F353154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 144 | 480 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0000542|Ga0495585_0000542_30694_31383 |
| Length | 229 |
| Sequence | VIPTQTLPGREGFKNKFTSIMASSTTNEIQKKVSPSGGDLEGAPPVILASKSPRRQELLRLMDIDFRVVLKDVDESYPEGLSPQEVALHIARKKAEAFDETIGDEVVLTADTIVCIDGLILGKPESRTDAIEMLQRLSGRVHQVITGVCLLHNGQYNNFYDLTEVFFRKLSDAEISNYVDKYQPLDKAGSYGIQELIGLIGIERIEGSYTNVVGLPTEKVYAQLGALNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 99 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 106 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 107 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 108 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 130 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 132 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 133 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 134 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 135 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 136 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 137 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 138 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 139 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 140 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 141 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 142 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 143 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 144 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.25 |
| Metatranscriptomes | 0 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.42 |
| Nodule | 0 |
| Rhizoplane | 0.42 |
| Rhizosphere | 82.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495585_0000542 | 3300046492 | Bacteria | 35718 |
| 2 | JGI24737J22298_10070533 | 3300001990 | Bacteria | 1044 |
| 3 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 4 | JGI25162J39368_1000046 | 3300002737 | Bacteria | 169695 |
| 5 | JGI25164J39214_1001974 | 3300002772 | Bacteria | 3701 |
| 6 | JGI25165J46597_1001297 | 3300003214 | Bacteria | 14423 |
| 7 | rootH1_10038987 | 3300003316 | Bacteria | 20037 |
| 8 | rootH1_10057206 | 3300003316 | Bacteria | 2804 |
| 9 | rootH1_10185428 | 3300003316 | Unclassified | 1643 |
| 10 | rootH2_10006566 | 3300003320 | Bacteria | 99379 |
| 11 | rootL2_10115709 | 3300003322 | Bacteria | 1661 |
| 12 | rootH1_10003256 | 3300003323 | Bacteria | 53834 |
| 13 | rootH1_10053582 | 3300003323 | Bacteria | 3594 |
| 14 | Ga0055536_1006243 | 3300003781 | Bacteria | 5619 |
| 15 | Ga0065165_1000152 | 3300005262 | Bacteria | 120418 |
| 16 | Ga0070683_100018073 | 3300005329 | Bacteria | 6238 |
| 17 | Ga0068868_100026497 | 3300005338 | Bacteria | 4419 |
| 18 | Ga0070660_100071879 | 3300005339 | Bacteria | 2702 |
| 19 | Ga0070689_100206325 | 3300005340 | Bacteria | 1607 |
| 20 | Ga0070669_100049976 | 3300005353 | Unclassified | 3054 |
| 21 | Ga0070675_100051768 | 3300005354 | Bacteria | 3375 |
| 22 | Ga0070671_100050883 | 3300005355 | Bacteria | 3446 |
| 23 | Ga0070674_100039278 | 3300005356 | Bacteria | 3195 |
| 24 | Ga0070659_100000042 | 3300005366 | Bacteria | 103672 |
