F353074

General Info

Members Datasets Scaffolds Average Seq Length
240 170 480 409

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1196706|Ga0436361_1196706_16207_17652
Length 481
Sequence MVAVAKAIESHSILLFMGVPLVPENGLQAGIDIAASNSFPAKALRRLPSIIAETSSTICLMTLPNSSDASSSVPAKKPMLSAPQALAFLLEAATPLDGIETVPTLEANGRILAGRQVSQLNVPPMDNTQMDGYAVRAADCAGGAAVLPVSQRIPAGHVGQPLQPGTAARIFTGAMMPAGADAVVMQEQCEAAADGKSVTIKHAPQAGEWVRRTGEDIRSGAEILPAGVRLRAQELGLAASVGLASLPVRRKLHVAVFFTGDELAMPGEALKPGAIYNSNRYTLRGLLENLGCTVSDFGIVPDSLAATRETLRRAAAGHDLIVTSGGVSVGDEDHVKPAVEAEGRLSMWQIAIKPGKPLAFGEVNRGEGKAYFIGLPGNPVSSLVTFLLFVRPFILRLQGAAHTAPRAYAMRADFAWSKADKRNEFLRARINREGGLDLFANQGSAVLTSCVWGDGLIDNPPGQTIAPGDLVRFLPFDALLS

