F353074
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 170 | 480 | 409 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_1196706|Ga0436361_1196706_16207_17652 |
| Length | 481 |
| Sequence | MVAVAKAIESHSILLFMGVPLVPENGLQAGIDIAASNSFPAKALRRLPSIIAETSSTICLMTLPNSSDASSSVPAKKPMLSAPQALAFLLEAATPLDGIETVPTLEANGRILAGRQVSQLNVPPMDNTQMDGYAVRAADCAGGAAVLPVSQRIPAGHVGQPLQPGTAARIFTGAMMPAGADAVVMQEQCEAAADGKSVTIKHAPQAGEWVRRTGEDIRSGAEILPAGVRLRAQELGLAASVGLASLPVRRKLHVAVFFTGDELAMPGEALKPGAIYNSNRYTLRGLLENLGCTVSDFGIVPDSLAATRETLRRAAAGHDLIVTSGGVSVGDEDHVKPAVEAEGRLSMWQIAIKPGKPLAFGEVNRGEGKAYFIGLPGNPVSSLVTFLLFVRPFILRLQGAAHTAPRAYAMRADFAWSKADKRNEFLRARINREGGLDLFANQGSAVLTSCVWGDGLIDNPPGQTIAPGDLVRFLPFDALLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 29 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 37 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 38 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 39 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 44 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 75 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 76 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 78 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 79 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 80 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 81 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 82 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 83 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 84 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 85 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 86 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 87 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 88 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 120 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 121 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 122 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 123 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 124 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 125 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 126 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 127 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 128 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 129 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 133 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 134 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 135 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 136 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 137 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 138 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 139 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 140 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 141 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 142 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 143 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 144 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 145 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 146 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 147 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 148 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 149 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 150 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 151 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 152 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 