTLHNARADYGPVEHRLIKRCQVMADRIFEPEFAAKARAQVPAI

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
88 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
173 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
174 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 2.92
Rhizosphere 88.33
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0303249 3300039438 Bacteria 2011
2 Ga0070687_100169030 3300005343 Bacteria 1300
3 Ga0070692_10132963 3300005345 Bacteria 1400
4 Ga0070669_100008399 3300005353 Bacteria 7369
5 Ga0070669_100035344 3300005353 Bacteria 3620
6 Ga0070674_100039670 3300005356 Bacteria 3181
7 Ga0070659_100281218 3300005366 Bacteria 1384
8 Ga0070703_10016529 3300005406 Bacteria 2118
9 Ga0070714_100028256 3300005435 Bacteria 4651
10 Ga0070714_100061225 3300005435 Bacteria 3232
11 Ga0070714_100520621 3300005435 Bacteria 1136
12 Ga0070713_100103106 3300005436 Bacteria 2475
13 Ga0070713_100202759 3300005436 Unclassified 1792
14 Ga0070700_100004515 3300005441 Bacteria 7277
15 Ga0070694_100042550 3300005444 Bacteria 3035
16 Ga0070694_100085124 3300005444 Bacteria 2207
17 Ga0070694_100178606 3300005444 Bacteria 1569
18 Ga0070681_10106363 3300005458 Bacteria 2747
19 Ga0068867_100000933 3300005459 Bacteria 19900
20 Ga0068867_100125620 3300005459 Bacteria 1988
21 Ga0070707_100294203 3300005468 Bacteria 1578
22 Ga0070698_100148431 3300005471 Bacteria 2293
23 Ga0070699_100484523 3300005518 Bacteria 1123
24 Ga0070697_100308052 3300005536 Bacteria 1362
25 Ga0070697_100312381 3300005536 Bacteria 1352
26 Ga0070697_100327687 3300005536 Bacteria 1320
27 Ga0070672_100308869 3300005543 Bacteria 1342
28 Ga0070686_100431614 3300005544 Bacteria 1009
29 Ga0070695_100102409 3300005545 Bacteria 1931
30 Ga0070695_100198987 3300005545 Bacteria 1431
31 Ga0070696_100089545 3300005546 Bacteria 2188
32 Ga0070704_100063323 3300005549 Bacteria 2654
33 Ga0070664_100364812 3300005564 Bacteria 1316
34 Ga0068856_100083974 3300005614 Bacteria 3163
35 Ga0070702_100056210 3300005615 Bacteria 2272
36 Ga0068859_100454316 3300005617 Bacteria 1377
37 Ga0068864_100065664 3300005618 Bacteria 3148
38 Ga0068861_100010443 3300005719 Bacteria 6445
39 Ga0068858_100077059 3300005842 Bacteria 3097
40 Ga0068862_100011831 3300005844 Bacteria 7206
41 Ga0075363_100016008 3300006048 Bacteria 3697
42 Ga0075363_100239228 3300006048 Bacteria 1043
43 Ga0070716_100001211 3300006173 Bacteria 11352
44 Ga0075362_10016065 3300006177 Bacteria 3058
45 Ga0075369_10073952 3300006186 Bacteria 1503
46 Ga0075366_10019518 3300006195 Bacteria 3924
47 Ga0097621_100249051 3300006237 Bacteria 1555
48 Ga0068871_100385419 3300006358 Bacteria 1246
49 Ga0075428_100005195 3300006844 Bacteria 14462
50 Ga0075428_100005553 3300006844 Bacteria 14030
51 Ga0075428_100045262 3300006844 Bacteria 4835
52 Ga0075430_100003193 3300006846 Bacteria 13738
53 Ga0075431_100003685 3300006847 Bacteria 14885
54 Ga0075431_100004344 3300006847 Bacteria 13894
55 Ga0075433_10020868 3300006852 Bacteria 5484
56 Ga0075434_100000018 3300006871 Bacteria 73715
57 Ga0075434_100428423 3300006871 Bacteria 1344
58 Ga0075429_100000103 3300006880 Bacteria 47421
59 Ga0075429_100002847 3300006880 Bacteria 14631