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
131 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
132 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
133 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
138 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
147 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
148 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
149 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
150 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
151 2643221570 Acidovorax sp. Root568 Isolate Unclassified
152 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
153 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
154 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
155 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
156 2842711865 Duganella sp. R-73148 Isolate Unclassified
157 2842747753 Variovorax sp. R-72060 Isolate Unclassified
158 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
159 2857564685 Duganella sp. R-74599 Isolate Unclassified
160 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
161 2885266251 Ralstonia sp. SET104 Isolate Nodule
162 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
163 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
164 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
165 2919476304 Duganella sp. 3397 Isolate Unclassified
166 2928058823 Ralstonia sp. 1138 Isolate Unclassified
167 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
168 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
169 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
170 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.33
Metatranscriptomes 1.25
Isolates 10.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.33
Nodule 2.5
Rhizoplane 1.67
Rhizosphere 47.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1196706 3300039447 Bacteria 36697
2 JGI24740J21852_10007091 3300001979 Bacteria 4591
3 JGI25156J39149_1005043 3300002705 Bacteria 3897
4 JGI25156J39149_1005507 3300002705 Bacteria 3631
5 JGI25154J39366_1000220 3300002738 Bacteria 39001
6 JGI25151J46595_10001700 3300003187 Bacteria 14371
7 JGI25151J46595_10010882 3300003187 Bacteria 4208
8 JGI25151J46595_10017515 3300003187 Bacteria 3102
9 JGI25151J46595_10048024 3300003187 Bacteria 1479
10 rootL2_10020495 3300003322 Bacteria 6745
11 rootL2_10043938 3300003322 Bacteria 2211
12 Ga0055539_1000123 3300003752 Bacteria 83036
13 Ga0055533_1002174 3300003756 Bacteria 4672
14 Ga0055533_1002613 3300003756 Bacteria 4010
15 Ga0055533_1003314 3300003756 Bacteria 3277
16 Ga0055532_1000002 3300003758 Bacteria 576000
17 Ga0055532_1000029 3300003758 Bacteria 232900
18 Ga0055525_1000345 3300003759 Bacteria 33665
19 Ga0055542_1001189 3300003762 Bacteria 14846
20 Ga0055529_1000060 3300003763 Bacteria 191230
21 Ga0055529_1000062 3300003763 Bacteria 183782
22 Ga0055526_1000023 3300003771 Bacteria 163444
23 Ga0055526_1000069 3300003771 Bacteria 97733
24 Ga0055526_1005560 3300003771 Bacteria 7198
25 Ga0055526_1005691 3300003771 Bacteria 7068
26 Ga0055526_1010941 3300003771 Bacteria 4151
27 Ga0055524_1001214 3300003775 Bacteria 15250
28 Ga0055524_1015426 3300003775 Bacteria 2785
29 Ga0055536_1000083 3300003781 Bacteria 81693
30 Ga0055534_1000855 3300003784 Bacteria 13979
31 Ga0055534_1001006 3300003784 Bacteria 12403
32 Ga0055541_1000208 3300003841 Bacteria 24817
33 Ga0055541_1001170 3300003841 Bacteria 5863
34 Ga0055541_1008337 3300003841 Bacteria 1654
35 Ga0070661_100001595 3300005344 Bacteria 15734
36 Ga0070659_100010290 3300005366 Bacteria 6878
37 Ga0070667_100040522 3300005367 Bacteria 3906
38 Ga0070663_100000011 3300005455 Bacteria 146097
39 Ga0070664_100000008 3300005564 Bacteria 173734
40 Ga0068857_100002038 3300005577 Bacteria 16379
41 Ga0068854_100000052 3300005578 Bacteria 85499
42 Ga0068856_100000009 3300005614 Bacteria 181448
43 Ga0068856_100136505 3300005614 Bacteria 2458
44 Ga0075368_10066345 3300006042 Bacteria 1451
45 Ga0075366_10009889 3300006195 Bacteria 5336