| 25 | Ga0070662_100000030 | 3300005457 | Bacteria | 81418 |
| 26 | Ga0070662_100320253 | 3300005457 | Bacteria | 1264 |
| 27 | Ga0070706_100160897 | 3300005467 | Bacteria | 2096 |
| 28 | Ga0070679_100003601 | 3300005530 | Bacteria | 14152 |
| 29 | Ga0070684_100053533 | 3300005535 | Bacteria | 3514 |
| 30 | Ga0068853_100134200 | 3300005539 | Bacteria | 2218 |
| 31 | Ga0068853_100350409 | 3300005539 | Bacteria | 1373 |
| 32 | Ga0070686_100749852 | 3300005544 | Unclassified | 783 |
| 33 | Ga0068855_100002946 | 3300005563 | Bacteria | 20803 |
| 34 | Ga0068855_100016255 | 3300005563 | Bacteria | 8949 |
| 35 | Ga0068855_100055062 | 3300005563 | Bacteria | 4673 |
| 36 | Ga0068855_100073379 | 3300005563 | Bacteria | 3976 |
| 37 | Ga0068855_100607690 | 3300005563 | Bacteria | 1178 |
| 38 | Ga0068854_100285510 | 3300005578 | Bacteria | 1330 |
| 39 | Ga0068856_100264658 | 3300005614 | Bacteria | 1735 |
| 40 | Ga0068852_100003276 | 3300005616 | Bacteria | 11304 |
| 41 | Ga0068870_10083996 | 3300005840 | Bacteria | 1766 |
| 42 | Ga0081539_10026610 | 3300005985 | Bacteria | 3685 |
| 43 | Ga0070717_10176409 | 3300006028 | Bacteria | 1861 |
| 44 | Ga0070712_100150166 | 3300006175 | Bacteria | 1788 |
| 45 | Ga0075366_10001501 | 3300006195 | Bacteria | 11652 |
| 46 | Ga0075366_10004451 | 3300006195 | Bacteria | 7521 |
| 47 | Ga0075366_10032051 | 3300006195 | Bacteria | 3094 |
| 48 | Ga0097621_100000093 | 3300006237 | Bacteria | 49437 |
| 49 | Ga0068871_100001507 | 3300006358 | Bacteria | 15615 |
| 50 | Ga0068871_100877672 | 3300006358 | Bacteria | 830 |
| 51 | Ga0068865_100004049 | 3300006881 | Bacteria | 8801 |
| 52 | Ga0075436_100040512 | 3300006914 | Bacteria | 3215 |
| 53 | Ga0105240_10019302 | 3300009093 | Bacteria | 9110 |
| 54 | Ga0105240_10053952 | 3300009093 | Bacteria | 5041 |
| 55 | Ga0105240_10077511 | 3300009093 | Bacteria | 4094 |
| 56 | Ga0105240_11493722 | 3300009093 | Bacteria | 709 |
| 57 | Ga0105245_10267294 | 3300009098 | Bacteria | 1666 |
| 58 | Ga0105241_10001783 | 3300009174 | Bacteria | 16342 |
| 59 | Ga0105241_10027877 | 3300009174 | Bacteria | 4206 |
| 60 | Ga0105241_10043115 | 3300009174 | Bacteria | 3416 |
| 61 | Ga0105241_10282151 | 3300009174 | Bacteria | 1419 |
| 62 | Ga0105237_10002994 | 3300009545 | Bacteria | 20410 |
| 63 | Ga0105237_10003874 | 3300009545 | Bacteria | 17567 |
| 64 | Ga0105237_10011780 | 3300009545 | Bacteria | 9252 |
| 65 | Ga0105237_10044222 | 3300009545 | Bacteria | 4484 |
| 66 | Ga0105237_10403689 | 3300009545 | Bacteria | 1371 |
| 67 | Ga0105239_10000228 | 3300010375 | Bacteria | 82820 |
| 68 | Ga0105239_10001327 | 3300010375 | Bacteria | 33331 |
| 69 | Ga0105239_10002117 | 3300010375 | Bacteria | 25632 |
| 70 | Ga0105239_10002733 | 3300010375 | Bacteria | 22146 |
| 71 | Ga0105239_10003320 | 3300010375 | Bacteria | 19805 |
| 72 | Ga0105239_10027951 | 3300010375 | Bacteria | 6206 |
| 73 | Ga0105239_10045570 | 3300010375 | Bacteria | 4807 |
| 74 | Ga0105239_10279553 | 3300010375 | Bacteria | 1879 |
| 75 | Ga0105239_10588907 | 3300010375 | Bacteria | 1268 |
| 76 | Ga0105239_10955061 | 3300010375 | Unclassified | 985 |
| 77 | Ga0105246_10098692 | 3300011119 | Bacteria | 2122 |