60 Ga0075429_100015770 3300006880 Bacteria 6544
61 Ga0068865_100006240 3300006881 Bacteria 7258
62 Ga0075436_100036440 3300006914 Bacteria 3395
63 Ga0097620_100454288 3300006931 Bacteria 1377
64 Ga0075435_100105436 3300007076 Bacteria 2340
65 Ga0111539_10040756 3300009094 Bacteria 5588
66 Ga0111539_10042498 3300009094 Bacteria 5457
67 Ga0111539_10046642 3300009094 Bacteria 5182
68 Ga0111539_10095062 3300009094 Bacteria 3501
69 Ga0111539_10282944 3300009094 Bacteria 1930
70 Ga0114129_10001184 3300009147 Bacteria 34627
71 Ga0114129_10007267 3300009147 Bacteria 15761
72 Ga0114129_10025093 3300009147 Bacteria 8448
73 Ga0114129_10120689 3300009147 Bacteria 3609
74 Ga0105249_10004574 3300009553 Bacteria 11954
75 Ga0099796_10004321 3300010159 Bacteria 3422
76 Ga0099796_10013303 3300010159 Bacteria 2347
77 Ga0105239_10733651 3300010375 Bacteria 1130
78 Ga0105239_10758699 3300010375 Bacteria 1110
79 Ga0157378_10545795 3300013297 Bacteria 1164
80 Ga0163162_10076028 3300013306 Bacteria 3419
81 Ga0157380_10014049 3300014326 Bacteria 5850
82 Ga0157380_10265254 3300014326 Bacteria 1562
83 Ga0182008_10113140 3300014497 Bacteria 1345
84 Ga0213876_10162836 3300021384 Bacteria 1187
85 Ga0213875_10000544 3300021388 Bacteria 30876
86 Ga0213875_10000556 3300021388 Bacteria 30532
87 Ga0213875_10012978 3300021388 Bacteria 4101
88 Ga0207643_10034278 3300025908 Bacteria 2844
89 Ga0207705_10223554 3300025909 Bacteria 1430
90 Ga0207660_10198489 3300025917 Bacteria 1566
91 Ga0207646_10064904 3300025922 Bacteria 3259
92 Ga0207681_10002427 3300025923 Bacteria 11816
93 Ga0207700_10008151 3300025928 Bacteria 6470
94 Ga0207700_10073454 3300025928 Bacteria 2641
95 Ga0207664_10055642 3300025929 Bacteria 3140
96 Ga0207664_10059748 3300025929 Bacteria 3037
97 Ga0207664_10288391 3300025929 Bacteria 1442
98 Ga0207664_10449031 3300025929 Bacteria 1151
99 Ga0207644_10554898 3300025931 Bacteria 951
100 Ga0207706_10314255 3300025933 Bacteria 1364
101 Ga0207669_10053983 3300025937 Bacteria 2425
102 Ga0207704_10001267 3300025938 Bacteria 11301
103 Ga0207665_10001711 3300025939 Bacteria 14752
104 Ga0207665_10118227 3300025939 Bacteria 1870
105 Ga0207691_10059978 3300025940 Bacteria 3458
106 Ga0207689_10144514 3300025942 Bacteria 1960
107 Ga0207712_10006352 3300025961 Bacteria 7456
108 Ga0207703_10071140 3300026035 Bacteria 2873
109 Ga0207639_10195765 3300026041 Bacteria 1730
110 Ga0207708_10014298 3300026075 Bacteria 5937
111 Ga0207702_10015773 3300026078 Bacteria 6255
112 Ga0207648_10002758 3300026089 Bacteria 18666
113 Ga0207676_10179642 3300026095 Bacteria 1852
114 Ga0207675_100002436 3300026118 Bacteria 18434
115 Ga0207675_100212659 3300026118 Bacteria 1861
116 Ga0207428_10000265 3300027907 Bacteria 70984
117 Ga0207428_10008018 3300027907 Bacteria 9583
118 Ga0207428_10026296 3300027907 Bacteria 4858
119 Ga0207428_10040752 3300027907 Bacteria 3763
120 Ga0268265_10001812 3300028380 Bacteria 17085
121 Ga0268264_10369691 3300028381 Bacteria 1370
122 Ga0265325_10102385 3300031241 Bacteria 1400
123 Ga0265327_10117950 3300031251 Bacteria 1261
124 Ga0307408_100365385 3300031548 Bacteria 1229
125 Ga0373928_0006247 3300035084 Bacteria 2288
