F353339

General Info

Members Datasets Scaffolds Average Seq Length
240 203 161 337

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2835188231|2835191795
Length 404
Sequence TAAGAADGTADGTAGGAAGASSTTPGAWEPDVLPGFERLTLPLAPDDEGPVVATLVRRAQRPPATTGAGRAADGHAGGAPDRGVDVLYVHGWIDYFFQTHVADFWERLGVRFYALDLRKYGRSLRPHQTPGFVTSLRTYDEDLEAALAAMGHASGTTDRRRLVLMGHSTGGLTLSLWAGRHPGRADGLVLNSPWLEFQTREVGRRVLEPGIRAQAAVAPYSRLVNVDLGFYARSISARFDGEWDYDATWRPDLGWRATPAWLAAVFRGHEQVARGLGIDVPILVLLSARSTIGVRWHPDMLTSDSVLDVVGVARRVPSLGSLVTLVRLDGALHDVTLSAAPVRDVVWRETQRWFDAYVAPAPVPPAAPPASPERAFRERVVRLARLARLSAARAPSRALGPSTR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
8 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
9 2643221549 Agromyces sp. Root1464 Isolate Unclassified
10 2643221572 Leifsonia sp. Root60 Isolate Unclassified
11 2643221613 Oerskovia sp. Root22 Isolate Unclassified
12 2643221616 Leifsonia sp. Root227 Isolate Unclassified
13 2643221619 Agromyces sp. Root81 Isolate Unclassified
14 2643221649 Leifsonia sp. Root4 Isolate Unclassified
15 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
16 2643221721 Oerskovia sp. Root918 Isolate Unclassified
17 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
18 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
19 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
20 2808606372 Agromyces sp. 23-23 Isolate Unclassified
21 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
22 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
23 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
24 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
25 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
26 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
27 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
28 2855683550 Micromonospora sp. RP3T Isolate Unclassified
29 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
30 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
31 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
32 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
33 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
34 2858868258 Micromonospora sp. MH33 Isolate Unclassified
35 2858882152 Micromonospora noduli MED15 Isolate Nodule
36 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
37 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
38 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
39 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
40 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
41 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
42 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
43 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
44 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
45 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
46 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
47 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
48 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
49 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
50 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
51 2902582711 Micromonospora sp. AP08 Isolate Unclassified
52 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
53 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
54 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
55 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
56 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