46 Ga0079104_1003442 3300006946 Bacteria 7365
47 Ga0105244_10036419 3300009036 Bacteria 2578
48 Ga0105240_10010244 3300009093 Bacteria 13194
49 Ga0157373_10010823 3300013100 Bacteria 6714
50 Ga0157371_10000068 3300013102 Bacteria 168110
51 Ga0157371_10000386 3300013102 Bacteria 55559
52 Ga0157370_10010316 3300013104 Bacteria 9854
53 Ga0157369_10008205 3300013105 Bacteria 11978
54 Ga0157372_10000271 3300013307 Bacteria 57411
55 Ga0182008_10000928 3300014497 Bacteria 20408
56 Ga0182008_10002648 3300014497 Bacteria 11114
57 Ga0182008_10016426 3300014497 Bacteria 3845
58 Ga0182008_10033675 3300014497 Bacteria 2570
59 Ga0182006_1000006 3300015261 Bacteria 555811
60 Ga0182006_1000008 3300015261 Bacteria 449652
61 Ga0182006_1012267 3300015261 Bacteria 3749
62 Ga0182006_1014161 3300015261 Bacteria 3442
63 Ga0182007_10000013 3300015262 Bacteria 231000
64 Ga0182007_10012083 3300015262 Bacteria 3333
65 Ga0182005_1000001 3300015265 Bacteria 1014869
66 Ga0182005_1000008 3300015265 Bacteria 471394
67 Ga0163161_10029371 3300017792 Bacteria 3909
68 Ga0206351_10253009 3300020077 Bacteria 7729
69 Ga0154015_1103548 3300020610 Bacteria 9590
70 Ga0213872_10000290 3300021361 Bacteria 42933
71 Ga0213872_10001477 3300021361 Bacteria 15244
72 Ga0213872_10006750 3300021361 Bacteria 5715
73 Ga0209784_100003 3300025224 Bacteria 1379451
74 Ga0209784_100482 3300025224 Bacteria 16070
75 Ga0209784_101670 3300025224 Bacteria 2704
76 Ga0209566_100002 3300025225 Bacteria 2614868
77 Ga0209566_100970 3300025225 Bacteria 12691
78 Ga0209566_103475 3300025225 Bacteria 2409
79 Ga0209674_100008 3300025226 Bacteria 1076909
80 Ga0209674_100229 3300025226 Bacteria 50211
81 Ga0209674_101558 3300025226 Bacteria 5833
82 Ga0209672_100052 3300025228 Bacteria 231179
83 Ga0209147_100002 3300025229 Bacteria 2158988
84 Ga0209563_100004 3300025230 Bacteria 1814108
85 Ga0209258_100002 3300025242 Bacteria 2158988
86 Ga0209646_1000049 3300025246 Bacteria 301924
87 Ga0209646_1000059 3300025246 Bacteria 256909
88 Ga0209677_100009 3300025253 Bacteria 749530
89 Ga0209677_102838 3300025253 Bacteria 6123
90 Ga0209148_1000021 3300025254 Bacteria 714645
91 Ga0209148_1001390 3300025254 Bacteria 12483
92 Ga0209148_1002516 3300025254 Bacteria 6157
93 Ga0209759_1002389 3300025256 Bacteria 8282
94 Ga0209759_1003853 3300025256 Bacteria 5811
95 Ga0209565_1000021 3300025263 Bacteria 406281
96 Ga0209455_1000021 3300025272 Bacteria 699993
97 Ga0209455_1000026 3300025272 Bacteria 653778
98 Ga0209673_1013162 3300025273 Bacteria 3284
99 Ga0209675_1000305 3300025291 Bacteria 44331
100 Ga0209675_1002471 3300025291 Bacteria 9483
101 Ga0209675_1002728 3300025291 Bacteria 8842
102 Ga0209676_1000380 3300025292 Bacteria 81727
103 Ga0209025_1000796 3300025294 Bacteria 51224
104 Ga0209025_1001065 3300025294 Bacteria 39873
105 Ga0209025_1004323 3300025294 Bacteria 12419
106 Ga0209025_1004347 3300025294 Bacteria 12371
107 Ga0209564_1000002 3300025295 Bacteria 1636803
108 Ga0209564_1000096 3300025295 Bacteria 232165
109 Ga0209564_1001230 3300025295 Bacteria 28913
110 Ga0209564_1001850 3300025295 Bacteria 19221
111 Ga0209564_1002876 3300025295 Bacteria 12621
112 Ga0209256_1000280 3300025299 Bacteria 89706
113 Ga0209256_1000653 3300025299 Bacteria 47237
114 Ga0209051_1029950 3300025303 Bacteria 2122
115 Ga0207655_1023979 3300025728 Bacteria 3006
116 Ga0207695_10001909 3300025913 Bacteria 32457
117 Ga0207649_10001269 3300025920 Bacteria 15079
118 Ga0207681_10038168 3300025923 Bacteria 3180
119 Ga0207690_10001324 3300025932 Bacteria 15570
120 Ga0207679_10000001 3300025945 Bacteria 777444
121 Ga0207640_10000035 3300025981 Bacteria 111369
122 Ga0207678_10000001 3300026067 Bacteria 433184
123 Ga0207702_10008078 3300026078 Bacteria 8901
124 Ga0207674_10012396 3300026116 Bacteria 9531
125 Ga0307515_10000022 3300028794 Bacteria 404064
126 Ga0307515_10000417 3300028794 Bacteria 102343
127 Ga0307515_10044681 3300028794 Bacteria 6835
128 Ga0316181_1154236 3300030744 Bacteria 4381
