F353341

General Info

Members Datasets Scaffolds Average Seq Length
240 183 236 101

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842045827|2842046833
Length 95
Sequence PALISSAFVFAASSALAESRVFIIANQANGYDQCLAKGDKCGASAARTYCQSRDFAQASAYRRVDPDEITGSVPKSGTNCSHGHCDEYVAITCQR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
4 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
167 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
168 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
169 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
172 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
173 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
174 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
181 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
182 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
183 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0.83
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 1.67
Rhizoplane 2.5
Rhizosphere 69.17
Stem 0
Stem Tuber 0
Unclassified 14.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10150173 3300005327 Bacteria 1950
2 Ga0070683_100017979 3300005329 Bacteria 6252
3 Ga0070670_100451844 3300005331 Bacteria 1139
4 Ga0070680_100042514 3300005336 Bacteria 3688
5 Ga0070660_100009001 3300005339 Bacteria 7004
6 Ga0070709_10002687 3300005434 Bacteria 9602
7 Ga0070714_100004549 3300005435 Bacteria 10456
8 Ga0070713_100001186 3300005436 Bacteria 16637
9 Ga0070710_10001085 3300005437 Bacteria 12877
10 Ga0070711_100159808 3300005439 Bacteria 1707
11 Ga0070711_101146510 3300005439 Bacteria 671
12 Ga0070678_100818370 3300005456 Bacteria 847
13 Ga0070681_10279438 3300005458 Bacteria 1580
14 Ga0070681_10450954 3300005458 Bacteria 1198
15 Ga0070679_100104736 3300005530 Bacteria 2815
16 Ga0070684_100246456 3300005535 Bacteria 1633
17 Ga0068853_100003512 3300005539 Bacteria 11990
18 Ga0068853_100230081 3300005539 Bacteria 1696
19 Ga0068855_100146049 3300005563 Bacteria 2692
20 Ga0068857_100025802 3300005577 Bacteria 5174
21 Ga0068857_101166130 3300005577 Bacteria 745
22 Ga0068854_102185665 3300005578 Bacteria 512
23 Ga0068856_100001102 3300005614 Bacteria 28542
24 Ga0068851_10004151 3300005834 Bacteria 6520
25 Ga0068858_100332339 3300005842 Bacteria 1454
26 Ga0068860_100001463 3300005843 Bacteria 25530
27 Ga0068860_101354991 3300005843 Bacteria 733
28 Ga0070717_10021688 3300006028 Bacteria 5065
29 Ga0070717_10073799 3300006028 Bacteria 2852
30 Ga0070717_10562890 3300006028 Bacteria 1033
31 Ga0075365_10685568 3300006038 Bacteria 724
32 Ga0070715_10000173 3300006163 Bacteria 14962
33 Ga0070716_100005501 3300006173 Bacteria 6139
34 Ga0070712_100006464 3300006175 Bacteria 7268
35 Ga0070712_100072790 3300006175 Bacteria 2463
36 Ga0068871_100293661 3300006358 Bacteria 1425
37 Ga0099795_10654132 3300007788 Bacteria 503
38 Ga0105250_10314677 3300009092 Bacteria 679
39 Ga0105240_10018413 3300009093 Bacteria 9379
40 Ga0105245_12743604 3300009098 Bacteria 545
41 Ga0105247_10008407 3300009101 Bacteria 6290
42 Ga0105247_11625261 3300009101 Bacteria 532