153 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 154 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 155 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 156 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 157 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 158 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 159 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 160 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 161 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 162 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 163 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 164 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 165 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 166 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 167 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 168 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 169 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 170 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.33 |
| Metatranscriptomes | 1.25 |
| Isolates | 10.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 33.33 |
| Nodule | 2.5 |
| Rhizoplane | 1.67 |
| Rhizosphere | 47.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_1196706 | 3300039447 | Bacteria | 36697 |
| 2 | JGI24740J21852_10007091 | 3300001979 | Bacteria | 4591 |
| 3 | JGI25156J39149_1005043 | 3300002705 | Bacteria | 3897 |
| 4 | JGI25156J39149_1005507 | 3300002705 | Bacteria | 3631 |
| 5 | JGI25154J39366_1000220 | 3300002738 | Bacteria | 39001 |
| 6 | JGI25151J46595_10001700 | 3300003187 | Bacteria | 14371 |
| 7 | JGI25151J46595_10010882 | 3300003187 | Bacteria | 4208 |
| 8 | JGI25151J46595_10017515 | 3300003187 | Bacteria | 3102 |
| 9 | JGI25151J46595_10048024 | 3300003187 | Bacteria | 1479 |
| 10 | rootL2_10020495 | 3300003322 | Bacteria | 6745 |
| 11 | rootL2_10043938 | 3300003322 | Bacteria | 2211 |
| 12 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 13 | Ga0055533_1002174 | 3300003756 | Bacteria | 4672 |
| 14 | Ga0055533_1002613 | 3300003756 | Bacteria | 4010 |
| 15 | Ga0055533_1003314 | 3300003756 | Bacteria | 3277 |
| 16 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 17 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 18 | Ga0055525_1000345 | 3300003759 | Bacteria | 33665 |
| 19 | Ga0055542_1001189 | 3300003762 | Bacteria | 14846 |
| 20 | Ga0055529_1000060 | 3300003763 | Bacteria | 191230 |
| 21 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 22 | Ga0055526_1000023 | 3300003771 | Bacteria | 163444 |
| 23 | Ga0055526_1000069 | 3300003771 | Bacteria | 97733 |
| 24 | Ga0055526_1005560 | 3300003771 | Bacteria | 7198 |
| 25 | Ga0055526_1005691 | 3300003771 | Bacteria | 7068 |
| 26 | Ga0055526_1010941 | 3300003771 | Bacteria | 4151 |
| 27 | Ga0055524_1001214 | 3300003775 | Bacteria | 15250 |
| 28 | Ga0055524_1015426 | 3300003775 | Bacteria | 2785 |
| 29 | Ga0055536_1000083 | 3300003781 | Bacteria | 81693 |
| 30 | Ga0055534_1000855 | 3300003784 | Bacteria | 13979 |
| 31 | Ga0055534_1001006 | 3300003784 | Bacteria | 12403 |
| 32 | Ga0055541_1000208 | 3300003841 | Bacteria | 24817 |
| 33 | Ga0055541_1001170 | 3300003841 | Bacteria | 5863 |
| 34 | Ga0055541_1008337 | 3300003841 | Bacteria | 1654 |
| 35 | Ga0070661_100001595 | 3300005344 | Bacteria | 15734 |
| 36 | Ga0070659_100010290 | 3300005366 | Bacteria | 6878 |
| 37 | Ga0070667_100040522 | 3300005367 | Bacteria | 3906 |