129 Ga0265327_10003564 3300031251 Bacteria 14736
130 Ga0395899_0000473 3300037312 Bacteria 45449
131 Ga0395900_0239834 3300037418 Bacteria 1819
132 Ga0395901_0250483 3300038443 Bacteria 1845
133 Ga0436361_0600215 3300039447 Bacteria 7031
134 Ga0451577_0040292 3300042876 Bacteria 4194
135 Ga0466972_0000005 3300044658 Bacteria 289640
136 Ga0466965_0006416 3300044683 Bacteria 5340
137 Ga0466961_0004849 3300044693 Bacteria 8463
138 Ga0466968_0005280 3300044735 Bacteria 4838
139 Ga0466970_0006124 3300044765 Bacteria 5991
140 Ga0466959_0008819 3300045049 Bacteria 7145
141 Ga0466967_0009266 3300045976 Bacteria 7293
142 Ga0495617_000937 3300046452 Bacteria 13548
143 Ga0495627_000001 3300046453 Bacteria 1104709
144 Ga0495638_0074776 3300046460 Bacteria 2066
145 Ga0495638_0080947 3300046460 Bacteria 1972
146 Ga0495650_0000246 3300046471 Bacteria 107109
147 Ga0495650_0010912 3300046471 Bacteria 5028
148 Ga0495580_0054723 3300046472 Bacteria 2813
149 Ga0495605_0000290 3300046474 Bacteria 55491
150 Ga0495605_0005335 3300046474 Bacteria 7492
151 Ga0495596_0002834 3300046500 Bacteria 9060
152 Ga0495606_0000070 3300046507 Bacteria 177343
153 Ga0495606_0000197 3300046507 Bacteria 105038
154 Ga0495606_0004298 3300046507 Bacteria 14339
155 Ga0495610_0001659 3300046512 Bacteria 19560
156 Ga0495610_0082036 3300046512 Bacteria 1478
157 Ga0495632_0010224 3300046519 Bacteria 5576
158 Ga0495637_0017966 3300046520 Bacteria 3286
159 Ga0495643_0000194 3300046522 Bacteria 96362
160 Ga0495648_0000739 3300046524 Bacteria 34836
161 Ga0495666_0009518 3300046526 Bacteria 4854
162 Ga0495586_0029996 3300046535 Bacteria 2911
163 Ga0495587_0039023 3300046536 Bacteria 2845
164 Ga0495609_0000603 3300046538 Bacteria 28203
165 Ga0495609_0008380 3300046538 Bacteria 5064
166 Ga0495622_0006292 3300046557 Bacteria 5514
167 Ga0495633_0000396 3300046558 Bacteria 45726
168 Ga0495633_0004609 3300046558 Bacteria 8687
169 Ga0495633_0026540 3300046558 Bacteria 2841
170 Ga0495668_0000083 3300046616 Bacteria 153471
171 Ga0495625_0003966 3300046660 Bacteria 14208
172 Ga0495623_0061097 3300046679 Bacteria 2363
173 Ga0495671_0047965 3300046692 Bacteria 2132
174 Ga0495649_0115395 3300046694 Bacteria 1422
175 Ga0495589_0029905 3300046794 Bacteria 2745
176 Ga0495660_0001596 3300046810 Bacteria 15214
177 Ga0495604_0037607 3300047317 Bacteria 3810
178 Ga0495672_0006014 3300047320 Bacteria 9497
179 Ga0495687_025280 3300047443 Bacteria 2810
180 Ga0495686_0002009 3300047472 Bacteria 20129
181 Ga0495686_0002773 3300047472 Bacteria 15988
182 Ga0495686_0087278 3300047472 Bacteria 1897
183 Ga0495626_0000512 3300048091 Bacteria 38832
184 Ga0496102_0027035 3300048905 Bacteria 5123
185 Ga0496115_0125873 3300048918 Bacteria 2111
186 Ga0496116_0027672 3300048919 Bacteria 4122
187 Ga0496117_0000001 3300048920 Bacteria 2526244
188 Ga0496118_0000002 3300048921 Bacteria 1690764
189 Ga0496121_0000709 3300048924 Bacteria 61789
190 Ga0496121_0053734 3300048924 Bacteria 3372
191 Ga0496122_0000660 3300048925 Bacteria 69382
192 Ga0496123_0002832 3300048926 Bacteria 20510
193 Ga0496124_0027398 3300048927 Bacteria 5115
194 Ga0496124_0066858 3300048927 Bacteria 2992
195 Ga0496124_0159316 3300048927 Bacteria 1761
196 Ga0496125_0026915 3300048928 Bacteria 5223
197 Ga0501308_000396 3300049128 Bacteria 2777
198 Ga0495678_000009 3300049459 Bacteria 373806
199 Ga0495678_000396 3300049459 Bacteria 43995
200 Ga0495682_0003426 3300049460 Bacteria 7050
201 Ga0501249_000688 3300049679 Bacteria 7689
202 Ga0501269_000476 3300049766 Bacteria 8546
203 nmdc:mga0k408_54792_c1 3300050493 Bacteria 2311
204 nmdc:mga04h51_36942_c1 3300050495 Bacteria 1574
205 nmdc:mga07m45_49399_c1 3300050496 Bacteria 1878
206 Ga0500644_0007541 3300053088 Bacteria 2836
207 Ga0500646_0013280 3300053090 Bacteria 2131
208 Ga0500651_0061076 3300053093 Bacteria 2354
209 Ga0500569_005170 3300053109 Bacteria 2792
210 Ga0500618_000596 3300053125 Bacteria 22299
211 Ga0500618_016865 3300053125 Bacteria 1822
212 Ga0500652_000358 3300053131 Bacteria 16363