43 Ga0105241_11468026 3300009174 Bacteria 655
44 Ga0105237_10068239 3300009545 Bacteria 3550
45 Ga0105237_10197232 3300009545 Bacteria 2013
46 Ga0105237_10425128 3300009545 Bacteria 1334
47 Ga0105238_10169549 3300009551 Bacteria 2159
48 Ga0099796_10196846 3300010159 Bacteria 816
49 Ga0105239_10041984 3300010375 Bacteria 5011
50 Ga0105246_10740717 3300011119 Bacteria 866
51 Ga0157371_10081698 3300013102 Bacteria 2288
52 Ga0157370_10220013 3300013104 Bacteria 1759
53 Ga0157370_10336125 3300013104 Bacteria 1392
54 Ga0157369_10019914 3300013105 Bacteria 7505
55 Ga0157378_10544349 3300013297 Bacteria 1165
56 Ga0163162_12124503 3300013306 Bacteria 644
57 Ga0157372_11467168 3300013307 Bacteria 786
58 Ga0163163_10920813 3300014325 Bacteria 937
59 Ga0157380_11363495 3300014326 Bacteria 758
60 Ga0157379_11246940 3300014968 Bacteria 716
61 Ga0213872_10115126 3300021361 Bacteria 1192
62 Ga0213872_10160025 3300021361 Bacteria 980
63 Ga0213874_10149559 3300021377 Bacteria 814
64 Ga0213876_10063322 3300021384 Bacteria 1953
65 Ga0213875_10106723 3300021388 Bacteria 1307
66 Ga0213875_10282558 3300021388 Bacteria 784
67 Ga0213871_10009615 3300021441 Bacteria 2170
68 Ga0207656_10011036 3300025321 Bacteria 3402
69 Ga0207692_10005040 3300025898 Bacteria 5262
70 Ga0207692_10477818 3300025898 Bacteria 788
71 Ga0207710_10027482 3300025900 Bacteria 2464
72 Ga0207685_10048936 3300025905 Bacteria 1622
73 Ga0207707_10005224 3300025912 Bacteria 11380
74 Ga0207671_10215535 3300025914 Bacteria 1503
75 Ga0207671_10454775 3300025914 Bacteria 1020
76 Ga0207671_10793986 3300025914 Bacteria 751
77 Ga0207693_10000445 3300025915 Bacteria 37840
78 Ga0207693_10061321 3300025915 Bacteria 2946
79 Ga0207660_10152379 3300025917 Bacteria 1777
80 Ga0207657_10086040 3300025919 Bacteria 2632
81 Ga0207652_10265875 3300025921 Bacteria 1547
82 Ga0207694_10204430 3300025924 Bacteria 1607
83 Ga0207650_10365328 3300025925 Bacteria 1190
84 Ga0207664_10002003 3300025929 Bacteria 13415
85 Ga0207664_11026530 3300025929 Bacteria 739
86 Ga0207670_10372818 3300025936 Bacteria 1135
87 Ga0207665_10000651 3300025939 Bacteria 23346
88 Ga0207665_11603549 3300025939 Bacteria 516
89 Ga0207661_10178265 3300025944 Bacteria 1854
90 Ga0207667_10088277 3300025949 Bacteria 3207
91 Ga0207668_10190754 3300025972 Bacteria 1624
92 Ga0207640_10829812 3300025981 Bacteria 803
93 Ga0207703_10723665 3300026035 Bacteria 947
94 Ga0207702_10001047 3300026078 Bacteria 28331
95 Ga0207641_10361367 3300026088 Bacteria 1386
96 Ga0207674_10012072 3300026116 Bacteria 9675
97 Ga0207674_10943970 3300026116 Bacteria 831
98 Ga0207683_11124108 3300026121 Bacteria 729
99 Ga0207698_10698509 3300026142 Bacteria 1009
100 Ga0207698_10993532 3300026142 Bacteria 850
101 Ga0268266_10663809 3300028379 Bacteria 1004
102 Ga0268266_10825131 3300028379 Bacteria 896
103 Ga0268264_10000065 3300028381 Bacteria 298403
104 Ga0265337_1101611 3300028556 Bacteria 782
105 Ga0265334_10015261 3300028573 Bacteria 3194
106 Ga0265323_10002476 3300028653 Bacteria 8450
107 Ga0265336_10139136 3300028666 Bacteria 722
108 Ga0265338_10000321 3300028800 Bacteria 87046