| 38 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 39 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 40 | Ga0068857_100002038 | 3300005577 | Bacteria | 16379 |
| 41 | Ga0068854_100000052 | 3300005578 | Bacteria | 85499 |
| 42 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 43 | Ga0068856_100136505 | 3300005614 | Bacteria | 2458 |
| 44 | Ga0075368_10066345 | 3300006042 | Bacteria | 1451 |
| 45 | Ga0075366_10009889 | 3300006195 | Bacteria | 5336 |
| 46 | Ga0079104_1003442 | 3300006946 | Bacteria | 7365 |
| 47 | Ga0105244_10036419 | 3300009036 | Bacteria | 2578 |
| 48 | Ga0105240_10010244 | 3300009093 | Bacteria | 13194 |
| 49 | Ga0157373_10010823 | 3300013100 | Bacteria | 6714 |
| 50 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 51 | Ga0157371_10000386 | 3300013102 | Bacteria | 55559 |
| 52 | Ga0157370_10010316 | 3300013104 | Bacteria | 9854 |
| 53 | Ga0157369_10008205 | 3300013105 | Bacteria | 11978 |
| 54 | Ga0157372_10000271 | 3300013307 | Bacteria | 57411 |
| 55 | Ga0182008_10000928 | 3300014497 | Bacteria | 20408 |
| 56 | Ga0182008_10002648 | 3300014497 | Bacteria | 11114 |
| 57 | Ga0182008_10016426 | 3300014497 | Bacteria | 3845 |
| 58 | Ga0182008_10033675 | 3300014497 | Bacteria | 2570 |
| 59 | Ga0182006_1000006 | 3300015261 | Bacteria | 555811 |
| 60 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 61 | Ga0182006_1012267 | 3300015261 | Bacteria | 3749 |
| 62 | Ga0182006_1014161 | 3300015261 | Bacteria | 3442 |
| 63 | Ga0182007_10000013 | 3300015262 | Bacteria | 231000 |
| 64 | Ga0182007_10012083 | 3300015262 | Bacteria | 3333 |
| 65 | Ga0182005_1000001 | 3300015265 | Bacteria | 1014869 |
| 66 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 67 | Ga0163161_10029371 | 3300017792 | Bacteria | 3909 |
| 68 | Ga0206351_10253009 | 3300020077 | Bacteria | 7729 |
| 69 | Ga0154015_1103548 | 3300020610 | Bacteria | 9590 |
| 70 | Ga0213872_10000290 | 3300021361 | Bacteria | 42933 |
| 71 | Ga0213872_10001477 | 3300021361 | Bacteria | 15244 |
| 72 | Ga0213872_10006750 | 3300021361 | Bacteria | 5715 |
| 73 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 74 | Ga0209784_100482 | 3300025224 | Bacteria | 16070 |
| 75 | Ga0209784_101670 | 3300025224 | Bacteria | 2704 |
| 76 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 77 | Ga0209566_100970 | 3300025225 | Bacteria | 12691 |
| 78 | Ga0209566_103475 | 3300025225 | Bacteria | 2409 |
| 79 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 80 | Ga0209674_100229 | 3300025226 | Bacteria | 50211 |
| 81 | Ga0209674_101558 | 3300025226 | Bacteria | 5833 |
| 82 | Ga0209672_100052 | 3300025228 | Bacteria | 231179 |
| 83 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 84 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 85 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 86 | Ga0209646_1000049 | 3300025246 | Bacteria | 301924 |
| 87 | Ga0209646_1000059 | 3300025246 | Bacteria | 256909 |
| 88 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 89 | Ga0209677_102838 | 3300025253 | Bacteria | 6123 |
| 90 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 91 | Ga0209148_1001390 | 3300025254 | Bacteria | 12483 |
| 92 | Ga0209148_1002516 | 3300025254 | Bacteria | 6157 |
| 93 | Ga0209759_1002389 | 3300025256 | Bacteria | 8282 |
| 94 | Ga0209759_1003853 | 3300025256 | Bacteria | 5811 |
| 95 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 96 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 97 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 98 | Ga0209673_1013162 | 3300025273 | Bacteria | 3284 |