57 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
58 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
59 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
60 2928153084 Leifsonia sp. 563 Isolate Unclassified
61 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
62 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
63 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
64 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
65 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
66 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
67 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
68 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
69 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
70 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
71 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
72 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
195 649633069 Micromonospora sp. L5 Isolate Unclassified
196 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
197 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
198 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
199 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
200 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
201 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
202 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
203 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.25
Metatranscriptomes 0.83
Isolates 32.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 2.5
Rhizoplane 1.67
Rhizosphere 60.42
Stem 0
Stem Tuber 0.42
Unclassified 30.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002175 3300002067 Bacteria 6886
2 JGI25164J39214_1001280 3300002772 Bacteria 6455
3 JGI25406J46586_10032842 3300003203 Bacteria 1924
4 JGI25165J46597_1000014 3300003214 Bacteria 390383
5 Ga0006562J51391_1005681 3300003578 Bacteria 7890
6 Ga0006562J51391_1005682 3300003578 Bacteria 9800
7 Ga0070658_10022573 3300005327 Bacteria 5050
8 Ga0070658_10055826 3300005327 Bacteria 3209
9 Ga0070680_100109018 3300005336 Bacteria 2303
10 Ga0070682_100042991 3300005337 Bacteria 2792
11 Ga0070682_100288249 3300005337 Bacteria 1200
12 Ga0070660_100051969 3300005339 Bacteria 3158
13 Ga0070687_100080961 3300005343 Bacteria 1772
14 Ga0070661_100017019 3300005344 Bacteria 5150
15 Ga0070692_10207149 3300005345 Bacteria 1152
16 Ga0070668_100003275 3300005347 Bacteria 11940
17 Ga0070668_100216747 3300005347 Bacteria 1577
18 Ga0070669_100139019 3300005353 Bacteria 1871
19 Ga0070659_100450480 3300005366 Bacteria 1092
20 Ga0070667_100033556 3300005367 Bacteria 4291
21 Ga0070678_100137430 3300005456 Bacteria 1951
22 Ga0070681_10087447 3300005458 Bacteria 3069
23 Ga0070679_100043531 3300005530 Bacteria 4471
24 Ga0068855_100272921 3300005563 Bacteria 1880
25 Ga0070664_100228149 3300005564 Bacteria 1668
26 Ga0068857_100426906 3300005577 Bacteria 1236
27 Ga0068864_100215969 3300005618 Bacteria 1768
28 Ga0068861_100266432 3300005719 Bacteria 1469
29 Ga0068863_100286409 3300005841 Bacteria 1597
30 Ga0068858_100005687 3300005842 Bacteria 12184
31 Ga0068862_100050108 3300005844 Bacteria 3568
32 Ga0081540_1023750 3300005983 Bacteria 3575
33 Ga0081540_1049212 3300005983 Bacteria 2104
34 Ga0081539_10004371 3300005985 Bacteria 15728
35 Ga0081539_10007093 3300005985 Bacteria 10362
36 Ga0075430_100004407 3300006846 Bacteria 11882
37 Ga0075431_100069366 3300006847 Bacteria 3637
38 Ga0075429_100017248 3300006880 Bacteria 6246
