F353154

General Info

Members Datasets Scaffolds Average Seq Length
240 144 480 193

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0000542|Ga0495585_0000542_30694_31383
Length 229
Sequence VIPTQTLPGREGFKNKFTSIMASSTTNEIQKKVSPSGGDLEGAPPVILASKSPRRQELLRLMDIDFRVVLKDVDESYPEGLSPQEVALHIARKKAEAFDETIGDEVVLTADTIVCIDGLILGKPESRTDAIEMLQRLSGRVHQVITGVCLLHNGQYNNFYDLTEVFFRKLSDAEISNYVDKYQPLDKAGSYGIQELIGLIGIERIEGSYTNVVGLPTEKVYAQLGALNR

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
136 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
137 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
138 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
139 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
140 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
141 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
142 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
143 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
144 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 0
Rhizoplane 0.42
Rhizosphere 82.08
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0000542 3300046492 Bacteria 35718
2 JGI24737J22298_10070533 3300001990 Bacteria 1044
3 JGI24735J21928_10000006 3300002067 Bacteria 339303
4 JGI25162J39368_1000046 3300002737 Bacteria 169695
5 JGI25164J39214_1001974 3300002772 Bacteria 3701
6 JGI25165J46597_1001297 3300003214 Bacteria 14423
7 rootH1_10038987 3300003316 Bacteria 20037
8 rootH1_10057206 3300003316 Bacteria 2804
9 rootH1_10185428 3300003316 Unclassified 1643
10 rootH2_10006566 3300003320 Bacteria 99379
11 rootL2_10115709 3300003322 Bacteria 1661
12 rootH1_10003256 3300003323 Bacteria 53834
13 rootH1_10053582 3300003323 Bacteria 3594
14 Ga0055536_1006243 3300003781 Bacteria 5619
15 Ga0065165_1000152 3300005262 Bacteria 120418
16 Ga0070683_100018073 3300005329 Bacteria 6238
17 Ga0068868_100026497 3300005338 Bacteria 4419
18 Ga0070660_100071879 3300005339 Bacteria 2702
19 Ga0070689_100206325 3300005340 Bacteria 1607
20 Ga0070669_100049976 3300005353 Unclassified 3054
21 Ga0070675_100051768 3300005354 Bacteria 3375
22 Ga0070671_100050883 3300005355 Bacteria 3446
23 Ga0070674_100039278 3300005356 Bacteria 3195
24 Ga0070659_100000042 3300005366 Bacteria 103672
25 Ga0070662_100000030 3300005457 Bacteria 81418
26 Ga0070662_100320253 3300005457 Bacteria 1264
27 Ga0070706_100160897 3300005467 Bacteria 2096
28 Ga0070679_100003601 3300005530 Bacteria 14152
29 Ga0070684_100053533 3300005535 Bacteria 3514
30 Ga0068853_100134200 3300005539 Bacteria 2218
31 Ga0068853_100350409 3300005539 Bacteria 1373
32 Ga0070686_100749852 3300005544 Unclassified 783
33 Ga0068855_100002946 3300005563 Bacteria 20803
34 Ga0068855_100016255 3300005563 Bacteria 8949
35 Ga0068855_100055062 3300005563 Bacteria 4673
36 Ga0068855_100073379 3300005563 Bacteria 3976
37 Ga0068855_100607690 3300005563 Bacteria 1178
38 Ga0068854_100285510 3300005578 Bacteria 1330
39 Ga0068856_100264658 3300005614 Bacteria 1735
40 Ga0068852_100003276 3300005616 Bacteria 11304
41 Ga0068870_10083996 3300005840 Bacteria 1766
42 Ga0081539_10026610 3300005985 Bacteria 3685
43 Ga0070717_10176409 3300006028 Bacteria 1861
44 Ga0070712_100150166 3300006175 Bacteria 1788