109 Ga0265324_10006568 3300029957 Bacteria 4822
110 Ga0307511_10015806 3300030521 Bacteria 7299
111 Ga0265760_10111696 3300031090 Bacteria 871
112 Ga0265331_10054658 3300031250 Bacteria 1901
113 Ga0265331_10309864 3300031250 Bacteria 707
114 Ga0265331_10473847 3300031250 Bacteria 563
115 Ga0307509_10299383 3300031507 Bacteria 1357
116 Ga0307508_10428258 3300031616 Bacteria 915
117 Ga0265314_10001300 3300031711 Bacteria 28304
118 Ga0265342_10032861 3300031712 Bacteria 3197
119 Ga0265342_10039127 3300031712 Bacteria 2883
120 Ga0307516_10040779 3300031730 Bacteria 4618
121 Ga0307516_10768928 3300031730 Bacteria 623
122 Ga0307507_10035833 3300033179 Bacteria 5087
123 Ga0373936_0498687 3300035113 Bacteria 566
124 Ga0373935_0013234 3300035692 Bacteria 4976
125 Ga0373927_0019712 3300035695 Bacteria 4422
126 Ga0373927_0021340 3300035695 Bacteria 4244
127 Ga0373933_0000368 3300035724 Bacteria 28785
128 Ga0373933_0273943 3300035724 Bacteria 1090
129 Ga0373947_0216641 3300035725 Bacteria 1257
130 Ga0372808_014463 3300036459 Bacteria 1127
131 Ga0373925_0235006 3300037068 Bacteria 1466
132 Ga0373925_0376693 3300037068 Bacteria 1155
133 Ga0395899_0714386 3300037312 Bacteria 627
134 Ga0395900_0838304 3300037418 Bacteria 845
135 Ga0395898_0231247 3300037466 Bacteria 1763
136 Ga0436364_0597209 3300037853 Bacteria 2232
137 Ga0436364_1044312 3300037853 Bacteria 1254
138 Ga0436364_1465683 3300037853 Bacteria 2517
139 Ga0436365_0618227 3300039437 Bacteria 928
140 Ga0436365_1129200 3300039437 Bacteria 755
141 Ga0436365_1852334 3300039437 Bacteria 2606
142 Ga0436360_0202328 3300039438 Bacteria 4827
143 Ga0436360_1050510 3300039438 Bacteria 1679
144 Ga0436361_0357476 3300039447 Bacteria 588
145 Ga0436361_0367504 3300039447 Bacteria 1265
146 Ga0436361_1167758 3300039447 Bacteria 2673
147 Ga0436363_0497072 3300039450 Bacteria 1500
148 Ga0436362_0453326 3300039453 Bacteria 1086
149 Ga0451800_0351737 3300041459 Bacteria 741
150 Ga0451841_0727074 3300041498 Bacteria 827
151 Ga0466969_0415751 3300044656 Unclassified 611
152 Ga0466963_0017577 3300044694 Bacteria 4460
153 Ga0466970_0493991 3300044765 Bacteria 704
154 Ga0466970_0671787 3300044765 Unclassified 603
155 Ga0466959_0042312 3300045049 Bacteria 3360
156 Ga0466967_0333763 3300045976 Bacteria 1465
157 Ga0495592_0535413 3300046454 Bacteria 722
158 Ga0495592_0905944 3300046454 Bacteria 518
159 Ga0495638_0171315 3300046460 Bacteria 1245
160 Ga0495651_0075614 3300046462 Bacteria 2553
161 Ga0495580_1001036 3300046472 Bacteria 533
162 Ga0495662_0232896 3300046476 Bacteria 908
163 Ga0495664_0153820 3300046477 Bacteria 1395
164 Ga0495594_0658254 3300046499 Bacteria 593
165 Ga0495606_0397996 3300046507 Bacteria 718
166 Ga0495618_0257529 3300046514 Bacteria 1093
167 Ga0495630_0785617 3300046517 Bacteria 727
168 Ga0495632_0370824 3300046519 Unclassified 628
169 Ga0495622_0017725 3300046557 Bacteria 3314
170 Ga0495667_0964418 3300046559 Bacteria 521
171 Ga0495656_0055070 3300046615 Bacteria 1714
172 Ga0495657_0086872 3300046675 Bacteria 2013
173 Ga0495657_0671227 3300046675 Bacteria 597
174 Ga0495623_0162217 3300046679 Bacteria 1313