| 99 | Ga0209675_1000305 | 3300025291 | Bacteria | 44331 |
| 100 | Ga0209675_1002471 | 3300025291 | Bacteria | 9483 |
| 101 | Ga0209675_1002728 | 3300025291 | Bacteria | 8842 |
| 102 | Ga0209676_1000380 | 3300025292 | Bacteria | 81727 |
| 103 | Ga0209025_1000796 | 3300025294 | Bacteria | 51224 |
| 104 | Ga0209025_1001065 | 3300025294 | Bacteria | 39873 |
| 105 | Ga0209025_1004323 | 3300025294 | Bacteria | 12419 |
| 106 | Ga0209025_1004347 | 3300025294 | Bacteria | 12371 |
| 107 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 108 | Ga0209564_1000096 | 3300025295 | Bacteria | 232165 |
| 109 | Ga0209564_1001230 | 3300025295 | Bacteria | 28913 |
| 110 | Ga0209564_1001850 | 3300025295 | Bacteria | 19221 |
| 111 | Ga0209564_1002876 | 3300025295 | Bacteria | 12621 |
| 112 | Ga0209256_1000280 | 3300025299 | Bacteria | 89706 |
| 113 | Ga0209256_1000653 | 3300025299 | Bacteria | 47237 |
| 114 | Ga0209051_1029950 | 3300025303 | Bacteria | 2122 |
| 115 | Ga0207655_1023979 | 3300025728 | Bacteria | 3006 |
| 116 | Ga0207695_10001909 | 3300025913 | Bacteria | 32457 |
| 117 | Ga0207649_10001269 | 3300025920 | Bacteria | 15079 |
| 118 | Ga0207681_10038168 | 3300025923 | Bacteria | 3180 |
| 119 | Ga0207690_10001324 | 3300025932 | Bacteria | 15570 |
| 120 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 121 | Ga0207640_10000035 | 3300025981 | Bacteria | 111369 |
| 122 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 123 | Ga0207702_10008078 | 3300026078 | Bacteria | 8901 |
| 124 | Ga0207674_10012396 | 3300026116 | Bacteria | 9531 |
| 125 | Ga0307515_10000022 | 3300028794 | Bacteria | 404064 |
| 126 | Ga0307515_10000417 | 3300028794 | Bacteria | 102343 |
| 127 | Ga0307515_10044681 | 3300028794 | Bacteria | 6835 |
| 128 | Ga0316181_1154236 | 3300030744 | Bacteria | 4381 |
| 129 | Ga0265327_10003564 | 3300031251 | Bacteria | 14736 |
| 130 | Ga0395899_0000473 | 3300037312 | Bacteria | 45449 |
| 131 | Ga0395900_0239834 | 3300037418 | Bacteria | 1819 |
| 132 | Ga0395901_0250483 | 3300038443 | Bacteria | 1845 |
| 133 | Ga0436361_0600215 | 3300039447 | Bacteria | 7031 |
| 134 | Ga0451577_0040292 | 3300042876 | Bacteria | 4194 |
| 135 | Ga0466972_0000005 | 3300044658 | Bacteria | 289640 |
| 136 | Ga0466965_0006416 | 3300044683 | Bacteria | 5340 |
| 137 | Ga0466961_0004849 | 3300044693 | Bacteria | 8463 |
| 138 | Ga0466968_0005280 | 3300044735 | Bacteria | 4838 |
| 139 | Ga0466970_0006124 | 3300044765 | Bacteria | 5991 |
| 140 | Ga0466959_0008819 | 3300045049 | Bacteria | 7145 |
| 141 | Ga0466967_0009266 | 3300045976 | Bacteria | 7293 |
| 142 | Ga0495617_000937 | 3300046452 | Bacteria | 13548 |
| 143 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 144 | Ga0495638_0074776 | 3300046460 | Bacteria | 2066 |
| 145 | Ga0495638_0080947 | 3300046460 | Bacteria | 1972 |
| 146 | Ga0495650_0000246 | 3300046471 | Bacteria | 107109 |
| 147 | Ga0495650_0010912 | 3300046471 | Bacteria | 5028 |
| 148 | Ga0495580_0054723 | 3300046472 | Bacteria | 2813 |
| 149 | Ga0495605_0000290 | 3300046474 | Bacteria | 55491 |
| 150 | Ga0495605_0005335 | 3300046474 | Bacteria | 7492 |
| 151 | Ga0495596_0002834 | 3300046500 | Bacteria | 9060 |
| 152 | Ga0495606_0000070 | 3300046507 | Bacteria | 177343 |
| 153 | Ga0495606_0000197 | 3300046507 | Bacteria | 105038 |
| 154 | Ga0495606_0004298 | 3300046507 | Bacteria | 14339 |
| 155 | Ga0495610_0001659 | 3300046512 | Bacteria | 19560 |
| 156 | Ga0495610_0082036 | 3300046512 | Bacteria | 1478 |