45 Ga0075366_10001501 3300006195 Bacteria 11652
46 Ga0075366_10004451 3300006195 Bacteria 7521
47 Ga0075366_10032051 3300006195 Bacteria 3094
48 Ga0097621_100000093 3300006237 Bacteria 49437
49 Ga0068871_100001507 3300006358 Bacteria 15615
50 Ga0068871_100877672 3300006358 Bacteria 830
51 Ga0068865_100004049 3300006881 Bacteria 8801
52 Ga0075436_100040512 3300006914 Bacteria 3215
53 Ga0105240_10019302 3300009093 Bacteria 9110
54 Ga0105240_10053952 3300009093 Bacteria 5041
55 Ga0105240_10077511 3300009093 Bacteria 4094
56 Ga0105240_11493722 3300009093 Bacteria 709
57 Ga0105245_10267294 3300009098 Bacteria 1666
58 Ga0105241_10001783 3300009174 Bacteria 16342
59 Ga0105241_10027877 3300009174 Bacteria 4206
60 Ga0105241_10043115 3300009174 Bacteria 3416
61 Ga0105241_10282151 3300009174 Bacteria 1419
62 Ga0105237_10002994 3300009545 Bacteria 20410
63 Ga0105237_10003874 3300009545 Bacteria 17567
64 Ga0105237_10011780 3300009545 Bacteria 9252
65 Ga0105237_10044222 3300009545 Bacteria 4484
66 Ga0105237_10403689 3300009545 Bacteria 1371
67 Ga0105239_10000228 3300010375 Bacteria 82820
68 Ga0105239_10001327 3300010375 Bacteria 33331
69 Ga0105239_10002117 3300010375 Bacteria 25632
70 Ga0105239_10002733 3300010375 Bacteria 22146
71 Ga0105239_10003320 3300010375 Bacteria 19805
72 Ga0105239_10027951 3300010375 Bacteria 6206
73 Ga0105239_10045570 3300010375 Bacteria 4807
74 Ga0105239_10279553 3300010375 Bacteria 1879
75 Ga0105239_10588907 3300010375 Bacteria 1268
76 Ga0105239_10955061 3300010375 Unclassified 985
77 Ga0105246_10098692 3300011119 Bacteria 2122
78 Ga0105246_10141567 3300011119 Bacteria 1809
79 Ga0157373_10000205 3300013100 Bacteria 48796
80 Ga0157373_10028284 3300013100 Bacteria 4044
81 Ga0157371_10144264 3300013102 Bacteria 1696
82 Ga0157371_10524690 3300013102 Bacteria 876
83 Ga0157370_10135849 3300013104 Bacteria 2292
84 Ga0157369_10093531 3300013105 Bacteria 3209
85 Ga0157374_10000203 3300013296 Bacteria 54699
86 Ga0157374_10003381 3300013296 Bacteria 13408
87 Ga0157378_10060096 3300013297 Bacteria 3392
88 Ga0157378_10284620 3300013297 Bacteria 1595
89 Ga0163162_10000399 3300013306 Bacteria 39845
90 Ga0163162_10043071 3300013306 Bacteria 4519
91 Ga0163162_10122372 3300013306 Unclassified 2707
92 Ga0157372_10009141 3300013307 Bacteria 10525
93 Ga0157372_10129449 3300013307 Bacteria 2903
94 Ga0157372_10135560 3300013307 Bacteria 2835
95 Ga0157372_10550738 3300013307 Bacteria 1345
96 Ga0157375_10023479 3300013308 Bacteria 5692
97 Ga0157375_10347329 3300013308 Bacteria 1649
98 Ga0157376_10036075 3300014969 Bacteria 4003
99 Ga0163161_10038608 3300017792 Bacteria 3425
100 Ga0213872_10018815 3300021361 Bacteria 3183
101 Ga0207427_100076 3300025231 Bacteria 149885
102 Ga0209437_100008 3300025233 Bacteria 921142
103 Ga0209437_100070 3300025233 Bacteria 306718
104 Ga0209026_1000691 3300025250 Bacteria 20158
105 Ga0209026_1007439 3300025250 Bacteria 2464
106 Ga0209148_1027918 3300025254 Bacteria 864
107 Ga0209233_1000024 3300025261 Bacteria 695418
108 Ga0209233_1014695 3300025261 Bacteria 2199
109 Ga0209676_1001137 3300025292 Bacteria 29129
110 Ga0207647_10000247 3300025904 Bacteria 44109
111 Ga0207645_10003597 3300025907 Bacteria 11728
112 Ga0207643_10250532 3300025908 Unclassified 1091