126 Ga0373929_0006633 3300035085 Bacteria 2095
127 Ga0373934_0000146 3300035086 Bacteria 25832
128 Ga0373940_0010705 3300035088 Bacteria 2164
129 Ga0373944_0003470 3300035089 Bacteria 4073
130 Ga0373951_0018545 3300035091 Bacteria 1581
131 Ga0373936_0049827 3300035113 Bacteria 1692
132 Ga0373939_0023657 3300035114 Bacteria 1704
133 Ga0373945_0000490 3300035116 Bacteria 11249
134 Ga0373954_0039392 3300035118 Bacteria 2199
135 Ga0373956_0000013 3300035119 Bacteria 54091
136 Ga0373957_0026929 3300035120 Bacteria 2084
137 Ga0373957_0035096 3300035120 Bacteria 1861
138 Ga0373960_0081348 3300035121 Bacteria 1020
139 Ga0373943_0022246 3300035170 Bacteria 2935
140 Ga0373955_0027600 3300035172 Bacteria 2936
141 Ga0373962_0003002 3300035242 Bacteria 4046
142 Ga0373933_0000294 3300035724 Bacteria 32230
143 Ga0373947_0026360 3300035725 Bacteria 3396
144 Ga0373947_0388670 3300035725 Bacteria 940
145 Ga0373937_0000517 3300036401 Bacteria 34778
146 Ga0373937_0097629 3300036401 Bacteria 2725
147 Ga0373925_0019590 3300037068 Bacteria 4923
148 Ga0436364_0124138 3300037853 Bacteria 39695
149 Ga0436364_0266112 3300037853 Bacteria 33925
150 Ga0436364_0508608 3300037853 Bacteria 35332
151 Ga0436365_0525125 3300039437 Bacteria 3199
152 Ga0436365_1611618 3300039437 Bacteria 1503
153 Ga0436360_1259897 3300039438 Bacteria 1899
154 Ga0439453_0011682 3300041408 Bacteria 1468
155 Ga0439435_0025928 3300042436 Bacteria 1557
156 Ga0439460_0018752 3300042461 Bacteria 1866
157 Ga0439440_0006738 3300042993 Bacteria 2320
158 Ga0451576_0006018 3300045051 Bacteria 14993
159 Ga0451576_0019126 3300045051 Bacteria 7482
160 Ga0451576_0022710 3300045051 Bacteria 6796
161 Ga0451576_0155088 3300045051 Bacteria 2389
162 Ga0495592_0031460 3300046454 Bacteria 4010
163 Ga0495592_0064656 3300046454 Bacteria 2680
164 Ga0495603_0003474 3300046455 Bacteria 9373
165 Ga0495651_0001246 3300046462 Bacteria 19713
166 Ga0495580_0003325 3300046472 Bacteria 13747
167 Ga0495582_0067044 3300046473 Bacteria 1983
168 Ga0495662_0038383 3300046476 Bacteria 2315
169 Ga0495594_0072822 3300046499 Bacteria 1912
170 Ga0495608_0006145 3300046511 Bacteria 8524
171 Ga0495628_0006196 3300046516 Bacteria 10462
172 Ga0495628_0066193 3300046516 Bacteria 2824
173 Ga0495630_0253661 3300046517 Bacteria 1344
174 Ga0495666_0026179 3300046526 Bacteria 2878
175 Ga0495666_0067354 3300046526 Bacteria 1706
176 Ga0495652_0028740 3300046529 Bacteria 4889
177 Ga0495665_0065227 3300046531 Bacteria 1922
178 Ga0495640_0012982 3300046533 Bacteria 6347
179 Ga0495586_0003781 3300046535 Bacteria 8111
180 Ga0495645_0000166 3300046543 Bacteria 45739
181 Ga0495667_0010769 3300046559 Bacteria 6183
182 Ga0495634_0004412 3300046642 Bacteria 11057
183 Ga0495635_0052749 3300046663 Bacteria 2801
184 Ga0495588_0035553 3300046674 Bacteria 2525
185 Ga0495599_0054908 3300046678 Bacteria 2495
186 Ga0495647_0001106 3300046681 Bacteria 8240
187 Ga0495658_0002559 3300046683 Bacteria 9145
188 Ga0495658_0020305 3300046683 Bacteria 3484
189 Ga0495613_0068817 3300046689 Bacteria 2581
190 Ga0495600_0019409 3300046809 Bacteria 4341
191 Ga0495600_0020559 3300046809 Bacteria 4220
192 Ga0495581_0092471 3300047315 Bacteria 1756