| 157 | Ga0495632_0010224 | 3300046519 | Bacteria | 5576 |
| 158 | Ga0495637_0017966 | 3300046520 | Bacteria | 3286 |
| 159 | Ga0495643_0000194 | 3300046522 | Bacteria | 96362 |
| 160 | Ga0495648_0000739 | 3300046524 | Bacteria | 34836 |
| 161 | Ga0495666_0009518 | 3300046526 | Bacteria | 4854 |
| 162 | Ga0495586_0029996 | 3300046535 | Bacteria | 2911 |
| 163 | Ga0495587_0039023 | 3300046536 | Bacteria | 2845 |
| 164 | Ga0495609_0000603 | 3300046538 | Bacteria | 28203 |
| 165 | Ga0495609_0008380 | 3300046538 | Bacteria | 5064 |
| 166 | Ga0495622_0006292 | 3300046557 | Bacteria | 5514 |
| 167 | Ga0495633_0000396 | 3300046558 | Bacteria | 45726 |
| 168 | Ga0495633_0004609 | 3300046558 | Bacteria | 8687 |
| 169 | Ga0495633_0026540 | 3300046558 | Bacteria | 2841 |
| 170 | Ga0495668_0000083 | 3300046616 | Bacteria | 153471 |
| 171 | Ga0495625_0003966 | 3300046660 | Bacteria | 14208 |
| 172 | Ga0495623_0061097 | 3300046679 | Bacteria | 2363 |
| 173 | Ga0495671_0047965 | 3300046692 | Bacteria | 2132 |
| 174 | Ga0495649_0115395 | 3300046694 | Bacteria | 1422 |
| 175 | Ga0495589_0029905 | 3300046794 | Bacteria | 2745 |
| 176 | Ga0495660_0001596 | 3300046810 | Bacteria | 15214 |
| 177 | Ga0495604_0037607 | 3300047317 | Bacteria | 3810 |
| 178 | Ga0495672_0006014 | 3300047320 | Bacteria | 9497 |
| 179 | Ga0495687_025280 | 3300047443 | Bacteria | 2810 |
| 180 | Ga0495686_0002009 | 3300047472 | Bacteria | 20129 |
| 181 | Ga0495686_0002773 | 3300047472 | Bacteria | 15988 |
| 182 | Ga0495686_0087278 | 3300047472 | Bacteria | 1897 |
| 183 | Ga0495626_0000512 | 3300048091 | Bacteria | 38832 |
| 184 | Ga0496102_0027035 | 3300048905 | Bacteria | 5123 |
| 185 | Ga0496115_0125873 | 3300048918 | Bacteria | 2111 |
| 186 | Ga0496116_0027672 | 3300048919 | Bacteria | 4122 |
| 187 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 188 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 189 | Ga0496121_0000709 | 3300048924 | Bacteria | 61789 |
| 190 | Ga0496121_0053734 | 3300048924 | Bacteria | 3372 |
| 191 | Ga0496122_0000660 | 3300048925 | Bacteria | 69382 |
| 192 | Ga0496123_0002832 | 3300048926 | Bacteria | 20510 |
| 193 | Ga0496124_0027398 | 3300048927 | Bacteria | 5115 |
| 194 | Ga0496124_0066858 | 3300048927 | Bacteria | 2992 |
| 195 | Ga0496124_0159316 | 3300048927 | Bacteria | 1761 |
| 196 | Ga0496125_0026915 | 3300048928 | Bacteria | 5223 |
| 197 | Ga0501308_000396 | 3300049128 | Bacteria | 2777 |
| 198 | Ga0495678_000009 | 3300049459 | Bacteria | 373806 |
| 199 | Ga0495678_000396 | 3300049459 | Bacteria | 43995 |
| 200 | Ga0495682_0003426 | 3300049460 | Bacteria | 7050 |
| 201 | Ga0501249_000688 | 3300049679 | Bacteria | 7689 |
| 202 | Ga0501269_000476 | 3300049766 | Bacteria | 8546 |
| 203 | nmdc:mga0k408_54792_c1 | 3300050493 | Bacteria | 2311 |
| 204 | nmdc:mga04h51_36942_c1 | 3300050495 | Bacteria | 1574 |
| 205 | nmdc:mga07m45_49399_c1 | 3300050496 | Bacteria | 1878 |
| 206 | Ga0500644_0007541 | 3300053088 | Bacteria | 2836 |
| 207 | Ga0500646_0013280 | 3300053090 | Bacteria | 2131 |
| 208 | Ga0500651_0061076 | 3300053093 | Bacteria | 2354 |
| 209 | Ga0500569_005170 | 3300053109 | Bacteria | 2792 |
| 210 | Ga0500618_000596 | 3300053125 | Bacteria | 22299 |
| 211 | Ga0500618_016865 | 3300053125 | Bacteria | 1822 |
| 212 | Ga0500652_000358 | 3300053131 | Bacteria | 16363 |
| 213 | Ga0500568_0009239 | 3300053139 | Bacteria | 4698 |
| 214 | Ga0500586_000305 | 3300053145 | Bacteria | 9781 |
| 215 | Ga0500622_0000106 | 3300053156 | Bacteria | 85750 |