39 Ga0105244_10007549 3300009036 Bacteria 6904
40 Ga0105244_10086375 3300009036 Bacteria 1547
41 Ga0114129_10621508 3300009147 Bacteria 1397
42 Ga0105243_10360882 3300009148 Bacteria 1337
43 Ga0157369_10005654 3300013105 Bacteria 14525
44 Ga0157369_10019258 3300013105 Bacteria 7636
45 Ga0157378_10070197 3300013297 Bacteria 3144
46 Ga0157372_10392207 3300013307 Bacteria 1618
47 Ga0157372_10637385 3300013307 Bacteria 1241
48 Ga0157375_10224549 3300013308 Bacteria 2037
49 Ga0163163_10247512 3300014325 Bacteria 1833
50 Ga0157380_10101648 3300014326 Bacteria 2396
51 Ga0163161_10149648 3300017792 Bacteria 1773
52 Ga0207427_100121 3300025231 Bacteria 99954
53 Ga0209437_100933 3300025233 Bacteria 11082
54 Ga0209233_1000014 3300025261 Bacteria 996641
55 Ga0209051_1002275 3300025303 Bacteria 14067
56 Ga0207705_10020441 3300025909 Bacteria 4731
57 Ga0207705_10076438 3300025909 Bacteria 2434
58 Ga0207660_10167393 3300025917 Bacteria 1699
59 Ga0207662_10076989 3300025918 Bacteria 2028
60 Ga0207649_10051071 3300025920 Bacteria 2560
61 Ga0207652_10019555 3300025921 Bacteria 5571
62 Ga0207681_10141897 3300025923 Bacteria 1790
63 Ga0207650_10265795 3300025925 Bacteria 1393
64 Ga0207700_10326615 3300025928 Bacteria 1331
65 Ga0207691_10067717 3300025940 Bacteria 3228
66 Ga0207661_10022896 3300025944 Bacteria 4712
67 Ga0207679_10051564 3300025945 Bacteria 3012
68 Ga0207667_10212442 3300025949 Bacteria 1983
69 Ga0207668_10152717 3300025972 Bacteria 1789
70 Ga0207658_10121494 3300025986 Bacteria 2083
71 Ga0207708_10135580 3300026075 Bacteria 1928
72 Ga0207648_10125184 3300026089 Bacteria 2261
73 Ga0207674_10016934 3300026116 Bacteria 7961
74 Ga0207683_10163855 3300026121 Bacteria 2011
75 Ga0207683_10172071 3300026121 Bacteria 1962
76 Ga0268266_10074585 3300028379 Bacteria 2946
77 Ga0268265_10288875 3300028380 Bacteria 1471
78 Ga0307515_10000217 3300028794 Bacteria 142129
79 Ga0307515_10022713 3300028794 Bacteria 11041
80 Ga0307515_10035104 3300028794 Bacteria 8173
81 Ga0307512_10007625 3300030522 Bacteria 10677
82 Ga0307512_10011102 3300030522 Bacteria 8549
83 Ga0307513_10152822 3300031456 Bacteria 2213
84 Ga0307509_10009891 3300031507 Bacteria 11793
85 Ga0307509_10269890 3300031507 Bacteria 1470
86 Ga0307408_100065236 3300031548 Bacteria 2670
87 Ga0307408_100248892 3300031548 Bacteria 1465
88 Ga0307508_10000473 3300031616 Bacteria 48634
89 Ga0307508_10013028 3300031616 Bacteria 7605
90 Ga0307508_10089339 3300031616 Bacteria 2666
91 Ga0307516_10000728 3300031730 Bacteria 44930
92 Ga0307516_10018155 3300031730 Bacteria 7315
93 Ga0307516_10044101 3300031730 Bacteria 4415
94 Ga0307413_10114518 3300031824 Bacteria 1813
95 Ga0307410_10147377 3300031852 Bacteria 1748
96 Ga0307406_10022448 3300031901 Bacteria 3745
97 Ga0307416_100667649 3300032002 Bacteria 1126
98 Ga0307415_100105072 3300032126 Bacteria 2082
99 Ga0307507_10039863 3300033179 Bacteria 4731
100 Ga0373940_0001881 3300035088 Bacteria 3945
101 Ga0373951_0000239 3300035091 Bacteria 18591
102 Ga0373941_0012166 3300035115 Bacteria 2243
103 Ga0373942_0000302 3300035207 Bacteria 13526
104 Ga0373962_0005317 3300035242 Bacteria 3115
105 Ga0373935_0036350 3300035692 Bacteria 3078
106 Ga0395900_0161863 3300037418 Bacteria 2282
107 Ga0395898_0020746 3300037466 Bacteria 6671
108 Ga0395898_0073048 3300037466 Bacteria 3313
109 Ga0395905_0007842 3300037471 Bacteria 10578
110 Ga0395901_0015485 3300038443 Bacteria 7764
111 Ga0395901_0250931 3300038443 Bacteria 1843