| 78 | Ga0105246_10141567 | 3300011119 | Bacteria | 1809 |
| 79 | Ga0157373_10000205 | 3300013100 | Bacteria | 48796 |
| 80 | Ga0157373_10028284 | 3300013100 | Bacteria | 4044 |
| 81 | Ga0157371_10144264 | 3300013102 | Bacteria | 1696 |
| 82 | Ga0157371_10524690 | 3300013102 | Bacteria | 876 |
| 83 | Ga0157370_10135849 | 3300013104 | Bacteria | 2292 |
| 84 | Ga0157369_10093531 | 3300013105 | Bacteria | 3209 |
| 85 | Ga0157374_10000203 | 3300013296 | Bacteria | 54699 |
| 86 | Ga0157374_10003381 | 3300013296 | Bacteria | 13408 |
| 87 | Ga0157378_10060096 | 3300013297 | Bacteria | 3392 |
| 88 | Ga0157378_10284620 | 3300013297 | Bacteria | 1595 |
| 89 | Ga0163162_10000399 | 3300013306 | Bacteria | 39845 |
| 90 | Ga0163162_10043071 | 3300013306 | Bacteria | 4519 |
| 91 | Ga0163162_10122372 | 3300013306 | Unclassified | 2707 |
| 92 | Ga0157372_10009141 | 3300013307 | Bacteria | 10525 |
| 93 | Ga0157372_10129449 | 3300013307 | Bacteria | 2903 |
| 94 | Ga0157372_10135560 | 3300013307 | Bacteria | 2835 |
| 95 | Ga0157372_10550738 | 3300013307 | Bacteria | 1345 |
| 96 | Ga0157375_10023479 | 3300013308 | Bacteria | 5692 |
| 97 | Ga0157375_10347329 | 3300013308 | Bacteria | 1649 |
| 98 | Ga0157376_10036075 | 3300014969 | Bacteria | 4003 |
| 99 | Ga0163161_10038608 | 3300017792 | Bacteria | 3425 |
| 100 | Ga0213872_10018815 | 3300021361 | Bacteria | 3183 |
| 101 | Ga0207427_100076 | 3300025231 | Bacteria | 149885 |
| 102 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 103 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 104 | Ga0209026_1000691 | 3300025250 | Bacteria | 20158 |
| 105 | Ga0209026_1007439 | 3300025250 | Bacteria | 2464 |
| 106 | Ga0209148_1027918 | 3300025254 | Bacteria | 864 |
| 107 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 108 | Ga0209233_1014695 | 3300025261 | Bacteria | 2199 |
| 109 | Ga0209676_1001137 | 3300025292 | Bacteria | 29129 |
| 110 | Ga0207647_10000247 | 3300025904 | Bacteria | 44109 |
| 111 | Ga0207645_10003597 | 3300025907 | Bacteria | 11728 |
| 112 | Ga0207643_10250532 | 3300025908 | Unclassified | 1091 |
| 113 | Ga0207705_10000112 | 3300025909 | Bacteria | 90821 |
| 114 | Ga0207684_10027410 | 3300025910 | Bacteria | 4855 |
| 115 | Ga0207654_10005196 | 3300025911 | Bacteria | 6569 |
| 116 | Ga0207654_10016746 | 3300025911 | Bacteria | 3820 |
| 117 | Ga0207654_10033891 | 3300025911 | Bacteria | 2834 |
| 118 | Ga0207707_10010538 | 3300025912 | Bacteria | 8026 |
| 119 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 120 | Ga0207695_10015023 | 3300025913 | Bacteria | 9136 |
| 121 | Ga0207695_10112642 | 3300025913 | Bacteria | 2698 |
| 122 | Ga0207695_10395893 | 3300025913 | Bacteria | 1266 |
| 123 | Ga0207671_10002982 | 3300025914 | Bacteria | 17364 |
| 124 | Ga0207671_10007384 | 3300025914 | Bacteria | 9546 |
| 125 | Ga0207671_10031536 | 3300025914 | Bacteria | 3949 |
| 126 | Ga0207671_10048649 | 3300025914 | Bacteria | 3138 |
| 127 | Ga0207671_10128296 | 3300025914 | Bacteria | 1945 |
| 128 | Ga0207657_10082245 | 3300025919 | Bacteria | 2703 |
| 129 | Ga0207652_10020319 | 3300025921 | Bacteria | 5466 |
| 130 | Ga0207681_10243451 | 3300025923 | Bacteria | 1401 |