113 Ga0207705_10000112 3300025909 Bacteria 90821
114 Ga0207684_10027410 3300025910 Bacteria 4855
115 Ga0207654_10005196 3300025911 Bacteria 6569
116 Ga0207654_10016746 3300025911 Bacteria 3820
117 Ga0207654_10033891 3300025911 Bacteria 2834
118 Ga0207707_10010538 3300025912 Bacteria 8026
119 Ga0207695_10000013 3300025913 Bacteria 821265
120 Ga0207695_10015023 3300025913 Bacteria 9136
121 Ga0207695_10112642 3300025913 Bacteria 2698
122 Ga0207695_10395893 3300025913 Bacteria 1266
123 Ga0207671_10002982 3300025914 Bacteria 17364
124 Ga0207671_10007384 3300025914 Bacteria 9546
125 Ga0207671_10031536 3300025914 Bacteria 3949
126 Ga0207671_10048649 3300025914 Bacteria 3138
127 Ga0207671_10128296 3300025914 Bacteria 1945
128 Ga0207657_10082245 3300025919 Bacteria 2703
129 Ga0207652_10020319 3300025921 Bacteria 5466
130 Ga0207681_10243451 3300025923 Bacteria 1401
131 Ga0207659_10076114 3300025926 Bacteria 2466
132 Ga0207644_10048929 3300025931 Bacteria 3025
133 Ga0207690_10000408 3300025932 Bacteria 28225
134 Ga0207706_10000129 3300025933 Bacteria 81280
135 Ga0207706_10406832 3300025933 Bacteria 1179
136 Ga0207670_10202549 3300025936 Bacteria 1509
137 Ga0207669_10025150 3300025937 Bacteria 3212
138 Ga0207704_10000074 3300025938 Bacteria 61994
139 Ga0207691_10208461 3300025940 Bacteria 1699
140 Ga0207691_10258646 3300025940 Unclassified 1501
141 Ga0207661_10044030 3300025944 Bacteria 3525
142 Ga0207667_10000375 3300025949 Bacteria 60547
143 Ga0207667_10003051 3300025949 Bacteria 20783
144 Ga0207667_10025160 3300025949 Bacteria 6522
145 Ga0207667_10085296 3300025949 Bacteria 3270
146 Ga0207667_10089886 3300025949 Bacteria 3173
147 Ga0207667_10092260 3300025949 Bacteria 3128
148 Ga0207677_10019688 3300026023 Bacteria 4082
149 Ga0207639_10022819 3300026041 Bacteria 4512
150 Ga0207639_10092022 3300026041 Bacteria 2430
151 Ga0207702_10000586 3300026078 Bacteria 40370
152 Ga0207702_10022086 3300026078 Bacteria 5272
153 Ga0207702_10057641 3300026078 Bacteria 3302
154 Ga0207702_10418952 3300026078 Bacteria 1295
155 Ga0207702_10772794 3300026078 Bacteria 949
156 Ga0207648_10013132 3300026089 Bacteria 7719
157 Ga0207683_10290805 3300026121 Bacteria 1494
158 Ga0207698_10006348 3300026142 Bacteria 7367
159 Ga0268266_10000095 3300028379 Bacteria 186169
160 Ga0307515_10000181 3300028794 Bacteria 154316
161 Ga0307515_10000353 3300028794 Bacteria 112876
162 Ga0307509_10096645 3300031507 Bacteria 3005
163 Ga0307408_100000751 3300031548 Bacteria 26176
164 Ga0307408_100009996 3300031548 Bacteria 6252
165 Ga0307405_10002240 3300031731 Bacteria 8462
166 Ga0307414_10388287 3300032004 Bacteria 1209
167 Ga0316574_0110352 3300035398 Bacteria 1763
168 Ga0395899_0000001 3300037312 Bacteria 1750322
169 Ga0395899_0001808 3300037312 Bacteria 17704
170 Ga0395900_0000506 3300037418 Bacteria 54890
171 Ga0395900_0002719 3300037418 Bacteria 19337
172 Ga0395900_0010229 3300037418 Bacteria 9595
173 Ga0395900_1189130 3300037418 Unclassified 678
174 Ga0395898_0056715 3300037466 Bacteria 3818
175 Ga0395905_0000379 3300037471 Bacteria 63171
176 Ga0395905_0001752 3300037471 Bacteria 25335
177 Ga0395901_0001923 3300038443 Bacteria 21386
178 Ga0395901_0003457 3300038443 Bacteria 15913