112 Ga0451791_0895918 3300041451 Bacteria 3605
113 Ga0451853_2277828 3300041512 Bacteria 1949
114 Ga0466965_0000004 3300044683 Bacteria 229348
115 Ga0495638_0105327 3300046460 Bacteria 1681
116 Ga0495594_0008729 3300046499 Bacteria 5225
117 Ga0496105_0373358 3300048908 Bacteria 1136
118 Ga0496108_0000040 3300048911 Bacteria 147522
119 Ga0496108_0289939 3300048911 Bacteria 1425
120 Ga0496117_0008492 3300048920 Bacteria 9745
121 Ga0496117_0010911 3300048920 Bacteria 8191
122 Ga0496118_0029140 3300048921 Bacteria 4635
123 Ga0496119_0001062 3300048922 Bacteria 35053
124 Ga0496120_0003758 3300048923 Bacteria 13435
125 Ga0496122_0000095 3300048925 Bacteria 200509
126 Ga0496123_0000100 3300048926 Bacteria 170019
127 Ga0496124_0010327 3300048927 Bacteria 9472
128 Ga0496125_0028437 3300048928 Bacteria 5049
129 Ga0496126_0006146 3300048929 Bacteria 13455
130 Ga0496126_0052423 3300048929 Bacteria 3707
131 Ga0501031_0259629 3300049568 Bacteria 1129
132 Ga0501032_0023508 3300049569 Bacteria 4256
133 Ga0501034_0082976 3300049571 Bacteria 3207
134 Ga0501034_0405864 3300049571 Bacteria 1285
135 Ga0501037_0125907 3300049573 Bacteria 1840
136 Ga0501037_0256520 3300049573 Bacteria 1222
137 Ga0501038_0017402 3300049574 Bacteria 6497
138 Ga0501038_0067340 3300049574 Bacteria 3046
139 Ga0501038_0192266 3300049574 Bacteria 1641
140 Ga0501039_0060167 3300049575 Bacteria 2941
141 Ga0501043_0030597 3300049579 Bacteria 4230
142 Ga0501043_0142451 3300049579 Bacteria 1877
143 Ga0501047_0074876 3300049581 Bacteria 3259
144 Ga0501047_0240506 3300049581 Bacteria 1661
145 Ga0501047_0325377 3300049581 Bacteria 1376
146 Ga0501070_0000262 3300049586 Bacteria 49716
147 Ga0501070_0079041 3300049586 Bacteria 2722
148 Ga0501070_0104363 3300049586 Bacteria 2344
149 Ga0501071_0182640 3300049587 Bacteria 1572
150 Ga0501035_0090050 3300049822 Bacteria 2701
151 Ga0501044_0035717 3300049823 Bacteria 5203
152 Ga0501044_0161767 3300049823 Bacteria 2215
153 nmdc:mga05p37_71085_c1 3300050507 Bacteria 4281
154 nmdc:mga09592_42244_c1 3300050508 Bacteria 3835
155 nmdc:mga0qj67_15008_c1 3300050509 Bacteria 5860
156 nmdc:mga06r32_405326_c1 3300050510 Bacteria 1346
157 Ga0500635_0000063 3300053080 Bacteria 70358
158 Ga0500644_0017670 3300053088 Bacteria 2075
159 Ga0500644_0049026 3300053088 Bacteria 1440
160 Ga0500568_0000935 3300053139 Bacteria 20164
161 Ga0500600_0028454 3300053149 Bacteria 3306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0000262 Ga0501070_0000262_24323_25540 294
2 3300048923 Ga0496120_0003758 Ga0496120_0003758_1173_2192 305
3 iso_pu_bacteria 2515154088 2515497363 305
4 iso_pu_bacteria 2515154129 2515720903 305
5 iso_pu_bacteria 2515154137 2515758306 305
6 iso_pu_bacteria 2515154202 2516082650 305
7 iso_pu_bacteria 2515154203 2516091811 305
8 iso_pu_bacteria 2772190715 2772643408 305
9 iso_pu_bacteria 649633069 649813485 305
10 3300005347 Ga0070668_100003275 Ga0070668_1000032752 306
11 3300005353 Ga0070669_100139019 Ga0070669_1001390192 306
12 3300005844 Ga0068862_100050108 Ga0068862_1000501084 306
13 3300025923 Ga0207681_10141897 Ga0207681_101418972 306
14 3300025972 Ga0207668_10152717 Ga0207668_101527172 306
15 3300028380 Ga0268265_10288875 Ga0268265_102888752 306
16 iso_pu_bacteria 2751185782 2753268541 306
17 3300048920 Ga0496117_0008492 Ga0496117_0008492_5739_6770 309
18 3300048921 Ga0496118_0029140 Ga0496118_0029140_1388_2419 309
19 3300048922 Ga0496119_0001062 Ga0496119_0001062_32986_34017 309