| 131 | Ga0207659_10076114 | 3300025926 | Bacteria | 2466 |
| 132 | Ga0207644_10048929 | 3300025931 | Bacteria | 3025 |
| 133 | Ga0207690_10000408 | 3300025932 | Bacteria | 28225 |
| 134 | Ga0207706_10000129 | 3300025933 | Bacteria | 81280 |
| 135 | Ga0207706_10406832 | 3300025933 | Bacteria | 1179 |
| 136 | Ga0207670_10202549 | 3300025936 | Bacteria | 1509 |
| 137 | Ga0207669_10025150 | 3300025937 | Bacteria | 3212 |
| 138 | Ga0207704_10000074 | 3300025938 | Bacteria | 61994 |
| 139 | Ga0207691_10208461 | 3300025940 | Bacteria | 1699 |
| 140 | Ga0207691_10258646 | 3300025940 | Unclassified | 1501 |
| 141 | Ga0207661_10044030 | 3300025944 | Bacteria | 3525 |
| 142 | Ga0207667_10000375 | 3300025949 | Bacteria | 60547 |
| 143 | Ga0207667_10003051 | 3300025949 | Bacteria | 20783 |
| 144 | Ga0207667_10025160 | 3300025949 | Bacteria | 6522 |
| 145 | Ga0207667_10085296 | 3300025949 | Bacteria | 3270 |
| 146 | Ga0207667_10089886 | 3300025949 | Bacteria | 3173 |
| 147 | Ga0207667_10092260 | 3300025949 | Bacteria | 3128 |
| 148 | Ga0207677_10019688 | 3300026023 | Bacteria | 4082 |
| 149 | Ga0207639_10022819 | 3300026041 | Bacteria | 4512 |
| 150 | Ga0207639_10092022 | 3300026041 | Bacteria | 2430 |
| 151 | Ga0207702_10000586 | 3300026078 | Bacteria | 40370 |
| 152 | Ga0207702_10022086 | 3300026078 | Bacteria | 5272 |
| 153 | Ga0207702_10057641 | 3300026078 | Bacteria | 3302 |
| 154 | Ga0207702_10418952 | 3300026078 | Bacteria | 1295 |
| 155 | Ga0207702_10772794 | 3300026078 | Bacteria | 949 |
| 156 | Ga0207648_10013132 | 3300026089 | Bacteria | 7719 |
| 157 | Ga0207683_10290805 | 3300026121 | Bacteria | 1494 |
| 158 | Ga0207698_10006348 | 3300026142 | Bacteria | 7367 |
| 159 | Ga0268266_10000095 | 3300028379 | Bacteria | 186169 |
| 160 | Ga0307515_10000181 | 3300028794 | Bacteria | 154316 |
| 161 | Ga0307515_10000353 | 3300028794 | Bacteria | 112876 |
| 162 | Ga0307509_10096645 | 3300031507 | Bacteria | 3005 |
| 163 | Ga0307408_100000751 | 3300031548 | Bacteria | 26176 |
| 164 | Ga0307408_100009996 | 3300031548 | Bacteria | 6252 |
| 165 | Ga0307405_10002240 | 3300031731 | Bacteria | 8462 |
| 166 | Ga0307414_10388287 | 3300032004 | Bacteria | 1209 |
| 167 | Ga0316574_0110352 | 3300035398 | Bacteria | 1763 |
| 168 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 169 | Ga0395899_0001808 | 3300037312 | Bacteria | 17704 |
| 170 | Ga0395900_0000506 | 3300037418 | Bacteria | 54890 |
| 171 | Ga0395900_0002719 | 3300037418 | Bacteria | 19337 |
| 172 | Ga0395900_0010229 | 3300037418 | Bacteria | 9595 |
| 173 | Ga0395900_1189130 | 3300037418 | Unclassified | 678 |
| 174 | Ga0395898_0056715 | 3300037466 | Bacteria | 3818 |
| 175 | Ga0395905_0000379 | 3300037471 | Bacteria | 63171 |
| 176 | Ga0395905_0001752 | 3300037471 | Bacteria | 25335 |
| 177 | Ga0395901_0001923 | 3300038443 | Bacteria | 21386 |
| 178 | Ga0395901_0003457 | 3300038443 | Bacteria | 15913 |
| 179 | Ga0436361_0829163 | 3300039447 | Bacteria | 6815 |
| 180 | Ga0436363_1299444 | 3300039450 | Bacteria | 693 |
| 181 | Ga0439448_0141881 | 3300042005 | Bacteria | 831 |
| 182 | Ga0495651_0096949 | 3300046462 | Bacteria | 2203 |