193 Ga0495604_0019340 3300047317 Bacteria 5452
194 Ga0495674_0006376 3300047319 Bacteria 11310
195 Ga0495676_0056302 3300047321 Bacteria 3110
196 Ga0495680_0001925 3300047322 Bacteria 21809
197 Ga0495680_0031719 3300047322 Bacteria 4297
198 Ga0496104_0003342 3300048907 Bacteria 13848
199 Ga0496105_0033802 3300048908 Bacteria 4202
200 Ga0496112_0033872 3300048915 Bacteria 4968
201 Ga0496112_0280355 3300048915 Bacteria 1614
202 Ga0496113_0046606 3300048916 Bacteria 3218
203 Ga0496115_0049349 3300048918 Bacteria 3369
204 Ga0496115_0437960 3300048918 Bacteria 1057
205 Ga0501041_0293089 3300049577 Bacteria 1025
206 Ga0501070_0087672 3300049586 Bacteria 2576
207 Ga0501083_0122937 3300049744 Bacteria 1702
208 Ga0501035_0150931 3300049822 Bacteria 2017
209 Ga0501044_0495105 3300049823 Bacteria 1124
210 nmdc:mga03683_14658_c1 3300050489 Bacteria 2905
211 nmdc:mga03n38_165129_c1 3300050490 Bacteria 1124
212 nmdc:mga0k408_43851_c1 3300050493 Bacteria 2579
213 nmdc:mga04h51_99046_c1 3300050495 Bacteria 1060
214 nmdc:mga05p37_249857_c1 3300050507 Bacteria 2128
215 nmdc:mga05p37_2836_c1 3300050507 Bacteria 20144
216 nmdc:mga05p37_33521_c1 3300050507 Bacteria 6290
217 nmdc:mga09592_11092_c1 3300050508 Bacteria 7332
218 nmdc:mga09592_20202_c1 3300050508 Bacteria 5473
219 nmdc:mga09592_20267_c1 3300050508 Bacteria 5466
220 nmdc:mga09592_63549_c1 3300050508 Bacteria 3125
221 nmdc:mga0qj67_55464_c1 3300050509 Bacteria 3140
222 nmdc:mga06r32_8849_c1 3300050510 Bacteria 9073
223 nmdc:mga08y16_33974_c1 3300050511 Bacteria 5357
224 nmdc:mga08y16_645_c1 3300050511 Bacteria 32765
225 nmdc:mga08y16_75219_c1 3300050511 Bacteria 3521
226 nmdc:mga0n895_44924_c1 3300050512 Bacteria 4309
227 nmdc:mga0n895_699797_c1 3300050512 Bacteria 1009
228 nmdc:mga0rr50_154_c1 3300050513 Bacteria 37500
229 nmdc:mga0rr50_259703_c1 3300050513 Unclassified 1445
230 nmdc:mga08x19_2283_c1 3300050514 Bacteria 11642
231 nmdc:mga0a205_242_c1 3300050515 Bacteria 22520
232 Ga0495601_0100164 3300053077 Bacteria 1871
233 Ga0495601_0301941 3300053077 Bacteria 1043
234 Ga0500586_003074 3300053145 Bacteria 3887
235 Ga0500637_0061300 3300053178 Bacteria 2155
236 Ga0590077_010577 3300059426 Bacteria 1898
237 Ga0501082_0000172 3300060353 Bacteria 55980
238 2857546016 2857542790 Bacteria 5326616
239 2881930012 2881927736 Bacteria 3993927
240 8055226233 8055225921 Bacteria 3341787
241 Ga0436360_0303249
242 Ga0070687_100169030
243 Ga0070692_10132963
244 Ga0070669_100008399
245 Ga0070669_100035344
246 Ga0070674_100039670
247 Ga0070659_100281218
248 Ga0070703_10016529
249 Ga0070714_100028256
250 Ga0070714_100061225
251 Ga0070714_100520621
252 Ga0070713_100103106
253 Ga0070713_100202759
254 Ga0070700_100004515
255 Ga0070694_100042550
256 Ga0070694_100085124
257 Ga0070694_100178606
258 Ga0070681_10106363
259 Ga0068867_100000933
260 Ga0068867_100125620
261 Ga0070707_100294203
262 Ga0070698_100148431
263 Ga0070699_100484523
264 Ga0070697_100308052
265 Ga0070697_100312381
266 Ga0070697_100327687
267 Ga0070672_100308869
268 Ga0070686_100431614
269 Ga0070695_100102409
270 Ga0070695_100198987
271 Ga0070696_100089545
272 Ga0070704_100063323
273 Ga0070664_100364812