20 3300048925 Ga0496122_0000095 Ga0496122_0000095_109133_110164 309
21 3300048926 Ga0496123_0000100 Ga0496123_0000100_59828_60859 309
22 3300048927 Ga0496124_0010327 Ga0496124_0010327_4111_5142 309
23 3300048928 Ga0496125_0028437 Ga0496125_0028437_779_1810 309
24 3300048929 Ga0496126_0052423 Ga0496126_0052423_68_1099 309
25 iso_pu_bacteria 2501939600 2501939648 309
26 iso_pu_bacteria 2831935698 2831937660 309
27 iso_pu_bacteria 2832004796 2832009898 309
28 iso_pu_bacteria 2855670206 2855673640 309
29 iso_pu_bacteria 2855676851 2855677944 309
30 iso_pu_bacteria 2855683550 2855689136 309
31 iso_pu_bacteria 2856858025 2856858277 309
32 iso_pu_bacteria 2857288857 2857291103 309
33 iso_pu_bacteria 2858848962 2858854011 309
34 iso_pu_bacteria 2858868258 2858870004 309
35 iso_pu_bacteria 2858882152 2858886980 309
36 iso_pu_bacteria 2858888857 2858894501 309
37 iso_pu_bacteria 2858895516 2858896416 309
38 iso_pu_bacteria 2858902515 2858907380 309
39 iso_pu_bacteria 2866065130 2866069420 309
40 iso_pu_bacteria 2867302475 2867307046 309
41 iso_pu_bacteria 2867312974 2867316947 309
42 iso_pu_bacteria 2867319477 2867325323 309
43 iso_pu_bacteria 2867507094 2867508230 309
44 iso_pu_bacteria 2869048445 2869048894 309
45 iso_pu_bacteria 2869061728 2869066714 309
46 iso_pu_bacteria 2869068681 2869069361 309
47 iso_pu_bacteria 2880489317 2880495788 309
48 iso_pu_bacteria 2880495981 2880496575 309
49 iso_pu_bacteria 2902582711 2902584074 309
50 iso_pu_bacteria 2929219909 2929225214 309
51 iso_pu_bacteria 2929226422 2929231814 309
52 iso_pu_bacteria 2996221748 2996224422 309
53 iso_pu_bacteria 8003856774 8003857463 309
54 iso_pu_bacteria 8003870546 8003874731 309
55 iso_pu_bacteria 8054704163 8054704839 309
56 3300003203 JGI25406J46586_10032842 JGI25406J46586_100328422 310
57 3300005327 Ga0070658_10055826 Ga0070658_100558264 310
58 3300005336 Ga0070680_100109018 Ga0070680_1001090182 310
59 3300005337 Ga0070682_100042991 Ga0070682_1000429912 310
60 3300005337 Ga0070682_100288249 Ga0070682_1002882492 310
61 3300005339 Ga0070660_100051969 Ga0070660_1000519695 310
62 3300005344 Ga0070661_100017019 Ga0070661_1000170192 310
63 3300005367 Ga0070667_100033556 Ga0070667_1000335563 310
64 3300005458 Ga0070681_10087447 Ga0070681_100874475 310
65 3300005530 Ga0070679_100043531 Ga0070679_1000435313 310
66 3300005563 Ga0068855_100272921 Ga0068855_1002729212 310
67 3300005564 Ga0070664_100228149 Ga0070664_1002281492 310
68 3300005577 Ga0068857_100426906 Ga0068857_1004269062 310
69 3300005618 Ga0068864_100215969 Ga0068864_1002159693 310
70 3300005841 Ga0068863_100286409 Ga0068863_1002864092 310
71 3300005842 Ga0068858_100005687 Ga0068858_1000056874 310
72 3300005983 Ga0081540_1023750 Ga0081540_10237505 310
73 3300005985 Ga0081539_10004371 Ga0081539_1000437115 310
74 3300005985 Ga0081539_10007093 Ga0081539_100070938 310
75 3300013105 Ga0157369_10005654 Ga0157369_1000565413 310
76 3300013297 Ga0157378_10070197 Ga0157378_100701974 310
77 3300013307 Ga0157372_10637385 Ga0157372_106373852 310
78 3300025909 Ga0207705_10020441 Ga0207705_100204412 310
79 3300025917 Ga0207660_10167393 Ga0207660_101673932 310
80 3300025920 Ga0207649_10051071 Ga0207649_100510714 310
81 3300025921 Ga0207652_10019555 Ga0207652_100195554 310
82 3300025928 Ga0207700_10326615 Ga0207700_103266151 310
83 3300025944 Ga0207661_10022896 Ga0207661_100228962 310
84 3300025945 Ga0207679_10051564 Ga0207679_100515645 310
85 3300025949 Ga0207667_10212442 Ga0207667_102124422 310