213 Ga0500568_0009239 3300053139 Bacteria 4698
214 Ga0500586_000305 3300053145 Bacteria 9781
215 Ga0500622_0000106 3300053156 Bacteria 85750
216 2511384472 2511231026 Bacteria 5225445
217 2513955086 2513237150 Bacteria 6553639
218 2597028590 2596583598 Bacteria 5251611
219 2599445276 2599185178 Bacteria 5365746
220 2601668745 2600255292 Bacteria 6300551
221 2643868239 2643221570 Bacteria 5103772
222 2644028235 2643221603 Bacteria 6147767
223 2644162622 2643221628 Bacteria 5745828
224 2841912730 2841911363 Bacteria 6173697
225 2841923033 2841917233 Bacteria 6173500
226 2842713598 2842711865 Bacteria 7155354
227 2842748538 2842747753 Bacteria 5578255
228 2857551442 2857547612 Bacteria 6179999
229 2857566570 2857564685 Bacteria 6290584
230 2885082733 2885080285 Bacteria 6355622
231 2885267068 2885266251 Bacteria 4796748
232 2900580228 2900577576 Bacteria 5438534
233 2904543937 2904541872 Bacteria 8915136
234 2919046517 2919046199 Bacteria 5567169
235 2919477792 2919476304 Bacteria 5888696
236 2928062606 2928058823 Bacteria 5520022
237 2929162504 2929160207 Bacteria 9075316
238 2932414296 2932410948 Bacteria 6312192
239 2932416905 2932416698 Bacteria 6315112
240 644748115 644736347 Bacteria 6476522
241 Ga0436361_1196706
242 JGI24740J21852_10007091
243 JGI25156J39149_1005043
244 JGI25156J39149_1005507
245 JGI25154J39366_1000220
246 JGI25151J46595_10001700
247 JGI25151J46595_10010882
248 JGI25151J46595_10017515
249 JGI25151J46595_10048024
250 rootL2_10020495
251 rootL2_10043938
252 Ga0055539_1000123
253 Ga0055533_1002174
254 Ga0055533_1002613
255 Ga0055533_1003314
256 Ga0055532_1000002
257 Ga0055532_1000029
258 Ga0055525_1000345
259 Ga0055542_1001189
260 Ga0055529_1000060
261 Ga0055529_1000062
262 Ga0055526_1000023
263 Ga0055526_1000069
264 Ga0055526_1005560
265 Ga0055526_1005691
266 Ga0055526_1010941
267 Ga0055524_1001214
268 Ga0055524_1015426
269 Ga0055536_1000083
270 Ga0055534_1000855
271 Ga0055534_1001006
272 Ga0055541_1000208
273 Ga0055541_1001170
274 Ga0055541_1008337
275 Ga0070661_100001595
276 Ga0070659_100010290
277 Ga0070667_100040522
278 Ga0070663_100000011
279 Ga0070664_100000008
280 Ga0068857_100002038
281 Ga0068854_100000052
282 Ga0068856_100000009
283 Ga0068856_100136505
284 Ga0075368_10066345
285 Ga0075366_10009889
286 Ga0079104_1003442
287 Ga0105244_10036419
288 Ga0105240_10010244
289 Ga0157373_10010823
290 Ga0157371_10000068
291 Ga0157371_10000386
292 Ga0157370_10010316
293 Ga0157369_10008205
294 Ga0157372_10000271
295 Ga0182008_10000928
296 Ga0182008_10002648
297 Ga0182008_10016426
298 Ga0182008_10033675
299 Ga0182006_1000006
300 Ga0182006_1000008
301 Ga0182006_1012267
302 Ga0182006_1014161
303 Ga0182007_10000013
304 Ga0182007_10012083
305 Ga0182005_1000001
306 Ga0182005_1000008
307 Ga0163161_10029371
308 Ga0206351_10253009
309 Ga0154015_1103548
310 Ga0213872_10000290
311 Ga0213872_10001477
312 Ga0213872_10006750
313 Ga0209784_100003
314 Ga0209784_100482
315 Ga0209784_101670
316 Ga0209566_100002
317 Ga0209566_100970
318 Ga0209566_103475
319 Ga0209674_100008
320 Ga0209674_100229
321 Ga0209674_101558
322 Ga0209672_100052
323 Ga0209147_100002
324 Ga0209563_100004
325 Ga0209258_100002
326 Ga0209646_1000049
327 Ga0209646_1000059
328 Ga0209677_100009
329 Ga0209677_102838
330 Ga0209148_1000021
331 Ga0209148_1001390
332 Ga0209148_1002516
333 Ga0209759_1002389
334 Ga0209759_1003853
335 Ga0209565_1000021
336 Ga0209455_1000021
337 Ga0209455_1000026
338 Ga0209673_1013162
339 Ga0209675_1000305
340 Ga0209675_1002471
341 Ga0209675_1002728
342 Ga0209676_1000380
343 Ga0209025_1000796
344 Ga0209025_1001065
345 Ga0209025_1004323
346 Ga0209025_1004347
347 Ga0209564_1000002
348 Ga0209564_1000096
349 Ga0209564_1001230
350 Ga0209564_1001850
351 Ga0209564_1002876
352 Ga0209256_1000280
353 Ga0209256_1000653
354 Ga0209051_1029950
355 Ga0207655_1023979
356 Ga0207695_10001909
357 Ga0207649_10001269
358 Ga0207681_10038168
359 Ga0207690_10001324
360 Ga0207679_10000001
361 Ga0207640_10000035
362 Ga0207678_10000001
