F353303

General Info

Members Datasets Scaffolds Average Seq Length
240 181 480 330

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0021485|Ga0500641_0021485_104_1225
Length 373
Sequence LKGQRTPSERRSGLPVGSFQDDNALVSRRITGNGMLMGDENKRGVLLQQRILPFPTSISAEAQSALRRLVSEDGIPLNSLHAMPAAEDHAAWMSVKAAVDAQYAAAVAGLAGTLRSSVETIQVDDTTIHIATPDAPVRPDCAYLDLHGGALVFGGGDACRAGARMQADQHGVRCYGVDYRMPPQHPYPAALDDCLTTYRYMLERHAPENIVIGGRSSGGNLAAAMALRARDEGLPLPAGLVLLSPEVDLTESGDSFEANRMVDVVLPSSLMSTNRMYANGADLAHPYLSPLFGDLRGLPTTFLQTGTRDLFLSNAVRMHRRLLGAGVRAELHVFEAMPHGGFMGGTPEDRELSEEVGRFVRARWRTPTGKGEM

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
24 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
25 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
26 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
27 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
28 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
29 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
33 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
34 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
35 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
49 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
50 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
51 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
52 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
53 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
54 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
55 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
56 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
57 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
58 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
68 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
69 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
118 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
119 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
120 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
127 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
128 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
129 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
130 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
131 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
132 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
133 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
134 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
135 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
136 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
137 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
138 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
139 2643221558 Rhizobium sp. Root149 Isolate Unclassified
140 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
141 2643221719 Rhizobium sp. Root274 Isolate Unclassified
142 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
143 2734482264 Dyella sp. AD052 Isolate Unclassified
144 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
145 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
146 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
147 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
148 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
149 2818991452 Burkholderia cepacia 561 Isolate Unclassified
150 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
151 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
152 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
153 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
154 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
155 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
156 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
157 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
158 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
159 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
160 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
161 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
162 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
163 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
164 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
165 2919085039 Luteibacter sp. 1214 Isolate Unclassified
166 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
167 2928170801 Burkholderia sp. 572 Isolate Unclassified
168 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
169 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
170 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
171 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
172 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
173 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
174 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
175 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
176 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
177 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
178 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
179 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
180 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
181 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.67
Metatranscriptomes 0
Isolates 23.33