175 Ga0495658_0184964 3300046683 Bacteria 1293
176 Ga0495613_0278892 3300046689 Bacteria 1161
177 Ga0495604_0750797 3300047317 Bacteria 617
178 Ga0495672_0232824 3300047320 Bacteria 903
179 Ga0495680_0085091 3300047322 Bacteria 2382
180 Ga0495684_0503378 3300047471 Bacteria 832
181 Ga0496102_1225977 3300048905 Bacteria 670
182 Ga0496103_0578412 3300048906 Bacteria 716
183 Ga0496106_0008579 3300048909 Bacteria 7563
184 Ga0496108_1667124 3300048911 Bacteria 526
185 Ga0496112_0229681 3300048915 Bacteria 1810
186 Ga0496117_0042654 3300048920 Bacteria 3308
187 Ga0496118_0023165 3300048921 Bacteria 5404
188 Ga0496119_0235870 3300048922 Bacteria 929
189 Ga0496121_0001081 3300048924 Bacteria 48118
190 Ga0496121_0028894 3300048924 Bacteria 5149
191 Ga0496121_0058363 3300048924 Bacteria 3191
192 Ga0496121_0257052 3300048924 Bacteria 1208
193 Ga0496124_0000722 3300048927 Bacteria 54175
194 Ga0496125_0179327 3300048928 Bacteria 1414
195 Ga0496126_0007084 3300048929 Bacteria 12348
196 Ga0496126_0053298 3300048929 Bacteria 3671
197 Ga0496126_0089300 3300048929 Bacteria 2713
198 Ga0496126_0216378 3300048929 Bacteria 1611
199 Ga0496126_0682326 3300048929 Bacteria 800
200 Ga0496126_1216821 3300048929 Bacteria 553
201 Ga0501072_0014911 3300049588 Bacteria 5957
202 Ga0501081_1157372 3300049743 Bacteria 586
203 Ga0501044_0928786 3300049823 Bacteria 744
204 Ga0495655_0236184 3300053083 Bacteria 610
205 Ga0495619_0112928 3300053085 Bacteria 1858
206 Ga0495619_0189233 3300053085 Bacteria 1424
207 Ga0495619_0653556 3300053085 Bacteria 717
208 Ga0500644_0332343 3300053088 Bacteria 655
209 Ga0500647_0138871 3300053091 Bacteria 1141
210 Ga0500651_0012062 3300053093 Bacteria 5227
211 Ga0500651_0545352 3300053093 Bacteria 635
212 Ga0500566_0091803 3300053094 Bacteria 1678
213 Ga0500648_268624 3300053097 Bacteria 782
214 Ga0500572_001066 3300053111 Bacteria 8130
215 Ga0500572_250077 3300053111 Bacteria 577
216 Ga0500595_021649 3300053119 Bacteria 2291
217 Ga0500642_0009138 3300053130 Bacteria 3424
218 Ga0500559_0000315 3300053136 Bacteria 36760
219 Ga0500559_0085279 3300053136 Bacteria 1440
220 Ga0500564_334326 3300053138 Bacteria 569
221 Ga0500573_0186623 3300053140 Bacteria 1110
222 Ga0500590_061113 3300053148 Bacteria 1892
223 Ga0500603_031881 3300053150 Bacteria 1364
224 Ga0500604_0157170 3300053151 Bacteria 774
225 Ga0500619_054592 3300053154 Bacteria 1302
226 Ga0500627_0380051 3300053158 Bacteria 605
227 Ga0500639_068501 3300053163 Bacteria 1813
228 Ga0500639_135485 3300053163 Bacteria 1160
229 Ga0500636_0006383 3300053177 Bacteria 6766
230 Ga0500636_0064008 3300053177 Bacteria 2142
231 Ga0500636_0138164 3300053177 Bacteria 1351
232 Ga0500637_0176826 3300053178 Bacteria 1224
233 Ga0500552_001654 3300053733 Bacteria 2129
234 Ga0500596_001701 3300053735 Bacteria 4456
235 Ga0500596_007250 3300053735 Bacteria 1827
236 Ga0500601_016712 3300053737 Bacteria 838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053737 Ga0500601_016712 Ga0500601_016712_259_564 90
2 3300009098 Ga0105245_12743604 Ga0105245_127436041 93
3 3300006028 Ga0070717_10021688 Ga0070717_100216881 94