86 3300025986 Ga0207658_10121494 Ga0207658_101214943 310
87 3300026116 Ga0207674_10016934 Ga0207674_100169345 310
88 3300028794 Ga0307515_10000217 Ga0307515_1000021765 310
89 3300028794 Ga0307515_10022713 Ga0307515_100227132 310
90 3300028794 Ga0307515_10035104 Ga0307515_1003510410 310
91 3300030522 Ga0307512_10007625 Ga0307512_100076252 310
92 3300030522 Ga0307512_10011102 Ga0307512_100111022 310
93 3300031456 Ga0307513_10152822 Ga0307513_101528221 310
94 3300031507 Ga0307509_10009891 Ga0307509_100098918 310
95 3300031507 Ga0307509_10269890 Ga0307509_102698901 310
96 3300031616 Ga0307508_10000473 Ga0307508_1000047337 310
97 3300031616 Ga0307508_10013028 Ga0307508_100130287 310
98 3300031616 Ga0307508_10089339 Ga0307508_100893391 310
99 3300031730 Ga0307516_10000728 Ga0307516_100007289 310
100 3300031730 Ga0307516_10044101 Ga0307516_100441012 310
101 3300032126 Ga0307415_100105072 Ga0307415_1001050721 310
102 3300033179 Ga0307507_10039863 Ga0307507_100398634 310
103 3300035088 Ga0373940_0001881 Ga0373940_0001881_231_1250 310
104 3300035091 Ga0373951_0000239 Ga0373951_0000239_8430_9449 310
105 3300035115 Ga0373941_0012166 Ga0373941_0012166_102_1121 310
106 3300035207 Ga0373942_0000302 Ga0373942_0000302_1500_2519 310
107 3300035242 Ga0373962_0005317 Ga0373962_0005317_1647_2666 310
108 3300035692 Ga0373935_0036350 Ga0373935_0036350_1375_2394 310
109 3300037418 Ga0395900_0161863 Ga0395900_0161863_1055_2077 310
110 3300037466 Ga0395898_0073048 Ga0395898_0073048_2103_3125 310
111 3300038443 Ga0395901_0250931 Ga0395901_0250931_596_1618 310
112 3300041451 Ga0451791_0895918 Ga0451791_0895918_1879_2889 310
113 3300041512 Ga0451853_2277828 Ga0451853_2277828_64_1143 310
114 3300046460 Ga0495638_0105327 Ga0495638_0105327_599_1609 310
115 3300046499 Ga0495594_0008729 Ga0495594_0008729_3173_4138 310
116 3300048908 Ga0496105_0373358 Ga0496105_0373358_100_1047 310
117 3300048911 Ga0496108_0000040 Ga0496108_0000040_58356_59387 310
118 3300048929 Ga0496126_0006146 Ga0496126_0006146_3810_4994 310
119 3300049581 Ga0501047_0325377 Ga0501047_0325377_246_1199 310
120 3300053088 Ga0500644_0017670 Ga0500644_0017670_806_1816 310
121 3300053088 Ga0500644_0049026 Ga0500644_0049026_301_1311 310
122 3300005343 Ga0070687_100080961 Ga0070687_1000809612 313
123 3300005345 Ga0070692_10207149 Ga0070692_102071491 313
124 3300005347 Ga0070668_100216747 Ga0070668_1002167472 313
125 3300005366 Ga0070659_100450480 Ga0070659_1004504801 313
126 3300005719 Ga0068861_100266432 Ga0068861_1002664322 313
127 3300009148 Ga0105243_10360882 Ga0105243_103608821 313
128 3300013308 Ga0157375_10224549 Ga0157375_102245492 313
129 3300014325 Ga0163163_10247512 Ga0163163_102475123 313
130 3300014326 Ga0157380_10101648 Ga0157380_101016482 313
131 3300017792 Ga0163161_10149648 Ga0163161_101496482 313
132 3300025918 Ga0207662_10076989 Ga0207662_100769892 313
133 3300025925 Ga0207650_10265795 Ga0207650_102657952 313
134 3300025940 Ga0207691_10067717 Ga0207691_100677173 313
135 3300026075 Ga0207708_10135580 Ga0207708_101355802 313
136 3300026089 Ga0207648_10125184 Ga0207648_101251843 313
137 3300026121 Ga0207683_10172071 Ga0207683_101720712 313
138 3300037466 Ga0395898_0020746 Ga0395898_0020746_2495_3538 313
139 3300037471 Ga0395905_0007842 Ga0395905_0007842_6166_7209 313
140 3300038443 Ga0395901_0015485 Ga0395901_0015485_2776_3819 313
141 3300048911 Ga0496108_0289939 Ga0496108_0289939_81_1079 313
142 3300031901 Ga0307406_10022448 Ga0307406_100224484 314