Biome Distribution

Category Percentage (%)
Aerial Root 1.25
Bulb 0
Endosphere 15
Nodule 4.58
Rhizoplane 2.92
Rhizosphere 54.58
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0021485 3300053096 Bacteria 2461
2 JGI25155J39150_1000040 3300002704 Bacteria 89420
3 JGI25156J39149_1000051 3300002705 Bacteria 89412
4 JGI25154J39366_1000079 3300002738 Bacteria 89420
5 JGI25157J39369_1000168 3300002741 Bacteria 55097
6 Ga0055527_1004690 3300003760 Bacteria 1847
7 Ga0055526_1000009 3300003771 Bacteria 257259
8 Ga0055524_1010631 3300003775 Bacteria 3651
9 Ga0055528_1000219 3300003790 Bacteria 48163
10 Ga0055530_10011461 3300003791 Bacteria 3182
11 Ga0065704_10162863 3300005289 Bacteria 1342
12 Ga0070670_100000133 3300005331 Bacteria 69691
13 Ga0075368_10031555 3300006042 Bacteria 2055
14 Ga0075362_10032987 3300006177 Bacteria 2250
15 Ga0075366_10001244 3300006195 Bacteria 12652
16 Ga0075370_10001967 3300006353 Bacteria 9292
17 Ga0105250_10000145 3300009092 Bacteria 62334
18 Ga0105243_10334608 3300009148 Bacteria 1384
19 Ga0157373_10048198 3300013100 Bacteria 3038
20 Ga0157371_10000619 3300013102 Bacteria 42290
21 Ga0157371_10003124 3300013102 Bacteria 15308
22 Ga0157370_10000661 3300013104 Bacteria 42855
23 Ga0157370_10030874 3300013104 Bacteria 5248
24 Ga0157370_10051445 3300013104 Bacteria 3935
25 Ga0157375_10000050 3300013308 Bacteria 134913
26 Ga0182005_1000019 3300015265 Bacteria 296232
27 Ga0183363_1005 3300015690 Bacteria 403020
28 Ga0163161_10009209 3300017792 Bacteria 6827
29 Ga0163161_10089997 3300017792 Bacteria 2270
30 Ga0228711_1008201 3300022739 Bacteria 14772
31 Ga0228710_1004154 3300022740 Bacteria 22854
32 Ga0209435_100052 3300025206 Bacteria 89472
33 Ga0209566_100384 3300025225 Bacteria 35773
34 Ga0209672_104165 3300025228 Bacteria 2756
35 Ga0209147_100145 3300025229 Bacteria 106552
36 Ga0209646_1000163 3300025246 Bacteria 89472
37 Ga0209026_1000190 3300025250 Bacteria 89460
38 Ga0209759_1000213 3300025256 Bacteria 89473
39 Ga0209673_1000005 3300025273 Bacteria 692788
40 Ga0209025_1002147 3300025294 Bacteria 22059
41 Ga0209564_1000069 3300025295 Bacteria 303332
42 Ga0209564_1028957 3300025295 Bacteria 1755
43 Ga0209050_1000682 3300025298 Bacteria 51096
44 Ga0209256_1001571 3300025299 Bacteria 22472
45 Ga0207696_1000002 3300025711 Bacteria 1098043
46 Ga0207655_1014076 3300025728 Bacteria 4544
47 Ga0207650_10000592 3300025925 Bacteria 29057
48 Ga0207698_10283479 3300026142 Bacteria 1534
49 Ga0209371_1001295 3300027312 Bacteria 17563
50 Ga0209813_10016096 3300027866 Bacteria 2036
51 Ga0268256_1000028 3300030500 Bacteria 433179
52 Ga0307412_10000301 3300031911 Bacteria 31415
53 Ga0495617_004155 3300046452 Bacteria 5305
54 Ga0495591_000151 3300046458 Bacteria 73402
55 Ga0495591_016073 3300046458 Unclassified 2620
56 Ga0495638_0000386 3300046460 Bacteria 54523
57 Ga0495653_0007075 3300046463 Bacteria 9202
58 Ga0495650_0001543 3300046471 Bacteria 21838
59 Ga0495605_0000054 3300046474 Bacteria 157560
60 Ga0495584_0002373 3300046491 Bacteria 10710
61 Ga0495585_0030945 3300046492 Bacteria 3042
62 Ga0495596_0001701 3300046500 Bacteria 12413
63 Ga0495596_0005992 3300046500 Bacteria 5670
64 Ga0495607_0000002 3300046501 Bacteria 414833
65 Ga0495607_0001715 3300046501 Bacteria 18792
66 Ga0495607_0001999 3300046501 Bacteria 17153
67 Ga0495607_0002220 3300046501 Bacteria 16077
68 Ga0495607_0105985 3300046501 Bacteria 1497
69 Ga0495583_0002038 3300046506 Bacteria 18400
70 Ga0495606_0000300 3300046507 Bacteria 85461
71 Ga0495606_0000794 3300046507 Bacteria 48239
72 Ga0495606_0001251 3300046507 Bacteria 35455
73 Ga0495606_0071431 3300046507 Bacteria 2185
74 Ga0495610_0002496 3300046512 Bacteria 15375
75 Ga0495610_0007600 3300046512 Bacteria 7177
76 Ga0495610_0023282 3300046512 Bacteria 3371
77 Ga0495616_0034525 3300046513 Bacteria 2627
78 Ga0495620_0000136 3300046515 Bacteria 60464
79 Ga0495620_0000484 3300046515 Bacteria 25815
80 Ga0495620_0030174 3300046515 Bacteria 2500
81 Ga0495630_0006110 3300046517 Bacteria 8536
82 Ga0495632_0001029 3300046519 Bacteria 24117
83 Ga0495632_0003985 3300046519 Bacteria 10218