4 3300006163 Ga0070715_10000173 Ga0070715_100001738 94
5 3300006173 Ga0070716_100005501 Ga0070716_1000055015 94
6 3300006175 Ga0070712_100006464 Ga0070712_1000064647 94
7 3300009174 Ga0105241_11468026 Ga0105241_114680262 94
8 3300025914 Ga0207671_10793986 Ga0207671_107939863 94
9 3300035695 Ga0373927_0021340 Ga0373927_0021340_3408_3692 94
10 3300035724 Ga0373933_0000368 Ga0373933_0000368_8862_9146 94
11 3300035725 Ga0373947_0216641 Ga0373947_0216641_258_542 94
12 3300037068 Ga0373925_0376693 Ga0373925_0376693_747_1031 94
13 3300046689 Ga0495613_0278892 Ga0495613_0278892_301_585 94
14 3300048915 Ga0496112_0229681 Ga0496112_0229681_14_298 94
15 iso_pu_bacteria 2508501128 2509151452 94
16 3300021388 Ga0213875_10106723 Ga0213875_101067233 95
17 3300037853 Ga0436364_1465683 Ga0436364_1465683_807_1112 95
18 3300039447 Ga0436361_0367504 Ga0436361_0367504_938_1243 95
19 iso_pu_bacteria 2842038055 2842040222 95
20 iso_pu_bacteria 2842045827 2842046833 95
21 3300021361 Ga0213872_10115126 Ga0213872_101151262 96
22 3300021361 Ga0213872_10160025 Ga0213872_101600252 96
23 3300021377 Ga0213874_10149559 Ga0213874_101495591 96
24 3300021441 Ga0213871_10009615 Ga0213871_100096152 96
25 3300039438 Ga0436360_0202328 Ga0436360_0202328_462_761 96
26 3300039447 Ga0436361_1167758 Ga0436361_1167758_1672_1971 96
27 3300039450 Ga0436363_0497072 Ga0436363_0497072_666_965 96
28 3300039453 Ga0436362_0453326 Ga0436362_0453326_252_551 96
29 3300005539 Ga0068853_100230081 Ga0068853_1002300812 97
30 3300005577 Ga0068857_101166130 Ga0068857_1011661301 97
31 3300005578 Ga0068854_102185665 Ga0068854_1021856651 97
32 3300013102 Ga0157371_10081698 Ga0157371_100816983 97
33 3300013104 Ga0157370_10220013 Ga0157370_102200132 97
34 3300013307 Ga0157372_11467168 Ga0157372_114671681 97
35 3300026116 Ga0207674_10943970 Ga0207674_109439701 97
36 3300031250 Ga0265331_10309864 Ga0265331_103098642 97
37 3300031250 Ga0265331_10473847 Ga0265331_104738471 97
38 3300046462 Ga0495651_0075614 Ga0495651_0075614_601_903 97
39 3300046679 Ga0495623_0162217 Ga0495623_0162217_927_1229 97
40 3300049588 Ga0501072_0014911 Ga0501072_0014911_2629_2928 97
41 3300049743 Ga0501081_1157372 Ga0501081_1157372_130_429 97
42 3300049823 Ga0501044_0928786 Ga0501044_0928786_358_657 97
43 iso_pu_bacteria 2513237141 2513889979 97
44 3300005434 Ga0070709_10002687 Ga0070709_100026879 98
45 3300005435 Ga0070714_100004549 Ga0070714_1000045492 98
46 3300005436 Ga0070713_100001186 Ga0070713_10000118614 98
47 3300005437 Ga0070710_10001085 Ga0070710_100010859 98
48 3300005439 Ga0070711_100159808 Ga0070711_1001598082 98
49 3300005842 Ga0068858_100332339 Ga0068858_1003323392 98
50 3300005843 Ga0068860_100001463 Ga0068860_1000014635 98
51 3300005843 Ga0068860_101354991 Ga0068860_1013549912 98
52 3300006028 Ga0070717_10073799 Ga0070717_100737993 98
53 3300006358 Ga0068871_100293661 Ga0068871_1002936612 98
54 3300007788 Ga0099795_10654132 Ga0099795_106541321 98
55 3300009092 Ga0105250_10314677 Ga0105250_103146771 98
56 3300009101 Ga0105247_10008407 Ga0105247_100084076 98
57 3300009545 Ga0105237_10197232 Ga0105237_101972322 98