363 Ga0207702_10008078
364 Ga0207674_10012396
365 Ga0307515_10000022
366 Ga0307515_10000417
367 Ga0307515_10044681
368 Ga0316181_1154236
369 Ga0265327_10003564
370 Ga0395899_0000473
371 Ga0395900_0239834
372 Ga0395901_0250483
373 Ga0436361_0600215
374 Ga0451577_0040292
375 Ga0466972_0000005
376 Ga0466965_0006416
377 Ga0466961_0004849
378 Ga0466968_0005280
379 Ga0466970_0006124
380 Ga0466959_0008819
381 Ga0466967_0009266
382 Ga0495617_000937
383 Ga0495627_000001
384 Ga0495638_0074776
385 Ga0495638_0080947
386 Ga0495650_0000246
387 Ga0495650_0010912
388 Ga0495580_0054723
389 Ga0495605_0000290
390 Ga0495605_0005335
391 Ga0495596_0002834
392 Ga0495606_0000070
393 Ga0495606_0000197
394 Ga0495606_0004298
395 Ga0495610_0001659
396 Ga0495610_0082036
397 Ga0495632_0010224
398 Ga0495637_0017966
399 Ga0495643_0000194
400 Ga0495648_0000739
401 Ga0495666_0009518
402 Ga0495586_0029996
403 Ga0495587_0039023
404 Ga0495609_0000603
405 Ga0495609_0008380
406 Ga0495622_0006292
407 Ga0495633_0000396
408 Ga0495633_0004609
409 Ga0495633_0026540
410 Ga0495668_0000083
411 Ga0495625_0003966
412 Ga0495623_0061097
413 Ga0495671_0047965
414 Ga0495649_0115395
415 Ga0495589_0029905
416 Ga0495660_0001596
417 Ga0495604_0037607
418 Ga0495672_0006014
419 Ga0495687_025280
420 Ga0495686_0002009
421 Ga0495686_0002773
422 Ga0495686_0087278
423 Ga0495626_0000512
424 Ga0496102_0027035
425 Ga0496115_0125873
426 Ga0496116_0027672
427 Ga0496117_0000001
428 Ga0496118_0000002
429 Ga0496121_0000709
430 Ga0496121_0053734
431 Ga0496122_0000660
432 Ga0496123_0002832
433 Ga0496124_0027398
434 Ga0496124_0066858
435 Ga0496124_0159316
436 Ga0496125_0026915
437 Ga0501308_000396
438 Ga0495678_000009
439 Ga0495678_000396
440 Ga0495682_0003426
441 Ga0501249_000688
442 Ga0501269_000476
443 nmdc:mga0k408_54792_c1
444 nmdc:mga04h51_36942_c1
445 nmdc:mga07m45_49399_c1
446 Ga0500644_0007541
447 Ga0500646_0013280
448 Ga0500651_0061076
449 Ga0500569_005170
450 Ga0500618_000596
451 Ga0500618_016865
452 Ga0500652_000358
453 Ga0500568_0009239
454 Ga0500586_000305
455 Ga0500622_0000106
456 2511384472
457 2513955086
458 2597028590
459 2599445276
460 2601668745
461 2643868239
462 2644028235
463 2644162622
464 2841912730
465 2841923033
466 2842713598
467 2842748538
468 2857551442
469 2857566570
470 2885082733
471 2885267068
472 2900580228
473 2904543937
474 2919046517
475 2919477792
476 2928062606
477 2929162504
478 2932414296
479 2932416905
480 644748115

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

255

396

0.96

PF03453

MoeA_N

MoeA N-terminal region (domain I and II)

80

242

0.92

PF03454

MoeA_C

MoeA C-terminal region (domain IV)

409

476

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi8-assembly1.cif.gz_A molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.9141 13 414
2nqv-assembly1.cif.gz_B moea d228a 0.9132 13 414
1g8r-assembly1.cif.gz_B moea 0.9125 13 418
2nqn-assembly1.cif.gz_B moea t100w 0.9113 13 418
2nqs-assembly1.cif.gz_B moea e188a 0.9099 13 414
ID Description Score Start End Superfamily
1fc5A02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.9861 34 183 3.90.105.10
1g8lB02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.982 34 183 3.90.105.10
1fc5A02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.9527 34 183 3.90.105.10
1g8lB02 Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 0.9489 34 183 3.90.105.10
af_P12281_176_326_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9374 184 341 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A363SFZ1-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9762 12 418 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A7V2GZL6-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9672 13 418 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A257FIE3-F1-model_v4 deleted 0.9668 13 418
AF-A0A363SFZ1-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9666 12 418 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-J4S7W7-F1-model_v4 deleted 0.9665 111 418

Map