| 216 | 2511384472 | 2511231026 | Bacteria | 5225445 |
| 217 | 2513955086 | 2513237150 | Bacteria | 6553639 |
| 218 | 2597028590 | 2596583598 | Bacteria | 5251611 |
| 219 | 2599445276 | 2599185178 | Bacteria | 5365746 |
| 220 | 2601668745 | 2600255292 | Bacteria | 6300551 |
| 221 | 2643868239 | 2643221570 | Bacteria | 5103772 |
| 222 | 2644028235 | 2643221603 | Bacteria | 6147767 |
| 223 | 2644162622 | 2643221628 | Bacteria | 5745828 |
| 224 | 2841912730 | 2841911363 | Bacteria | 6173697 |
| 225 | 2841923033 | 2841917233 | Bacteria | 6173500 |
| 226 | 2842713598 | 2842711865 | Bacteria | 7155354 |
| 227 | 2842748538 | 2842747753 | Bacteria | 5578255 |
| 228 | 2857551442 | 2857547612 | Bacteria | 6179999 |
| 229 | 2857566570 | 2857564685 | Bacteria | 6290584 |
| 230 | 2885082733 | 2885080285 | Bacteria | 6355622 |
| 231 | 2885267068 | 2885266251 | Bacteria | 4796748 |
| 232 | 2900580228 | 2900577576 | Bacteria | 5438534 |
| 233 | 2904543937 | 2904541872 | Bacteria | 8915136 |
| 234 | 2919046517 | 2919046199 | Bacteria | 5567169 |
| 235 | 2919477792 | 2919476304 | Bacteria | 5888696 |
| 236 | 2928062606 | 2928058823 | Bacteria | 5520022 |
| 237 | 2929162504 | 2929160207 | Bacteria | 9075316 |
| 238 | 2932414296 | 2932410948 | Bacteria | 6312192 |
| 239 | 2932416905 | 2932416698 | Bacteria | 6315112 |
| 240 | 644748115 | 644736347 | Bacteria | 6476522 |
| 241 | Ga0436361_1196706 | |||
| 242 | JGI24740J21852_10007091 | |||
| 243 | JGI25156J39149_1005043 | |||
| 244 | JGI25156J39149_1005507 | |||
| 245 | JGI25154J39366_1000220 | |||
| 246 | JGI25151J46595_10001700 | |||
| 247 | JGI25151J46595_10010882 | |||
| 248 | JGI25151J46595_10017515 | |||
| 249 | JGI25151J46595_10048024 | |||
| 250 | rootL2_10020495 | |||
| 251 | rootL2_10043938 | |||
| 252 | Ga0055539_1000123 | |||
| 253 | Ga0055533_1002174 | |||
| 254 | Ga0055533_1002613 | |||
| 255 | Ga0055533_1003314 | |||
| 256 | Ga0055532_1000002 | |||
| 257 | Ga0055532_1000029 | |||
| 258 | Ga0055525_1000345 | |||
| 259 | Ga0055542_1001189 | |||
| 260 | Ga0055529_1000060 | |||
| 261 | Ga0055529_1000062 | |||
| 262 | Ga0055526_1000023 | |||
| 263 | Ga0055526_1000069 | |||
| 264 | Ga0055526_1005560 | |||
| 265 | Ga0055526_1005691 | |||
| 266 | Ga0055526_1010941 | |||
| 267 | Ga0055524_1001214 | |||
| 268 | Ga0055524_1015426 | |||
| 269 | Ga0055536_1000083 | |||
| 270 | Ga0055534_1000855 | |||
| 271 | Ga0055534_1001006 | |||
| 272 | Ga0055541_1000208 | |||
| 273 | Ga0055541_1001170 | |||
| 274 | Ga0055541_1008337 | |||
| 275 | Ga0070661_100001595 | |||
| 276 | Ga0070659_100010290 | |||
| 277 | Ga0070667_100040522 | |||
| 278 | Ga0070663_100000011 | |||
| 279 | Ga0070664_100000008 | |||
| 280 | Ga0068857_100002038 | |||
| 281 | Ga0068854_100000052 | |||
| 282 | Ga0068856_100000009 | |||
| 283 | Ga0068856_100136505 | |||
| 284 | Ga0075368_10066345 | |||
| 285 | Ga0075366_10009889 | |||
| 286 | Ga0079104_1003442 | |||
| 287 | Ga0105244_10036419 | |||
| 288 | Ga0105240_10010244 | |||
| 289 | Ga0157373_10010823 | |||
| 290 | Ga0157371_10000068 | |||
| 291 | Ga0157371_10000386 | |||
| 292 | Ga0157370_10010316 | |||
| 293 | Ga0157369_10008205 | |||
| 294 | Ga0157372_10000271 | |||
| 295 | Ga0182008_10000928 | |||
| 296 | Ga0182008_10002648 | |||
| 297 | Ga0182008_10016426 | |||
| 298 | Ga0182008_10033675 | |||
| 299 | Ga0182006_1000006 | |||
| 300 | Ga0182006_1000008 | |||
| 301 | Ga0182006_1012267 | |||
| 302 | Ga0182006_1014161 | |||
| 303 | Ga0182007_10000013 | |||
| 304 | Ga0182007_10012083 | |||
| 305 | Ga0182005_1000001 | |||