84 Ga0495637_0000092 3300046520 Bacteria 70294
85 Ga0495643_0000492 3300046522 Bacteria 49769
86 Ga0495643_0004143 3300046522 Bacteria 10307
87 Ga0495644_0000858 3300046523 Bacteria 12550
88 Ga0495648_0000713 3300046524 Bacteria 35458
89 Ga0495648_0001918 3300046524 Bacteria 19812
90 Ga0495648_0098209 3300046524 Bacteria 1622
91 Ga0495663_0000035 3300046525 Bacteria 72251
92 Ga0495666_0003268 3300046526 Bacteria 8177
93 Ga0495665_0005019 3300046531 Bacteria 7134
94 Ga0495640_0114057 3300046533 Bacteria 1762
95 Ga0495611_0000530 3300046648 Bacteria 22502
96 Ga0495625_0000322 3300046660 Bacteria 72914
97 Ga0495625_0002661 3300046660 Bacteria 19020
98 Ga0495661_0000001 3300046665 Bacteria 898372
99 Ga0495661_0000033 3300046665 Bacteria 168033
100 Ga0495661_0079882 3300046665 Bacteria 1889
101 Ga0495623_0001620 3300046679 Bacteria 15120
102 Ga0495646_0006062 3300046680 Bacteria 7668
103 Ga0495613_0013925 3300046689 Bacteria 5968
104 Ga0495624_0007641 3300046690 Bacteria 7590
105 Ga0495670_0001019 3300046691 Bacteria 13614
106 Ga0495671_0001312 3300046692 Bacteria 16904
107 Ga0495671_0005914 3300046692 Bacteria 7113
108 Ga0495649_0001308 3300046694 Bacteria 19038
109 Ga0495649_0009642 3300046694 Bacteria 5724
110 Ga0495649_0018342 3300046694 Bacteria 3938
111 Ga0495589_0000763 3300046794 Bacteria 20550
112 Ga0495589_0133508 3300046794 Bacteria 1191
113 Ga0495600_0202501 3300046809 Bacteria 1274
114 Ga0495581_0020656 3300047315 Bacteria 3819
115 Ga0495674_0039781 3300047319 Bacteria 4211
116 Ga0495672_0001648 3300047320 Bacteria 21695
117 Ga0495672_0052881 3300047320 Bacteria 2383
118 Ga0495676_0039602 3300047321 Bacteria 3901
119 Ga0495680_0014578 3300047322 Bacteria 6804
120 Ga0495687_000202 3300047443 Bacteria 84886
121 Ga0495687_078788 3300047443 Bacteria 1297
122 Ga0495675_0001643 3300047444 Bacteria 13408
123 Ga0495679_001008 3300047446 Bacteria 17324
124 Ga0495673_0001553 3300047469 Bacteria 17990
125 Ga0495673_0036943 3300047469 Bacteria 2235
126 Ga0495673_0049775 3300047469 Bacteria 1843
127 Ga0495681_0000170 3300047470 Bacteria 54525
128 Ga0495681_0003143 3300047470 Bacteria 11558
129 Ga0495681_0010553 3300047470 Bacteria 5587
130 Ga0495681_0031720 3300047470 Bacteria 2670
131 Ga0495686_0000531 3300047472 Bacteria 54712
132 Ga0495686_0000670 3300047472 Bacteria 46425
133 Ga0495686_0038271 3300047472 Bacteria 3068
134 Ga0495686_0059429 3300047472 Bacteria 2380
135 Ga0495602_0062204 3300048088 Bacteria 3239
136 Ga0495614_0032047 3300048089 Bacteria 2262
137 Ga0495626_0000852 3300048091 Bacteria 27166
138 Ga0496111_0000142 3300048914 Bacteria 32155
139 Ga0496116_0006559 3300048919 Bacteria 10536
140 Ga0496117_0044664 3300048920 Bacteria 3207
141 Ga0496118_0127989 3300048921 Bacteria 1637
142 Ga0496119_0012137 3300048922 Bacteria 7035
143 Ga0496121_0005514 3300048924 Bacteria 16166
144 Ga0496121_0009974 3300048924 Bacteria 10802
145 Ga0496121_0058990 3300048924 Bacteria 3167
146 Ga0496121_0074334 3300048924 Bacteria 2719
147 Ga0496122_0003047 3300048925 Bacteria 22665
148 Ga0496122_0003621 3300048925 Bacteria 20112
149 Ga0496122_0131886 3300048925 Bacteria 1585
150 Ga0496123_0002549 3300048926 Bacteria 22213
151 Ga0496123_0006407 3300048926 Bacteria 11412
152 Ga0496124_0000800 3300048927 Bacteria 51160
153 Ga0496124_0001909 3300048927 Bacteria 28595
154 Ga0496124_0006380 3300048927 Bacteria 12861
155 Ga0496124_0007309 3300048927 Bacteria 11779
156 Ga0496124_0011501 3300048927 Bacteria 8839
157 Ga0496124_0032758 3300048927 Bacteria 4583
158 Ga0496124_0097495 3300048927 Bacteria 2387
159 Ga0496125_0223814 3300048928 Bacteria 1210
160 Ga0496125_0257352 3300048928 Bacteria 1096
161 Ga0496126_0009058 3300048929 Bacteria 10639
162 Ga0496126_0056305 3300048929 Bacteria 3555
163 Ga0496126_0260625 3300048929 Bacteria 1442
164 Ga0495678_000858 3300049459 Bacteria 27076
165 Ga0495678_002087 3300049459 Bacteria 14209
166 Ga0495682_0000025 3300049460 Bacteria 147931
167 Ga0495682_0000826 3300049460 Bacteria 19395
168 Ga0495682_0001338 3300049460 Bacteria 13616
169 nmdc:mga00v17_202818_c1 3300050491 Bacteria 1282