179 Ga0436361_0829163 3300039447 Bacteria 6815
180 Ga0436363_1299444 3300039450 Bacteria 693
181 Ga0439448_0141881 3300042005 Bacteria 831
182 Ga0495651_0096949 3300046462 Bacteria 2203
183 Ga0495651_0197407 3300046462 Bacteria 1411
184 Ga0495650_0000014 3300046471 Bacteria 581606
185 Ga0495650_0148330 3300046471 Bacteria 844
186 Ga0495585_0000436 3300046492 Bacteria 39946
187 Ga0495607_0191408 3300046501 Bacteria 1019
188 Ga0495583_0074385 3300046506 Bacteria 1487
189 Ga0495606_0000020 3300046507 Bacteria 274490
190 Ga0495606_0013549 3300046507 Bacteria 6432
191 Ga0495606_0072952 3300046507 Bacteria 2155
192 Ga0495606_0151544 3300046507 Bacteria 1360
193 Ga0495606_0206111 3300046507 Bacteria 1117
194 Ga0495610_0003852 3300046512 Bacteria 11404
195 Ga0495610_0138026 3300046512 Bacteria 1052
196 Ga0495616_0005310 3300046513 Bacteria 7941
197 Ga0495616_0047866 3300046513 Bacteria 2151
198 Ga0495631_0018023 3300046518 Bacteria 3331
199 Ga0495648_0009849 3300046524 Bacteria 7344
200 Ga0495642_0213049 3300046528 Bacteria 843
201 Ga0495609_0000834 3300046538 Bacteria 22885
202 Ga0495622_0046846 3300046557 Bacteria 2009
203 Ga0495633_0000101 3300046558 Bacteria 116147
204 Ga0495633_0047980 3300046558 Bacteria 2017
205 Ga0495625_0000009 3300046660 Bacteria 404954
206 Ga0495625_0000282 3300046660 Bacteria 79268
207 Ga0495625_0009458 3300046660 Bacteria 8157
208 Ga0495625_0032533 3300046660 Bacteria 3865
209 Ga0495625_0144793 3300046660 Bacteria 1600
210 Ga0495625_0285696 3300046660 Unclassified 1060
211 Ga0495661_0061954 3300046665 Bacteria 2218
212 Ga0495661_0088597 3300046665 Bacteria 1766
213 Ga0495649_0000172 3300046694 Bacteria 56537
214 Ga0495589_0031808 3300046794 Bacteria 2656
215 Ga0495687_000516 3300047443 Bacteria 46369
216 Ga0495687_043356 3300047443 Bacteria 1961
217 Ga0495679_054209 3300047446 Bacteria 1195
218 Ga0495686_0001273 3300047472 Bacteria 28543
219 Ga0495686_0203345 3300047472 Bacteria 1135
220 Ga0495682_0148573 3300049460 Bacteria 836
221 nmdc:mga0k408_1712_c1 3300050493 Bacteria 11799
222 nmdc:mga0k408_186333_c1 3300050493 Bacteria 1238
223 nmdc:mga0k408_33461_c1 3300050493 Bacteria 2940
224 nmdc:mga0k408_3883_c1 3300050493 Bacteria 7922
225 nmdc:mga08x19_64469_c1 3300050514 Bacteria 2378
226 Ga0500635_0010472 3300053080 Bacteria 2606
227 Ga0500650_0198246 3300053098 Bacteria 915
228 Ga0500618_000023 3300053125 Bacteria 152444
229 Ga0500618_029309 3300053125 Bacteria 1299
230 Ga0500616_0175534 3300053153 Unclassified 969
231 Ga0500624_000311 3300053157 Bacteria 16698
232 2522548533 2522125168 Bacteria 7376607
233 2599477038 2599185184 Bacteria 6430550
234 2839991410 2839989709 Bacteria 3773432
235 2884937990 2884933994 Bacteria 4535041
236 2919442336 2919437846 Bacteria 6199444
237 2928078951 2928078545 Bacteria 6534839
238 2928148682 2928147474 Bacteria 6512076
239 2932085600 2932082852 Bacteria 6563563
240 2977236869 2977232053 Bacteria 5485925
241 Ga0495585_0000542
242 JGI24737J22298_10070533
243 JGI24735J21928_10000006
244 JGI25162J39368_1000046
245 JGI25164J39214_1001974
246 JGI25165J46597_1001297
247 rootH1_10038987
248 rootH1_10057206
249 rootH1_10185428
250 rootH2_10006566
251 rootL2_10115709
252 rootH1_10003256
253 rootH1_10053582
254 Ga0055536_1006243