| 306 | Ga0182005_1000008 | |||
| 307 | Ga0163161_10029371 | |||
| 308 | Ga0206351_10253009 | |||
| 309 | Ga0154015_1103548 | |||
| 310 | Ga0213872_10000290 | |||
| 311 | Ga0213872_10001477 | |||
| 312 | Ga0213872_10006750 | |||
| 313 | Ga0209784_100003 | |||
| 314 | Ga0209784_100482 | |||
| 315 | Ga0209784_101670 | |||
| 316 | Ga0209566_100002 | |||
| 317 | Ga0209566_100970 | |||
| 318 | Ga0209566_103475 | |||
| 319 | Ga0209674_100008 | |||
| 320 | Ga0209674_100229 | |||
| 321 | Ga0209674_101558 | |||
| 322 | Ga0209672_100052 | |||
| 323 | Ga0209147_100002 | |||
| 324 | Ga0209563_100004 | |||
| 325 | Ga0209258_100002 | |||
| 326 | Ga0209646_1000049 | |||
| 327 | Ga0209646_1000059 | |||
| 328 | Ga0209677_100009 | |||
| 329 | Ga0209677_102838 | |||
| 330 | Ga0209148_1000021 | |||
| 331 | Ga0209148_1001390 | |||
| 332 | Ga0209148_1002516 | |||
| 333 | Ga0209759_1002389 | |||
| 334 | Ga0209759_1003853 | |||
| 335 | Ga0209565_1000021 | |||
| 336 | Ga0209455_1000021 | |||
| 337 | Ga0209455_1000026 | |||
| 338 | Ga0209673_1013162 | |||
| 339 | Ga0209675_1000305 | |||
| 340 | Ga0209675_1002471 | |||
| 341 | Ga0209675_1002728 | |||
| 342 | Ga0209676_1000380 | |||
| 343 | Ga0209025_1000796 | |||
| 344 | Ga0209025_1001065 | |||
| 345 | Ga0209025_1004323 | |||
| 346 | Ga0209025_1004347 | |||
| 347 | Ga0209564_1000002 | |||
| 348 | Ga0209564_1000096 | |||
| 349 | Ga0209564_1001230 | |||
| 350 | Ga0209564_1001850 | |||
| 351 | Ga0209564_1002876 | |||
| 352 | Ga0209256_1000280 | |||
| 353 | Ga0209256_1000653 | |||
| 354 | Ga0209051_1029950 | |||
| 355 | Ga0207655_1023979 | |||
| 356 | Ga0207695_10001909 | |||
| 357 | Ga0207649_10001269 | |||
| 358 | Ga0207681_10038168 | |||
| 359 | Ga0207690_10001324 | |||
| 360 | Ga0207679_10000001 | |||
| 361 | Ga0207640_10000035 | |||
| 362 | Ga0207678_10000001 | |||
| 363 | Ga0207702_10008078 | |||
| 364 | Ga0207674_10012396 | |||
| 365 | Ga0307515_10000022 | |||
| 366 | Ga0307515_10000417 | |||
| 367 | Ga0307515_10044681 | |||
| 368 | Ga0316181_1154236 | |||
| 369 | Ga0265327_10003564 | |||
| 370 | Ga0395899_0000473 | |||
| 371 | Ga0395900_0239834 | |||
| 372 | Ga0395901_0250483 | |||
| 373 | Ga0436361_0600215 | |||
| 374 | Ga0451577_0040292 | |||
| 375 | Ga0466972_0000005 | |||
| 376 | Ga0466965_0006416 | |||
| 377 | Ga0466961_0004849 | |||
| 378 | Ga0466968_0005280 | |||
| 379 | Ga0466970_0006124 | |||
| 380 | Ga0466959_0008819 | |||
| 381 | Ga0466967_0009266 | |||
| 382 | Ga0495617_000937 | |||
| 383 | Ga0495627_000001 | |||
| 384 | Ga0495638_0074776 | |||
| 385 | Ga0495638_0080947 | |||
| 386 | Ga0495650_0000246 | |||
| 387 | Ga0495650_0010912 | |||
| 388 | Ga0495580_0054723 | |||
| 389 | Ga0495605_0000290 | |||
| 390 | Ga0495605_0005335 | |||
| 391 | Ga0495596_0002834 | |||
| 392 | Ga0495606_0000070 | |||
| 393 | Ga0495606_0000197 | |||
| 394 | Ga0495606_0004298 | |||
| 395 | Ga0495610_0001659 | |||
| 396 | Ga0495610_0082036 | |||
| 397 | Ga0495632_0010224 | |||
| 398 | Ga0495637_0017966 | |||
| 399 | Ga0495643_0000194 | |||
| 400 | Ga0495648_0000739 | |||
| 401 | Ga0495666_0009518 | |||
| 402 | Ga0495586_0029996 | |||
| 403 | Ga0495587_0039023 | |||
| 404 | Ga0495609_0000603 | |||
| 405 | Ga0495609_0008380 | |||
| 406 | Ga0495622_0006292 | |||
| 407 | Ga0495633_0000396 | |||
| 408 | Ga0495633_0004609 | |||
| 409 | Ga0495633_0026540 | |||
| 410 | Ga0495668_0000083 | |||
| 411 | Ga0495625_0003966 | |||
| 412 | Ga0495623_0061097 | |||
| 413 | Ga0495671_0047965 | |||
| 414 | Ga0495649_0115395 | |||