170 nmdc:mga0k408_1522_c1 3300050493 Bacteria 12523
171 nmdc:mga06z11_297_c1 3300050494 Bacteria 17486
172 nmdc:mga04h51_12032_c1 3300050495 Bacteria 2418
173 nmdc:mga07m45_1036_c1 3300050496 Bacteria 12352
174 nmdc:mga07m45_104_c1 3300050496 Bacteria 33217
175 Ga0500578_0042326 3300053086 Bacteria 2925
176 Ga0500583_0000668 3300053092 Bacteria 10094
177 Ga0500608_000522 3300053122 Bacteria 14350
178 Ga0500618_001058 3300053125 Bacteria 13668
179 Ga0500568_0009318 3300053139 Bacteria 4674
180 Ga0500574_000054 3300053141 Bacteria 13645
181 Ga0500616_0009791 3300053153 Bacteria 5783
182 Ga0500638_000026 3300053162 Bacteria 55912
183 Ga0500636_0000062 3300053177 Bacteria 52263
184 Ga0500567_062631 3300053723 Bacteria 1660
185 2501079765 2501025502 Bacteria 9641094
186 2511094103 2510917013 Bacteria 9951648
187 2511389362 2511231027 Bacteria 5013807
188 2559298590 2558860242 Bacteria 5568029
189 2585564314 2585427531 Bacteria 6992870
190 2585903203 2585427609 Bacteria 6667127
191 2587978631 2585428125 Bacteria 6662905
192 2595452284 2593339239 Bacteria 4124669
193 2599336390 2599185156 Bacteria 5403036
194 2599734843 2599185239 Bacteria 8686614
195 2600202060 2599185354 Bacteria 4398675
196 2600203769 2599185354 Bacteria 4398675
197 2600225251 2599185359 Bacteria 4772316
198 2643814191 2643221558 Bacteria 5460675
199 2644300913 2643221653 Bacteria 4569637
200 2644659135 2643221719 Bacteria 4568197
201 2671586678 2671180115 Bacteria 5353919
202 2735835131 2734482264 Unclassified 5014763
203 2758642687 2758568016 Bacteria 5645291
204 2776910964 2775507049 Bacteria 6284736
205 2808989955 2808606387 Bacteria 5697198
206 2819552752 2818991438 Bacteria 5793701
207 2819561646 2818991439 Bacteria 6907412
208 2819635791 2818991452 Bacteria 8442785
209 2819712268 2818991466 Bacteria 4748179
210 2838033553 2838029111 Bacteria 6603031
211 2838718535 2838714209 Bacteria 5525906
212 2838723534 2838719591 Bacteria 5523910
213 2840768613 2840764183 Bacteria 6358399
214 2842174868 2842170452 Bacteria 5525737
215 2842191349 2842187318 Bacteria 5524014
216 2842215577 2842211629 Bacteria 5523832
217 2842228298 2842224351 Bacteria 5524473
218 2842480175 2842475841 Bacteria 6603183
219 2842508055 2842502639 Bacteria 6604161
220 2842782363 2842780639 Bacteria 4337790
221 2842873029 2842871566 Bacteria 4827117
222 2852653729 2852653556 Bacteria 4050083
223 2899846855 2899845264 Bacteria 5672268
224 2919088583 2919085039 Bacteria 4532964
225 2926765343 2926760298 Bacteria 5505990
226 2928175218 2928170801 Bacteria 8785406
227 2928528372 2928526807 Bacteria 4760224
228 2928972519 2928968154 Bacteria 4633371
229 2945964008 2945961074 Bacteria 7342064
230 2946009508 2946006987 Bacteria 6705746
231 2979095413 2979089926 Bacteria 5670289
232 2979097666 2979095461 Bacteria 5669583
233 2984514262 2984509177 Bacteria 5274802
234 2984523293 2984518228 Bacteria 5277463
235 2984542685 2984537506 Bacteria 5277481
236 3005416688 3005416602 Bacteria 7064308
237 650741442 650716007 Bacteria 5573770
238 8005320669 8005314921 Bacteria 7072929
239 8018847830 8018845410 Bacteria 8933938
240 8021121872 8021120328 Bacteria 8782274
241 Ga0500641_0021485
242 JGI25155J39150_1000040
243 JGI25156J39149_1000051
244 JGI25154J39366_1000079
245 JGI25157J39369_1000168
246 Ga0055527_1004690
247 Ga0055526_1000009
248 Ga0055524_1010631
249 Ga0055528_1000219
250 Ga0055530_10011461
251 Ga0065704_10162863
252 Ga0070670_100000133
253 Ga0075368_10031555
254 Ga0075362_10032987
255 Ga0075366_10001244
256 Ga0075370_10001967
257 Ga0105250_10000145
258 Ga0105243_10334608
259 Ga0157373_10048198
260 Ga0157371_10000619
261 Ga0157371_10003124
262 Ga0157370_10000661
263 Ga0157370_10030874
264 Ga0157370_10051445
265 Ga0157375_10000050
266 Ga0182005_1000019
267 Ga0183363_1005
268 Ga0163161_10009209
269 Ga0163161_10089997
270 Ga0228711_1008201
271 Ga0228710_1004154
272 Ga0209435_100052
273 Ga0209566_100384
274 Ga0209672_104165
275 Ga0209147_100145
276 Ga0209646_1000163
277 Ga0209026_1000190
278 Ga0209759_1000213
279 Ga0209673_1000005
280 Ga0209025_1002147