| 183 | Ga0495651_0197407 | 3300046462 | Bacteria | 1411 |
| 184 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 185 | Ga0495650_0148330 | 3300046471 | Bacteria | 844 |
| 186 | Ga0495585_0000436 | 3300046492 | Bacteria | 39946 |
| 187 | Ga0495607_0191408 | 3300046501 | Bacteria | 1019 |
| 188 | Ga0495583_0074385 | 3300046506 | Bacteria | 1487 |
| 189 | Ga0495606_0000020 | 3300046507 | Bacteria | 274490 |
| 190 | Ga0495606_0013549 | 3300046507 | Bacteria | 6432 |
| 191 | Ga0495606_0072952 | 3300046507 | Bacteria | 2155 |
| 192 | Ga0495606_0151544 | 3300046507 | Bacteria | 1360 |
| 193 | Ga0495606_0206111 | 3300046507 | Bacteria | 1117 |
| 194 | Ga0495610_0003852 | 3300046512 | Bacteria | 11404 |
| 195 | Ga0495610_0138026 | 3300046512 | Bacteria | 1052 |
| 196 | Ga0495616_0005310 | 3300046513 | Bacteria | 7941 |
| 197 | Ga0495616_0047866 | 3300046513 | Bacteria | 2151 |
| 198 | Ga0495631_0018023 | 3300046518 | Bacteria | 3331 |
| 199 | Ga0495648_0009849 | 3300046524 | Bacteria | 7344 |
| 200 | Ga0495642_0213049 | 3300046528 | Bacteria | 843 |
| 201 | Ga0495609_0000834 | 3300046538 | Bacteria | 22885 |
| 202 | Ga0495622_0046846 | 3300046557 | Bacteria | 2009 |
| 203 | Ga0495633_0000101 | 3300046558 | Bacteria | 116147 |
| 204 | Ga0495633_0047980 | 3300046558 | Bacteria | 2017 |
| 205 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 206 | Ga0495625_0000282 | 3300046660 | Bacteria | 79268 |
| 207 | Ga0495625_0009458 | 3300046660 | Bacteria | 8157 |
| 208 | Ga0495625_0032533 | 3300046660 | Bacteria | 3865 |
| 209 | Ga0495625_0144793 | 3300046660 | Bacteria | 1600 |
| 210 | Ga0495625_0285696 | 3300046660 | Unclassified | 1060 |
| 211 | Ga0495661_0061954 | 3300046665 | Bacteria | 2218 |
| 212 | Ga0495661_0088597 | 3300046665 | Bacteria | 1766 |
| 213 | Ga0495649_0000172 | 3300046694 | Bacteria | 56537 |
| 214 | Ga0495589_0031808 | 3300046794 | Bacteria | 2656 |
| 215 | Ga0495687_000516 | 3300047443 | Bacteria | 46369 |
| 216 | Ga0495687_043356 | 3300047443 | Bacteria | 1961 |
| 217 | Ga0495679_054209 | 3300047446 | Bacteria | 1195 |
| 218 | Ga0495686_0001273 | 3300047472 | Bacteria | 28543 |
| 219 | Ga0495686_0203345 | 3300047472 | Bacteria | 1135 |
| 220 | Ga0495682_0148573 | 3300049460 | Bacteria | 836 |
| 221 | nmdc:mga0k408_1712_c1 | 3300050493 | Bacteria | 11799 |
| 222 | nmdc:mga0k408_186333_c1 | 3300050493 | Bacteria | 1238 |
| 223 | nmdc:mga0k408_33461_c1 | 3300050493 | Bacteria | 2940 |
| 224 | nmdc:mga0k408_3883_c1 | 3300050493 | Bacteria | 7922 |
| 225 | nmdc:mga08x19_64469_c1 | 3300050514 | Bacteria | 2378 |
| 226 | Ga0500635_0010472 | 3300053080 | Bacteria | 2606 |
| 227 | Ga0500650_0198246 | 3300053098 | Bacteria | 915 |
| 228 | Ga0500618_000023 | 3300053125 | Bacteria | 152444 |
| 229 | Ga0500618_029309 | 3300053125 | Bacteria | 1299 |
| 230 | Ga0500616_0175534 | 3300053153 | Unclassified | 969 |
| 231 | Ga0500624_000311 | 3300053157 | Bacteria | 16698 |
| 232 | 2522548533 | 2522125168 | Bacteria | 7376607 |
| 233 | 2599477038 | 2599185184 | Bacteria | 6430550 |
| 234 | 2839991410 | 2839989709 | Bacteria | 3773432 |
| 235 | 2884937990 | 2884933994 | Bacteria | 4535041 |
| 236 | 2919442336 | 2919437846 | Bacteria | 6199444 |