274 Ga0068856_100083974
275 Ga0070702_100056210
276 Ga0068859_100454316
277 Ga0068864_100065664
278 Ga0068861_100010443
279 Ga0068858_100077059
280 Ga0068862_100011831
281 Ga0075363_100016008
282 Ga0075363_100239228
283 Ga0070716_100001211
284 Ga0075362_10016065
285 Ga0075369_10073952
286 Ga0075366_10019518
287 Ga0097621_100249051
288 Ga0068871_100385419
289 Ga0075428_100005195
290 Ga0075428_100005553
291 Ga0075428_100045262
292 Ga0075430_100003193
293 Ga0075431_100003685
294 Ga0075431_100004344
295 Ga0075433_10020868
296 Ga0075434_100000018
297 Ga0075434_100428423
298 Ga0075429_100000103
299 Ga0075429_100002847
300 Ga0075429_100015770
301 Ga0068865_100006240
302 Ga0075436_100036440
303 Ga0097620_100454288
304 Ga0075435_100105436
305 Ga0111539_10040756
306 Ga0111539_10042498
307 Ga0111539_10046642
308 Ga0111539_10095062
309 Ga0111539_10282944
310 Ga0114129_10001184
311 Ga0114129_10007267
312 Ga0114129_10025093
313 Ga0114129_10120689
314 Ga0105249_10004574
315 Ga0099796_10004321
316 Ga0099796_10013303
317 Ga0105239_10733651
318 Ga0105239_10758699
319 Ga0157378_10545795
320 Ga0163162_10076028
321 Ga0157380_10014049
322 Ga0157380_10265254
323 Ga0182008_10113140
324 Ga0213876_10162836
325 Ga0213875_10000544
326 Ga0213875_10000556
327 Ga0213875_10012978
328 Ga0207643_10034278
329 Ga0207705_10223554
330 Ga0207660_10198489
331 Ga0207646_10064904
332 Ga0207681_10002427
333 Ga0207700_10008151
334 Ga0207700_10073454
335 Ga0207664_10055642
336 Ga0207664_10059748
337 Ga0207664_10288391
338 Ga0207664_10449031
339 Ga0207644_10554898
340 Ga0207706_10314255
341 Ga0207669_10053983
342 Ga0207704_10001267
343 Ga0207665_10001711
344 Ga0207665_10118227
345 Ga0207691_10059978
346 Ga0207689_10144514
347 Ga0207712_10006352
348 Ga0207703_10071140
349 Ga0207639_10195765
350 Ga0207708_10014298
351 Ga0207702_10015773
352 Ga0207648_10002758
353 Ga0207676_10179642
354 Ga0207675_100002436
355 Ga0207675_100212659
356 Ga0207428_10000265
357 Ga0207428_10008018
358 Ga0207428_10026296
359 Ga0207428_10040752
360 Ga0268265_10001812
361 Ga0268264_10369691
362 Ga0265325_10102385
363 Ga0265327_10117950
364 Ga0307408_100365385
365 Ga0373928_0006247
366 Ga0373929_0006633
367 Ga0373934_0000146
368 Ga0373940_0010705
369 Ga0373944_0003470
370 Ga0373951_0018545
371 Ga0373936_0049827
372 Ga0373939_0023657
373 Ga0373945_0000490
374 Ga0373954_0039392
375 Ga0373956_0000013
376 Ga0373957_0026929
377 Ga0373957_0035096
378 Ga0373960_0081348
379 Ga0373943_0022246
380 Ga0373955_0027600
381 Ga0373962_0003002
382 Ga0373933_0000294
383 Ga0373947_0026360
384 Ga0373947_0388670
385 Ga0373937_0000517
386 Ga0373937_0097629
387 Ga0373925_0019590
388 Ga0436364_0124138
389 Ga0436364_0266112
390 Ga0436364_0508608
391 Ga0436365_0525125
392 Ga0436365_1611618
393 Ga0436360_1259897
394 Ga0439453_0011682
395 Ga0439435_0025928
396 Ga0439460_0018752
397 Ga0439440_0006738
398 Ga0451576_0006018
399 Ga0451576_0019126
400 Ga0451576_0022710
401 Ga0451576_0155088
402 Ga0495592_0031460
403 Ga0495592_0064656
404 Ga0495603_0003474
405 Ga0495651_0001246
406 Ga0495580_0003325
407 Ga0495582_0067044
408 Ga0495662_0038383
409 Ga0495594_0072822
410 Ga0495608_0006145
411 Ga0495628_0006196