143 iso_pu_bacteria 2919034639 2919035654 315
144 iso_pu_bacteria 2932426870 2932427732 315
145 3300005983 Ga0081540_1049212 Ga0081540_10492122 316
146 3300006846 Ga0075430_100004407 Ga0075430_1000044071 316
147 3300006847 Ga0075431_100069366 Ga0075431_1000693661 316
148 3300006880 Ga0075429_100017248 Ga0075429_1000172483 316
149 3300009147 Ga0114129_10621508 Ga0114129_106215081 316
150 3300028379 Ga0268266_10074585 Ga0268266_100745855 316
151 3300031730 Ga0307516_10018155 Ga0307516_100181551 316
152 3300050507 nmdc:mga05p37_71085_c1 nmdc:mga05p37_71085_c1_376_1344 316
153 3300050508 nmdc:mga09592_42244_c1 nmdc:mga09592_42244_c1_344_1312 316
154 3300050509 nmdc:mga0qj67_15008_c1 nmdc:mga0qj67_15008_c1_592_1560 316
155 3300050510 nmdc:mga06r32_405326_c1 nmdc:mga06r32_405326_c1_332_1300 316
156 3300053149 Ga0500600_0028454 Ga0500600_0028454_1965_2993 316
157 iso_pu_bacteria 2904776348 2904778297 316
158 iso_pu_bacteria 2932431166 2932434143 316
159 3300002772 JGI25164J39214_1001280 JGI25164J39214_10012808 317
160 3300003214 JGI25165J46597_1000014 JGI25165J46597_1000014155 317
161 3300049571 Ga0501034_0405864 Ga0501034_0405864_94_1254 318
162 3300049573 Ga0501037_0125907 Ga0501037_0125907_39_1085 318
163 3300049579 Ga0501043_0142451 Ga0501043_0142451_397_1443 318
164 3300049581 Ga0501047_0074876 Ga0501047_0074876_1173_2219 318
165 3300049822 Ga0501035_0090050 Ga0501035_0090050_1366_2412 318
166 3300044683 Ga0466965_0000004 Ga0466965_0000004_9387_10406 319
167 3300049568 Ga0501031_0259629 Ga0501031_0259629_13_1032 319
168 3300049571 Ga0501034_0082976 Ga0501034_0082976_471_1490 319
169 3300049573 Ga0501037_0256520 Ga0501037_0256520_77_1096 319
170 3300049574 Ga0501038_0017402 Ga0501038_0017402_1375_2394 319
171 3300049586 Ga0501070_0104363 Ga0501070_0104363_916_1935 319
172 3300049587 Ga0501071_0182640 Ga0501071_0182640_428_1447 319
173 3300049823 Ga0501044_0161767 Ga0501044_0161767_733_1752 319
174 3300053139 Ga0500568_0000935 Ga0500568_0000935_18826_19848 319
175 iso_pu_bacteria 2622736626 2623591348 319
176 iso_pu_bacteria 2643221613 2644081493 319
177 iso_pu_bacteria 2643221721 2644664787 319
178 iso_pu_bacteria 2857740372 2857740745 319
179 iso_pu_bacteria 2933418574 2933418703 319
180 iso_pu_bacteria 8003830390 8003833427 319
181 iso_pu_bacteria 8054727385 8054730025 319
182 iso_pu_bacteria 8054734606 8054737364 319
183 iso_pu_bacteria 8055412473 8055416968 319
184 3300005456 Ga0070678_100137430 Ga0070678_1001374302 320
185 3300009036 Ga0105244_10007549 Ga0105244_100075499 320
186 3300025303 Ga0209051_1002275 Ga0209051_100227512 320
187 3300026121 Ga0207683_10163855 Ga0207683_101638552 320
188 iso_pu_bacteria 2904497146 2904499206 321
189 iso_pu_bacteria 2910809715 2910813615 321
190 iso_pu_bacteria 2919538618 2919539152 321
191 3300031548 Ga0307408_100248892 Ga0307408_1002488922 323
192 3300031852 Ga0307410_10147377 Ga0307410_101473771 323
193 iso_pu_bacteria 2643221616 2644094525 323
194 iso_pu_bacteria 2884763398 2884763975 323
195 3300005327 Ga0070658_10022573 Ga0070658_100225734 324
196 3300025909 Ga0207705_10076438 Ga0207705_100764382 324
197 3300031824 Ga0307413_10114518 Ga0307413_101145181 325
198 iso_pu_bacteria 2939674588 2939677603 325
199 3300049823 Ga0501044_0035717 Ga0501044_0035717_3922_4953 326
200 3300053080 Ga0500635_0000063 Ga0500635_0000063_41419_42435 326
201 iso_pu_bacteria 2643221572 2643877430 326
202 iso_pu_bacteria 2643221669 2644384485 326