255 Ga0065165_1000152
256 Ga0070683_100018073
257 Ga0068868_100026497
258 Ga0070660_100071879
259 Ga0070689_100206325
260 Ga0070669_100049976
261 Ga0070675_100051768
262 Ga0070671_100050883
263 Ga0070674_100039278
264 Ga0070659_100000042
265 Ga0070662_100000030
266 Ga0070662_100320253
267 Ga0070706_100160897
268 Ga0070679_100003601
269 Ga0070684_100053533
270 Ga0068853_100134200
271 Ga0068853_100350409
272 Ga0070686_100749852
273 Ga0068855_100002946
274 Ga0068855_100016255
275 Ga0068855_100055062
276 Ga0068855_100073379
277 Ga0068855_100607690
278 Ga0068854_100285510
279 Ga0068856_100264658
280 Ga0068852_100003276
281 Ga0068870_10083996
282 Ga0081539_10026610
283 Ga0070717_10176409
284 Ga0070712_100150166
285 Ga0075366_10001501
286 Ga0075366_10004451
287 Ga0075366_10032051
288 Ga0097621_100000093
289 Ga0068871_100001507
290 Ga0068871_100877672
291 Ga0068865_100004049
292 Ga0075436_100040512
293 Ga0105240_10019302
294 Ga0105240_10053952
295 Ga0105240_10077511
296 Ga0105240_11493722
297 Ga0105245_10267294
298 Ga0105241_10001783
299 Ga0105241_10027877
300 Ga0105241_10043115
301 Ga0105241_10282151
302 Ga0105237_10002994
303 Ga0105237_10003874
304 Ga0105237_10011780
305 Ga0105237_10044222
306 Ga0105237_10403689
307 Ga0105239_10000228
308 Ga0105239_10001327
309 Ga0105239_10002117
310 Ga0105239_10002733
311 Ga0105239_10003320
312 Ga0105239_10027951
313 Ga0105239_10045570
314 Ga0105239_10279553
315 Ga0105239_10588907
316 Ga0105239_10955061
317 Ga0105246_10098692
318 Ga0105246_10141567
319 Ga0157373_10000205
320 Ga0157373_10028284
321 Ga0157371_10144264
322 Ga0157371_10524690
323 Ga0157370_10135849
324 Ga0157369_10093531
325 Ga0157374_10000203
326 Ga0157374_10003381
327 Ga0157378_10060096
328 Ga0157378_10284620
329 Ga0163162_10000399
330 Ga0163162_10043071
331 Ga0163162_10122372
332 Ga0157372_10009141
333 Ga0157372_10129449
334 Ga0157372_10135560
335 Ga0157372_10550738
336 Ga0157375_10023479
337 Ga0157375_10347329
338 Ga0157376_10036075
339 Ga0163161_10038608
340 Ga0213872_10018815
341 Ga0207427_100076
342 Ga0209437_100008
343 Ga0209437_100070
344 Ga0209026_1000691
345 Ga0209026_1007439
346 Ga0209148_1027918
347 Ga0209233_1000024
348 Ga0209233_1014695
349 Ga0209676_1001137
350 Ga0207647_10000247
351 Ga0207645_10003597
352 Ga0207643_10250532
353 Ga0207705_10000112
354 Ga0207684_10027410
355 Ga0207654_10005196
356 Ga0207654_10016746
357 Ga0207654_10033891
358 Ga0207707_10010538
359 Ga0207695_10000013
360 Ga0207695_10015023
361 Ga0207695_10112642
362 Ga0207695_10395893
363 Ga0207671_10002982
364 Ga0207671_10007384
365 Ga0207671_10031536
366 Ga0207671_10048649
367 Ga0207671_10128296
368 Ga0207657_10082245
369 Ga0207652_10020319
370 Ga0207681_10243451
371 Ga0207659_10076114
372 Ga0207644_10048929
373 Ga0207690_10000408
374 Ga0207706_10000129
375 Ga0207706_10406832
376 Ga0207670_10202549
377 Ga0207669_10025150
378 Ga0207704_10000074
379 Ga0207691_10208461
380 Ga0207691_10258646
381 Ga0207661_10044030
382 Ga0207667_10000375
383 Ga0207667_10003051
384 Ga0207667_10025160
385 Ga0207667_10085296
386 Ga0207667_10089886
387 Ga0207667_10092260
388 Ga0207677_10019688
389 Ga0207639_10022819
390 Ga0207639_10092022
391 Ga0207702_10000586
392 Ga0207702_10022086
393 Ga0207702_10057641