| 237 | 2928078951 | 2928078545 | Bacteria | 6534839 |
| 238 | 2928148682 | 2928147474 | Bacteria | 6512076 |
| 239 | 2932085600 | 2932082852 | Bacteria | 6563563 |
| 240 | 2977236869 | 2977232053 | Bacteria | 5485925 |
| 241 | Ga0495585_0000542 | |||
| 242 | JGI24737J22298_10070533 | |||
| 243 | JGI24735J21928_10000006 | |||
| 244 | JGI25162J39368_1000046 | |||
| 245 | JGI25164J39214_1001974 | |||
| 246 | JGI25165J46597_1001297 | |||
| 247 | rootH1_10038987 | |||
| 248 | rootH1_10057206 | |||
| 249 | rootH1_10185428 | |||
| 250 | rootH2_10006566 | |||
| 251 | rootL2_10115709 | |||
| 252 | rootH1_10003256 | |||
| 253 | rootH1_10053582 | |||
| 254 | Ga0055536_1006243 | |||
| 255 | Ga0065165_1000152 | |||
| 256 | Ga0070683_100018073 | |||
| 257 | Ga0068868_100026497 | |||
| 258 | Ga0070660_100071879 | |||
| 259 | Ga0070689_100206325 | |||
| 260 | Ga0070669_100049976 | |||
| 261 | Ga0070675_100051768 | |||
| 262 | Ga0070671_100050883 | |||
| 263 | Ga0070674_100039278 | |||
| 264 | Ga0070659_100000042 | |||
| 265 | Ga0070662_100000030 | |||
| 266 | Ga0070662_100320253 | |||
| 267 | Ga0070706_100160897 | |||
| 268 | Ga0070679_100003601 | |||
| 269 | Ga0070684_100053533 | |||
| 270 | Ga0068853_100134200 | |||
| 271 | Ga0068853_100350409 | |||
| 272 | Ga0070686_100749852 | |||
| 273 | Ga0068855_100002946 | |||
| 274 | Ga0068855_100016255 | |||
| 275 | Ga0068855_100055062 | |||
| 276 | Ga0068855_100073379 | |||
| 277 | Ga0068855_100607690 | |||
| 278 | Ga0068854_100285510 | |||
| 279 | Ga0068856_100264658 | |||
| 280 | Ga0068852_100003276 | |||
| 281 | Ga0068870_10083996 | |||
| 282 | Ga0081539_10026610 | |||
| 283 | Ga0070717_10176409 | |||
| 284 | Ga0070712_100150166 | |||
| 285 | Ga0075366_10001501 | |||
| 286 | Ga0075366_10004451 | |||
| 287 | Ga0075366_10032051 | |||
| 288 | Ga0097621_100000093 | |||
| 289 | Ga0068871_100001507 | |||
| 290 | Ga0068871_100877672 | |||
| 291 | Ga0068865_100004049 | |||
| 292 | Ga0075436_100040512 | |||
| 293 | Ga0105240_10019302 | |||
| 294 | Ga0105240_10053952 | |||
| 295 | Ga0105240_10077511 | |||
| 296 | Ga0105240_11493722 | |||
| 297 | Ga0105245_10267294 | |||
| 298 | Ga0105241_10001783 | |||
| 299 | Ga0105241_10027877 | |||
| 300 | Ga0105241_10043115 | |||
| 301 | Ga0105241_10282151 | |||
| 302 | Ga0105237_10002994 | |||
| 303 | Ga0105237_10003874 | |||
| 304 | Ga0105237_10011780 | |||
| 305 | Ga0105237_10044222 | |||
| 306 | Ga0105237_10403689 | |||
| 307 | Ga0105239_10000228 | |||
| 308 | Ga0105239_10001327 | |||
| 309 | Ga0105239_10002117 | |||
| 310 | Ga0105239_10002733 | |||
| 311 | Ga0105239_10003320 | |||
| 312 | Ga0105239_10027951 | |||
| 313 | Ga0105239_10045570 | |||
| 314 | Ga0105239_10279553 | |||
| 315 | Ga0105239_10588907 | |||
| 316 | Ga0105239_10955061 | |||
| 317 | Ga0105246_10098692 | |||
| 318 | Ga0105246_10141567 | |||
| 319 | Ga0157373_10000205 | |||
| 320 | Ga0157373_10028284 | |||
| 321 | Ga0157371_10144264 | |||
| 322 | Ga0157371_10524690 | |||
| 323 | Ga0157370_10135849 | |||
| 324 | Ga0157369_10093531 | |||
| 325 | Ga0157374_10000203 | |||
| 326 | Ga0157374_10003381 | |||
| 327 | Ga0157378_10060096 | |||