281 Ga0209564_1000069
282 Ga0209564_1028957
283 Ga0209050_1000682
284 Ga0209256_1001571
285 Ga0207696_1000002
286 Ga0207655_1014076
287 Ga0207650_10000592
288 Ga0207698_10283479
289 Ga0209371_1001295
290 Ga0209813_10016096
291 Ga0268256_1000028
292 Ga0307412_10000301
293 Ga0495617_004155
294 Ga0495591_000151
295 Ga0495591_016073
296 Ga0495638_0000386
297 Ga0495653_0007075
298 Ga0495650_0001543
299 Ga0495605_0000054
300 Ga0495584_0002373
301 Ga0495585_0030945
302 Ga0495596_0001701
303 Ga0495596_0005992
304 Ga0495607_0000002
305 Ga0495607_0001715
306 Ga0495607_0001999
307 Ga0495607_0002220
308 Ga0495607_0105985
309 Ga0495583_0002038
310 Ga0495606_0000300
311 Ga0495606_0000794
312 Ga0495606_0001251
313 Ga0495606_0071431
314 Ga0495610_0002496
315 Ga0495610_0007600
316 Ga0495610_0023282
317 Ga0495616_0034525
318 Ga0495620_0000136
319 Ga0495620_0000484
320 Ga0495620_0030174
321 Ga0495630_0006110
322 Ga0495632_0001029
323 Ga0495632_0003985
324 Ga0495637_0000092
325 Ga0495643_0000492
326 Ga0495643_0004143
327 Ga0495644_0000858
328 Ga0495648_0000713
329 Ga0495648_0001918
330 Ga0495648_0098209
331 Ga0495663_0000035
332 Ga0495666_0003268
333 Ga0495665_0005019
334 Ga0495640_0114057
335 Ga0495611_0000530
336 Ga0495625_0000322
337 Ga0495625_0002661
338 Ga0495661_0000001
339 Ga0495661_0000033
340 Ga0495661_0079882
341 Ga0495623_0001620
342 Ga0495646_0006062
343 Ga0495613_0013925
344 Ga0495624_0007641
345 Ga0495670_0001019
346 Ga0495671_0001312
347 Ga0495671_0005914
348 Ga0495649_0001308
349 Ga0495649_0009642
350 Ga0495649_0018342
351 Ga0495589_0000763
352 Ga0495589_0133508
353 Ga0495600_0202501
354 Ga0495581_0020656
355 Ga0495674_0039781
356 Ga0495672_0001648
357 Ga0495672_0052881
358 Ga0495676_0039602
359 Ga0495680_0014578
360 Ga0495687_000202
361 Ga0495687_078788
362 Ga0495675_0001643
363 Ga0495679_001008
364 Ga0495673_0001553
365 Ga0495673_0036943
366 Ga0495673_0049775
367 Ga0495681_0000170
368 Ga0495681_0003143
369 Ga0495681_0010553
370 Ga0495681_0031720
371 Ga0495686_0000531
372 Ga0495686_0000670
373 Ga0495686_0038271
374 Ga0495686_0059429
375 Ga0495602_0062204
376 Ga0495614_0032047
377 Ga0495626_0000852
378 Ga0496111_0000142
379 Ga0496116_0006559
380 Ga0496117_0044664
381 Ga0496118_0127989
382 Ga0496119_0012137
383 Ga0496121_0005514
384 Ga0496121_0009974
385 Ga0496121_0058990
386 Ga0496121_0074334
387 Ga0496122_0003047
388 Ga0496122_0003621
389 Ga0496122_0131886
390 Ga0496123_0002549
391 Ga0496123_0006407
392 Ga0496124_0000800
393 Ga0496124_0001909
394 Ga0496124_0006380
395 Ga0496124_0007309
396 Ga0496124_0011501
397 Ga0496124_0032758
398 Ga0496124_0097495
399 Ga0496125_0223814
400 Ga0496125_0257352
401 Ga0496126_0009058
402 Ga0496126_0056305
403 Ga0496126_0260625
404 Ga0495678_000858
405 Ga0495678_002087
406 Ga0495682_0000025
407 Ga0495682_0000826
408 Ga0495682_0001338
409 nmdc:mga00v17_202818_c1
410 nmdc:mga0k408_1522_c1
411 nmdc:mga06z11_297_c1
412 nmdc:mga04h51_12032_c1
413 nmdc:mga07m45_1036_c1
414 nmdc:mga07m45_104_c1
415 Ga0500578_0042326
416 Ga0500583_0000668
417 Ga0500608_000522
418 Ga0500618_001058
419 Ga0500568_0009318
420 Ga0500574_000054
421 Ga0500616_0009791
422 Ga0500638_000026
423 Ga0500636_0000062
424 Ga0500567_062631
425 2501079765
426 2511094103
427 2511389362
428 2559298590
429 2585564314
430 2585903203
431 2587978631
432 2595452284
433 2599336390
434 2599734843
435 2600202060
436 2600203769
437 2600225251
438 2643814191
439 2644300913
440 2644659135
441 2671586678
442 2735835131
443 2758642687
444 2776910964
445 2808989955
446 2819552752
447 2819561646
448 2819635791
449 2819712268
450 2838033553
451 2838718535
452 2838723534
453 2840768613
454 2842174868
455 2842191349
456 2842215577
457 2842228298
458 2842480175
459 2842508055
460 2842782363
461 2842873029
462 2852653729
463 2899846855
464 2919088583
465 2926765343
466 2928175218
467 2928528372
468 2928972519
469 2945964008
470 2946009508
471 2979095413
472 2979097666
473 2984514262
474 2984523293
475 2984542685
476 3005416688
477 650741442
478 8005320669
479 8018847830
480 8021121872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