| 415 | Ga0495589_0029905 | |||
| 416 | Ga0495660_0001596 | |||
| 417 | Ga0495604_0037607 | |||
| 418 | Ga0495672_0006014 | |||
| 419 | Ga0495687_025280 | |||
| 420 | Ga0495686_0002009 | |||
| 421 | Ga0495686_0002773 | |||
| 422 | Ga0495686_0087278 | |||
| 423 | Ga0495626_0000512 | |||
| 424 | Ga0496102_0027035 | |||
| 425 | Ga0496115_0125873 | |||
| 426 | Ga0496116_0027672 | |||
| 427 | Ga0496117_0000001 | |||
| 428 | Ga0496118_0000002 | |||
| 429 | Ga0496121_0000709 | |||
| 430 | Ga0496121_0053734 | |||
| 431 | Ga0496122_0000660 | |||
| 432 | Ga0496123_0002832 | |||
| 433 | Ga0496124_0027398 | |||
| 434 | Ga0496124_0066858 | |||
| 435 | Ga0496124_0159316 | |||
| 436 | Ga0496125_0026915 | |||
| 437 | Ga0501308_000396 | |||
| 438 | Ga0495678_000009 | |||
| 439 | Ga0495678_000396 | |||
| 440 | Ga0495682_0003426 | |||
| 441 | Ga0501249_000688 | |||
| 442 | Ga0501269_000476 | |||
| 443 | nmdc:mga0k408_54792_c1 | |||
| 444 | nmdc:mga04h51_36942_c1 | |||
| 445 | nmdc:mga07m45_49399_c1 | |||
| 446 | Ga0500644_0007541 | |||
| 447 | Ga0500646_0013280 | |||
| 448 | Ga0500651_0061076 | |||
| 449 | Ga0500569_005170 | |||
| 450 | Ga0500618_000596 | |||
| 451 | Ga0500618_016865 | |||
| 452 | Ga0500652_000358 | |||
| 453 | Ga0500568_0009239 | |||
| 454 | Ga0500586_000305 | |||
| 455 | Ga0500622_0000106 | |||
| 456 | 2511384472 | |||
| 457 | 2513955086 | |||
| 458 | 2597028590 | |||
| 459 | 2599445276 | |||
| 460 | 2601668745 | |||
| 461 | 2643868239 | |||
| 462 | 2644028235 | |||
| 463 | 2644162622 | |||
| 464 | 2841912730 | |||
| 465 | 2841923033 | |||
| 466 | 2842713598 | |||
| 467 | 2842748538 | |||
| 468 | 2857551442 | |||
| 469 | 2857566570 | |||
| 470 | 2885082733 | |||
| 471 | 2885267068 | |||
| 472 | 2900580228 | |||
| 473 | 2904543937 | |||
| 474 | 2919046517 | |||
| 475 | 2919477792 | |||
| 476 | 2928062606 | |||
| 477 | 2929162504 | |||
| 478 | 2932414296 | |||
| 479 | 2932416905 | |||
| 480 | 644748115 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xi8-assembly1.cif.gz_A | molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 | 0.9141 | 13 | 414 |
| 2nqv-assembly1.cif.gz_B | moea d228a | 0.9132 | 13 | 414 |
| 1g8r-assembly1.cif.gz_B | moea | 0.9125 | 13 | 418 |
| 2nqn-assembly1.cif.gz_B | moea t100w | 0.9113 | 13 | 418 |
| 2nqs-assembly1.cif.gz_B | moea e188a | 0.9099 | 13 | 414 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fc5A02 | Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 | 0.9861 | 34 | 183 | 3.90.105.10 |
| 1g8lB02 | Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 | 0.982 | 34 | 183 | 3.90.105.10 |
| 1fc5A02 | Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 | 0.9527 | 34 | 183 | 3.90.105.10 |
| 1g8lB02 | Alpha Beta;Alpha-Beta Complex;Molybdopterin biosynthesis moea protein, domain 2;Molybdopterin biosynthesis moea protein, domain 2 | 0.9489 | 34 | 183 | 3.90.105.10 |
| af_P12281_176_326_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9374 | 184 | 341 | 3.40.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A363SFZ1-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9762 | 12 | 418 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A7V2GZL6-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9672 | 13 | 418 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A257FIE3-F1-model_v4 | deleted | 0.9668 | 13 | 418 |
|
| AF-A0A363SFZ1-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9666 | 12 | 418 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-J4S7W7-F1-model_v4 | deleted | 0.9665 | 111 | 418 |
|