| 328 | Ga0157378_10284620 | |||
| 329 | Ga0163162_10000399 | |||
| 330 | Ga0163162_10043071 | |||
| 331 | Ga0163162_10122372 | |||
| 332 | Ga0157372_10009141 | |||
| 333 | Ga0157372_10129449 | |||
| 334 | Ga0157372_10135560 | |||
| 335 | Ga0157372_10550738 | |||
| 336 | Ga0157375_10023479 | |||
| 337 | Ga0157375_10347329 | |||
| 338 | Ga0157376_10036075 | |||
| 339 | Ga0163161_10038608 | |||
| 340 | Ga0213872_10018815 | |||
| 341 | Ga0207427_100076 | |||
| 342 | Ga0209437_100008 | |||
| 343 | Ga0209437_100070 | |||
| 344 | Ga0209026_1000691 | |||
| 345 | Ga0209026_1007439 | |||
| 346 | Ga0209148_1027918 | |||
| 347 | Ga0209233_1000024 | |||
| 348 | Ga0209233_1014695 | |||
| 349 | Ga0209676_1001137 | |||
| 350 | Ga0207647_10000247 | |||
| 351 | Ga0207645_10003597 | |||
| 352 | Ga0207643_10250532 | |||
| 353 | Ga0207705_10000112 | |||
| 354 | Ga0207684_10027410 | |||
| 355 | Ga0207654_10005196 | |||
| 356 | Ga0207654_10016746 | |||
| 357 | Ga0207654_10033891 | |||
| 358 | Ga0207707_10010538 | |||
| 359 | Ga0207695_10000013 | |||
| 360 | Ga0207695_10015023 | |||
| 361 | Ga0207695_10112642 | |||
| 362 | Ga0207695_10395893 | |||
| 363 | Ga0207671_10002982 | |||
| 364 | Ga0207671_10007384 | |||
| 365 | Ga0207671_10031536 | |||
| 366 | Ga0207671_10048649 | |||
| 367 | Ga0207671_10128296 | |||
| 368 | Ga0207657_10082245 | |||
| 369 | Ga0207652_10020319 | |||
| 370 | Ga0207681_10243451 | |||
| 371 | Ga0207659_10076114 | |||
| 372 | Ga0207644_10048929 | |||
| 373 | Ga0207690_10000408 | |||
| 374 | Ga0207706_10000129 | |||
| 375 | Ga0207706_10406832 | |||
| 376 | Ga0207670_10202549 | |||
| 377 | Ga0207669_10025150 | |||
| 378 | Ga0207704_10000074 | |||
| 379 | Ga0207691_10208461 | |||
| 380 | Ga0207691_10258646 | |||
| 381 | Ga0207661_10044030 | |||
| 382 | Ga0207667_10000375 | |||
| 383 | Ga0207667_10003051 | |||
| 384 | Ga0207667_10025160 | |||
| 385 | Ga0207667_10085296 | |||
| 386 | Ga0207667_10089886 | |||
| 387 | Ga0207667_10092260 | |||
| 388 | Ga0207677_10019688 | |||
| 389 | Ga0207639_10022819 | |||
| 390 | Ga0207639_10092022 | |||
| 391 | Ga0207702_10000586 | |||
| 392 | Ga0207702_10022086 | |||
| 393 | Ga0207702_10057641 | |||
| 394 | Ga0207702_10418952 | |||
| 395 | Ga0207702_10772794 | |||
| 396 | Ga0207648_10013132 | |||
| 397 | Ga0207683_10290805 | |||
| 398 | Ga0207698_10006348 | |||
| 399 | Ga0268266_10000095 | |||
| 400 | Ga0307515_10000181 | |||
| 401 | Ga0307515_10000353 | |||
| 402 | Ga0307509_10096645 | |||
| 403 | Ga0307408_100000751 | |||
| 404 | Ga0307408_100009996 | |||
| 405 | Ga0307405_10002240 | |||
| 406 | Ga0307414_10388287 | |||
| 407 | Ga0316574_0110352 | |||
| 408 | Ga0395899_0000001 | |||
| 409 | Ga0395899_0001808 | |||
| 410 | Ga0395900_0000506 | |||
| 411 | Ga0395900_0002719 | |||
| 412 | Ga0395900_0010229 | |||
| 413 | Ga0395900_1189130 | |||
| 414 | Ga0395898_0056715 | |||
| 415 | Ga0395905_0000379 | |||
| 416 | Ga0395905_0001752 | |||
| 417 | Ga0395901_0001923 | |||
| 418 | Ga0395901_0003457 | |||
| 419 | Ga0436361_0829163 | |||
| 420 | Ga0436363_1299444 | |||
| 421 | Ga0439448_0141881 | |||
| 422 | Ga0495651_0096949 | |||
| 423 | Ga0495651_0197407 | |||
| 424 | Ga0495650_0000014 | |||