58 3300009545 Ga0105237_10425128 Ga0105237_104251282 98
59 3300011119 Ga0105246_10740717 Ga0105246_107407172 98
60 3300013297 Ga0157378_10544349 Ga0157378_105443492 98
61 3300013306 Ga0163162_12124503 Ga0163162_121245031 98
62 3300014968 Ga0157379_11246940 Ga0157379_112469401 98
63 3300021384 Ga0213876_10063322 Ga0213876_100633222 98
64 3300021388 Ga0213875_10282558 Ga0213875_102825581 98
65 3300025898 Ga0207692_10005040 Ga0207692_100050404 98
66 3300025900 Ga0207710_10027482 Ga0207710_100274823 98
67 3300025905 Ga0207685_10048936 Ga0207685_100489363 98
68 3300025914 Ga0207671_10454775 Ga0207671_104547752 98
69 3300025915 Ga0207693_10000445 Ga0207693_100004459 98
70 3300025929 Ga0207664_10002003 Ga0207664_1000200310 98
71 3300025929 Ga0207664_11026530 Ga0207664_110265301 98
72 3300025939 Ga0207665_10000651 Ga0207665_1000065112 98
73 3300025939 Ga0207665_11603549 Ga0207665_116035491 98
74 3300025981 Ga0207640_10829812 Ga0207640_108298121 98
75 3300026035 Ga0207703_10723665 Ga0207703_107236651 98
76 3300026088 Ga0207641_10361367 Ga0207641_103613672 98
77 3300026142 Ga0207698_10698509 Ga0207698_106985091 98
78 3300028379 Ga0268266_10663809 Ga0268266_106638092 98
79 3300028381 Ga0268264_10000065 Ga0268264_10000065142 98
80 3300028556 Ga0265337_1101611 Ga0265337_11016111 98
81 3300028573 Ga0265334_10015261 Ga0265334_100152611 98
82 3300028653 Ga0265323_10002476 Ga0265323_100024762 98
83 3300028666 Ga0265336_10139136 Ga0265336_101391361 98
84 3300028800 Ga0265338_10000321 Ga0265338_1000032170 98
85 3300029957 Ga0265324_10006568 Ga0265324_100065686 98
86 3300030521 Ga0307511_10015806 Ga0307511_100158065 98
87 3300031090 Ga0265760_10111696 Ga0265760_101116961 98
88 3300031250 Ga0265331_10054658 Ga0265331_100546581 98
89 3300031507 Ga0307509_10299383 Ga0307509_102993832 98
90 3300031616 Ga0307508_10428258 Ga0307508_104282581 98
91 3300031712 Ga0265342_10032861 Ga0265342_100328612 98
92 3300031730 Ga0307516_10040779 Ga0307516_100407792 98
93 3300031730 Ga0307516_10768928 Ga0307516_107689281 98
94 3300033179 Ga0307507_10035833 Ga0307507_100358332 98
95 3300035113 Ga0373936_0498687 Ga0373936_0498687_140_445 98
96 3300035692 Ga0373935_0013234 Ga0373935_0013234_3523_3828 98
97 3300035695 Ga0373927_0019712 Ga0373927_0019712_4085_4390 98
98 3300035724 Ga0373933_0273943 Ga0373933_0273943_181_486 98
99 3300036459 Ga0372808_014463 Ga0372808_014463_526_831 98
100 3300037068 Ga0373925_0235006 Ga0373925_0235006_428_733 98
101 3300037853 Ga0436364_0597209 Ga0436364_0597209_1465_1770 98
102 3300037853 Ga0436364_1044312 Ga0436364_1044312_898_1203 98
103 3300039437 Ga0436365_0618227 Ga0436365_0618227_112_417 98
104 3300039437 Ga0436365_1129200 Ga0436365_1129200_253_558 98
105 3300039437 Ga0436365_1852334 Ga0436365_1852334_582_887 98
106 3300039438 Ga0436360_1050510 Ga0436360_1050510_884_1189 98
107 3300039447 Ga0436361_0357476 Ga0436361_0357476_235_540 98
108 3300041459 Ga0451800_0351737 Ga0451800_0351737_264_569 98
109 3300041498 Ga0451841_0727074 Ga0451841_0727074_219_524 98
110 3300044656 Ga0466969_0415751 Ga0466969_0415751_117_422 98