143

343

0.95

PF10340

Say1_Mug180

Steryl acetyl hydrolase

172

294

0.87

PF20434

BD-FAE

BD-FAE

130

294

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q05-assembly1.cif.gz_B crystal structure of an esterase e25 0.922 7 323
3d7r-assembly2.cif.gz_B crystal structure of a putative esterase from staphylococcus aureus 0.9073 76 321
7at4-assembly1.cif.gz_A structure of estd11 in complex with naproxen 0.9033 22 326
7at4-assembly1.cif.gz_A structure of estd11 in complex with naproxen 0.8917 22 326
5mif-assembly2.cif.gz_B crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum 0.89 76 326
ID Description Score Start End Superfamily
4q05B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.922 7 323 3.40.50.1820
af_I6Y2J4_205_430_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9029 79 319 3.40.50.1820
af_Q2G2W3_3_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9026 76 321 3.40.50.1820
4q3oF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8889 18 322 3.40.50.1820
af_I6Y2J4_205_430_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8764 79 319 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A558QV57-F1-model_v4 Alpha/beta hydrolase 0.9927 164 323 GO:0004806
AF-K2QKB8-F1-model_v4 Esterase/lipase/thioesterase family protein 0.9833 106 326 GO:0004806
AF-A0A839YJX2-F1-model_v4 Acetyl esterase/lipase 0.983 1 323 GO:0004806
AF-A0A829N4C8-F1-model_v4 deleted 0.9774 29 323
AF-A0A0A2VT47-F1-model_v4 Monoterpene epsilon-lactone hydrolase 0.9773 3 326 GO:0016491
GO:0016787

Map