412 Ga0495628_0066193
413 Ga0495630_0253661
414 Ga0495666_0026179
415 Ga0495666_0067354
416 Ga0495652_0028740
417 Ga0495665_0065227
418 Ga0495640_0012982
419 Ga0495586_0003781
420 Ga0495645_0000166
421 Ga0495667_0010769
422 Ga0495634_0004412
423 Ga0495635_0052749
424 Ga0495588_0035553
425 Ga0495599_0054908
426 Ga0495647_0001106
427 Ga0495658_0002559
428 Ga0495658_0020305
429 Ga0495613_0068817
430 Ga0495600_0019409
431 Ga0495600_0020559
432 Ga0495581_0092471
433 Ga0495604_0019340
434 Ga0495674_0006376
435 Ga0495676_0056302
436 Ga0495680_0001925
437 Ga0495680_0031719
438 Ga0496104_0003342
439 Ga0496105_0033802
440 Ga0496112_0033872
441 Ga0496112_0280355
442 Ga0496113_0046606
443 Ga0496115_0049349
444 Ga0496115_0437960
445 Ga0501041_0293089
446 Ga0501070_0087672
447 Ga0501083_0122937
448 Ga0501035_0150931
449 Ga0501044_0495105
450 nmdc:mga03683_14658_c1
451 nmdc:mga03n38_165129_c1
452 nmdc:mga0k408_43851_c1
453 nmdc:mga04h51_99046_c1
454 nmdc:mga05p37_249857_c1
455 nmdc:mga05p37_2836_c1
456 nmdc:mga05p37_33521_c1
457 nmdc:mga09592_11092_c1
458 nmdc:mga09592_20202_c1
459 nmdc:mga09592_20267_c1
460 nmdc:mga09592_63549_c1
461 nmdc:mga0qj67_55464_c1
462 nmdc:mga06r32_8849_c1
463 nmdc:mga08y16_33974_c1
464 nmdc:mga08y16_645_c1
465 nmdc:mga08y16_75219_c1
466 nmdc:mga0n895_44924_c1
467 nmdc:mga0n895_699797_c1
468 nmdc:mga0rr50_154_c1
469 nmdc:mga0rr50_259703_c1
470 nmdc:mga08x19_2283_c1
471 nmdc:mga0a205_242_c1
472 Ga0495601_0100164
473 Ga0495601_0301941
474 Ga0500586_003074
475 Ga0500637_0061300
476 Ga0590077_010577
477 Ga0501082_0000172
478 2857546016
479 2881930012
480 8055226233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

3

273

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d3j-assembly1.cif.gz_A ft_t dioxygenase holoenzyme 0.9386 2 283
4ffa-assembly1.cif.gz_C sulfatase from mycobacterium tuberculosis 0.9277 2 283
1oij-assembly4.cif.gz_D crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9276 1 283
1oik-assembly1.cif.gz_A-2 crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with fe, alphaketoglutarate and 2-ethyl-1-hexanesulfuric acid 0.9248 3 283
1oij-assembly2.cif.gz_B crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9243 1 283
ID Description Score Start End Superfamily
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9126 3 283 3.60.130.10
1gqwB00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9083 2 283 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9075 2 283 3.60.130.10
5j92B00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8999 3 286 3.60.130.10
6d0oA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8834 2 283 3.60.130.10
ID Description Score Start End GO Terms
AF-D3JH11-F1-model_v4 TfdA-like protein 0.9853 135 258 GO:0000908
GO:0005737
GO:0006790
AF-A0A7C2M650-F1-model_v4 TauD/TfdA family dioxygenase 0.9843 1 287 GO:0000908
GO:0005737
GO:0006790
AF-A0A7C2M650-F1-model_v4 TauD/TfdA family dioxygenase 0.9708 1 287 GO:0000908
GO:0005737
GO:0006790
AF-A0A176FS79-F1-model_v4 Taurine dioxygenase 0.9702 53 287 GO:0000908
GO:0005737
GO:0006790
AF-A0A7X1P8K9-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9694 131 270 GO:0000908
GO:0005737
GO:0006790

Map