394 Ga0207702_10418952
395 Ga0207702_10772794
396 Ga0207648_10013132
397 Ga0207683_10290805
398 Ga0207698_10006348
399 Ga0268266_10000095
400 Ga0307515_10000181
401 Ga0307515_10000353
402 Ga0307509_10096645
403 Ga0307408_100000751
404 Ga0307408_100009996
405 Ga0307405_10002240
406 Ga0307414_10388287
407 Ga0316574_0110352
408 Ga0395899_0000001
409 Ga0395899_0001808
410 Ga0395900_0000506
411 Ga0395900_0002719
412 Ga0395900_0010229
413 Ga0395900_1189130
414 Ga0395898_0056715
415 Ga0395905_0000379
416 Ga0395905_0001752
417 Ga0395901_0001923
418 Ga0395901_0003457
419 Ga0436361_0829163
420 Ga0436363_1299444
421 Ga0439448_0141881
422 Ga0495651_0096949
423 Ga0495651_0197407
424 Ga0495650_0000014
425 Ga0495650_0148330
426 Ga0495585_0000436
427 Ga0495607_0191408
428 Ga0495583_0074385
429 Ga0495606_0000020
430 Ga0495606_0013549
431 Ga0495606_0072952
432 Ga0495606_0151544
433 Ga0495606_0206111
434 Ga0495610_0003852
435 Ga0495610_0138026
436 Ga0495616_0005310
437 Ga0495616_0047866
438 Ga0495631_0018023
439 Ga0495648_0009849
440 Ga0495642_0213049
441 Ga0495609_0000834
442 Ga0495622_0046846
443 Ga0495633_0000101
444 Ga0495633_0047980
445 Ga0495625_0000009
446 Ga0495625_0000282
447 Ga0495625_0009458
448 Ga0495625_0032533
449 Ga0495625_0144793
450 Ga0495625_0285696
451 Ga0495661_0061954
452 Ga0495661_0088597
453 Ga0495649_0000172
454 Ga0495589_0031808
455 Ga0495687_000516
456 Ga0495687_043356
457 Ga0495679_054209
458 Ga0495686_0001273
459 Ga0495686_0203345
460 Ga0495682_0148573
461 nmdc:mga0k408_1712_c1
462 nmdc:mga0k408_186333_c1
463 nmdc:mga0k408_33461_c1
464 nmdc:mga0k408_3883_c1
465 nmdc:mga08x19_64469_c1
466 Ga0500635_0010472
467 Ga0500650_0198246
468 Ga0500618_000023
469 Ga0500618_029309
470 Ga0500616_0175534
471 Ga0500624_000311
472 2522548533
473 2599477038
474 2839991410
475 2884937990
476 2919442336
477 2928078951
478 2928148682
479 2932085600
480 2977236869

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

45

227

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9569 18 199
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9561 15 199
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9529 17 200
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9462 15 199
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.943 19 200
ID Description Score Start End Superfamily
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9569 18 199 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9418 19 200 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9417 18 199 3.90.950.10
af_Q8IEH6_20_257_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9305 19 200 3.90.950.10
af_Q86BM0_10_204_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9255 16 200 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A3C1BHG2-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9891 15 199 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379
AF-A0A7Y2DH52-F1-model_v4 Septum formation inhibitor Maf 0.9857 89 202 GO:0047429
AF-A0A6B3PQR3-F1-model_v4 deleted 0.9833 15 200
AF-A0A4R7K2K1-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9831 17 200 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379
AF-A0A4Q3ATR2-F1-model_v4 deleted 0.9797 18 200

Map