203 iso_pu_bacteria 2852677369 2852679384 326
204 iso_pu_bacteria 2895660088 2895661754 326
205 iso_pu_bacteria 8046352972 8046355000 326
206 3300025231 Ga0207427_100121 Ga0207427_10012144 327
207 3300025233 Ga0209437_100933 Ga0209437_1009337 327
208 3300025261 Ga0209233_1000014 Ga0209233_1000014563 327
209 iso_pu_bacteria 2935409751 2935409950 327
210 3300013307 Ga0157372_10392207 Ga0157372_103922072 328
211 3300049581 Ga0501047_0240506 Ga0501047_0240506_475_1506 328
212 3300049569 Ga0501032_0023508 Ga0501032_0023508_1379_2404 329
213 3300049574 Ga0501038_0067340 Ga0501038_0067340_548_1573 329
214 3300049574 Ga0501038_0192266 Ga0501038_0192266_333_1358 329
215 3300049575 Ga0501039_0060167 Ga0501039_0060167_783_1808 329
216 3300049579 Ga0501043_0030597 Ga0501043_0030597_2894_3919 329
217 3300049586 Ga0501070_0079041 Ga0501070_0079041_322_1347 329
218 iso_pu_bacteria 2721755702 2723640411 329
219 3300009036 Ga0105244_10086375 Ga0105244_100863752 330
220 3300031548 Ga0307408_100065236 Ga0307408_1000652362 330
221 iso_pu_bacteria 2835188231 2835191795 330
222 iso_pu_bacteria 2857729791 2857731975 331
223 iso_pu_bacteria 2928121344 2928124162 331
224 iso_pu_bacteria 2808606372 2808899435 332
225 iso_pu_bacteria 2643221619 2644113356 333
226 iso_pu_bacteria 2643221649 2644279890 333
227 iso_pu_bacteria 2919538618 2919540324 333
228 iso_pu_bacteria 2935890801 2935894173 333
229 3300032002 Ga0307416_100667649 Ga0307416_1006676491 334
230 iso_pu_bacteria 2585428094 2587862288 334
231 iso_pu_bacteria 2844841374 2844844697 334
232 iso_pu_bacteria 2919055335 2919056655 334
233 iso_pu_bacteria 2928153084 2928155463 334
234 3300013105 Ga0157369_10019258 Ga0157369_100192584 335
235 iso_pu_bacteria 2643221549 2643766728 335
236 iso_pu_bacteria 2919443155 2919444242 337
237 3300002067 JGI24735J21928_10002175 JGI24735J21928_100021752 338
238 3300003578 Ga0006562J51391_1005681 Ga0006562J51391_10056816 338
239 3300003578 Ga0006562J51391_1005682 Ga0006562J51391_100568211 338
240 3300048920 Ga0496117_0010911 Ga0496117_0010911_525_1541 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

81

298

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

86

240

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8371 16 335
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8317 16 335
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8268 16 335
6qe2-assembly2.cif.gz_B crystal structure of paleococcus ferrophilus monoacylglycerol lipase. 0.82 55 334
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.8188 16 335
ID Description Score Start End Superfamily
af_O05805_38_331_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9146 52 335 3.40.50.1820
af_O05805_38_331_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8754 52 335 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8253 16 335 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8199 16 335 3.40.50.1820
af_O94305_2_276_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8001 51 334 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D3KU88-F1-model_v4 Alpha/beta hydrolase 0.977 160 335 GO:0016787
AF-A0A496PGQ4-F1-model_v4 Alpha/beta hydrolase 0.9763 33 335 GO:0016787
AF-A0A7X6ZB33-F1-model_v4 Alpha/beta hydrolase 0.9694 234 334
AF-A0A3B9VUX8-F1-model_v4 Alpha/beta hydrolase 0.9679 4 337 GO:0006654
GO:0042171
GO:0052689
GO:0055088
AF-A0A7Y0CJ20-F1-model_v4 Alpha/beta hydrolase 0.9676 52 334 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map