| 425 | Ga0495650_0148330 | |||
| 426 | Ga0495585_0000436 | |||
| 427 | Ga0495607_0191408 | |||
| 428 | Ga0495583_0074385 | |||
| 429 | Ga0495606_0000020 | |||
| 430 | Ga0495606_0013549 | |||
| 431 | Ga0495606_0072952 | |||
| 432 | Ga0495606_0151544 | |||
| 433 | Ga0495606_0206111 | |||
| 434 | Ga0495610_0003852 | |||
| 435 | Ga0495610_0138026 | |||
| 436 | Ga0495616_0005310 | |||
| 437 | Ga0495616_0047866 | |||
| 438 | Ga0495631_0018023 | |||
| 439 | Ga0495648_0009849 | |||
| 440 | Ga0495642_0213049 | |||
| 441 | Ga0495609_0000834 | |||
| 442 | Ga0495622_0046846 | |||
| 443 | Ga0495633_0000101 | |||
| 444 | Ga0495633_0047980 | |||
| 445 | Ga0495625_0000009 | |||
| 446 | Ga0495625_0000282 | |||
| 447 | Ga0495625_0009458 | |||
| 448 | Ga0495625_0032533 | |||
| 449 | Ga0495625_0144793 | |||
| 450 | Ga0495625_0285696 | |||
| 451 | Ga0495661_0061954 | |||
| 452 | Ga0495661_0088597 | |||
| 453 | Ga0495649_0000172 | |||
| 454 | Ga0495589_0031808 | |||
| 455 | Ga0495687_000516 | |||
| 456 | Ga0495687_043356 | |||
| 457 | Ga0495679_054209 | |||
| 458 | Ga0495686_0001273 | |||
| 459 | Ga0495686_0203345 | |||
| 460 | Ga0495682_0148573 | |||
| 461 | nmdc:mga0k408_1712_c1 | |||
| 462 | nmdc:mga0k408_186333_c1 | |||
| 463 | nmdc:mga0k408_33461_c1 | |||
| 464 | nmdc:mga0k408_3883_c1 | |||
| 465 | nmdc:mga08x19_64469_c1 | |||
| 466 | Ga0500635_0010472 | |||
| 467 | Ga0500650_0198246 | |||
| 468 | Ga0500618_000023 | |||
| 469 | Ga0500618_029309 | |||
| 470 | Ga0500616_0175534 | |||
| 471 | Ga0500624_000311 | |||
| 472 | 2522548533 | |||
| 473 | 2599477038 | |||
| 474 | 2839991410 | |||
| 475 | 2884937990 | |||
| 476 | 2919442336 | |||
| 477 | 2928078951 | |||
| 478 | 2928148682 | |||
| 479 | 2932085600 | |||
| 480 | 2977236869 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.9569 | 18 | 199 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.9561 | 15 | 199 |
| 4heb-assembly1.cif.gz_B | the crystal structure of maf protein of bacillus subtilis | 0.9529 | 17 | 200 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.9462 | 15 | 199 |
| 4p0e-assembly1.cif.gz_A | yhde e33a (p212121 space group) | 0.943 | 19 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9569 | 18 | 199 | 3.90.950.10 |
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9418 | 19 | 200 | 3.90.950.10 |
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9417 | 18 | 199 | 3.90.950.10 |
| af_Q8IEH6_20_257_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9305 | 19 | 200 | 3.90.950.10 |
| af_Q86BM0_10_204_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9255 | 16 | 200 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1BHG2-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9891 | 15 | 199 |
GO:0005737
GO:0009117 GO:0036218 GO:0036221 GO:0106379 |
| AF-A0A7Y2DH52-F1-model_v4 | Septum formation inhibitor Maf | 0.9857 | 89 | 202 |
GO:0047429
|
| AF-A0A6B3PQR3-F1-model_v4 | deleted | 0.9833 | 15 | 200 |
|
| AF-A0A4R7K2K1-F1-model_v4 | dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9831 | 17 | 200 |
GO:0005737
GO:0009117 GO:0036218 GO:0036221 GO:0106379 |
| AF-A0A4Q3ATR2-F1-model_v4 | deleted | 0.9797 | 18 | 200 |
|