111 3300044694 Ga0466963_0017577 Ga0466963_0017577_708_1013 98
112 3300044765 Ga0466970_0493991 Ga0466970_0493991_253_558 98
113 3300044765 Ga0466970_0671787 Ga0466970_0671787_149_454 98
114 3300045049 Ga0466959_0042312 Ga0466959_0042312_1352_1657 98
115 3300045976 Ga0466967_0333763 Ga0466967_0333763_714_1019 98
116 3300046454 Ga0495592_0535413 Ga0495592_0535413_369_677 98
117 3300046454 Ga0495592_0905944 Ga0495592_0905944_185_490 98
118 3300046472 Ga0495580_1001036 Ga0495580_1001036_93_398 98
119 3300046476 Ga0495662_0232896 Ga0495662_0232896_123_428 98
120 3300046477 Ga0495664_0153820 Ga0495664_0153820_886_1191 98
121 3300046499 Ga0495594_0658254 Ga0495594_0658254_41_346 98
122 3300046507 Ga0495606_0397996 Ga0495606_0397996_262_570 98
123 3300046514 Ga0495618_0257529 Ga0495618_0257529_29_334 98
124 3300046517 Ga0495630_0785617 Ga0495630_0785617_74_379 98
125 3300046519 Ga0495632_0370824 Ga0495632_0370824_52_357 98
126 3300046557 Ga0495622_0017725 Ga0495622_0017725_368_673 98
127 3300046559 Ga0495667_0964418 Ga0495667_0964418_110_415 98
128 3300046675 Ga0495657_0086872 Ga0495657_0086872_1482_1787 98
129 3300046675 Ga0495657_0671227 Ga0495657_0671227_167_472 98
130 3300046683 Ga0495658_0184964 Ga0495658_0184964_76_381 98
131 3300047317 Ga0495604_0750797 Ga0495604_0750797_130_435 98
132 3300047322 Ga0495680_0085091 Ga0495680_0085091_1175_1480 98
133 3300047471 Ga0495684_0503378 Ga0495684_0503378_175_480 98
134 3300048906 Ga0496103_0578412 Ga0496103_0578412_259_567 98
135 3300048909 Ga0496106_0008579 Ga0496106_0008579_6157_6462 98
136 3300048911 Ga0496108_1667124 Ga0496108_1667124_154_459 98
137 3300048920 Ga0496117_0042654 Ga0496117_0042654_2816_3121 98
138 3300048921 Ga0496118_0023165 Ga0496118_0023165_3923_4228 98
139 3300048922 Ga0496119_0235870 Ga0496119_0235870_485_790 98
140 3300048924 Ga0496121_0001081 Ga0496121_0001081_40900_41205 98
141 3300048924 Ga0496121_0058363 Ga0496121_0058363_1415_1720 98
142 3300048924 Ga0496121_0257052 Ga0496121_0257052_220_525 98
143 3300048927 Ga0496124_0000722 Ga0496124_0000722_13028_13333 98
144 3300048928 Ga0496125_0179327 Ga0496125_0179327_738_1043 98
145 3300048929 Ga0496126_0007084 Ga0496126_0007084_11911_12216 98
146 3300048929 Ga0496126_0053298 Ga0496126_0053298_444_749 98
147 3300048929 Ga0496126_0216378 Ga0496126_0216378_901_1206 98
148 3300048929 Ga0496126_0682326 Ga0496126_0682326_445_750 98
149 3300048929 Ga0496126_1216821 Ga0496126_1216821_137_442 98
150 3300053085 Ga0495619_0112928 Ga0495619_0112928_1384_1689 98
151 3300053085 Ga0495619_0189233 Ga0495619_0189233_10_315 98
152 3300053091 Ga0500647_0138871 Ga0500647_0138871_74_379 98
153 3300053093 Ga0500651_0545352 Ga0500651_0545352_83_388 98
154 3300053094 Ga0500566_0091803 Ga0500566_0091803_436_741 98
155 3300053097 Ga0500648_268624 Ga0500648_268624_166_471 98
156 3300053111 Ga0500572_001066 Ga0500572_001066_1130_1435 98
157 3300053111 Ga0500572_250077 Ga0500572_250077_111_416 98
158 3300053119 Ga0500595_021649 Ga0500595_021649_1899_2204 98
159 3300053136 Ga0500559_0000315 Ga0500559_0000315_8521_8826 98
160 3300053136 Ga0500559_0085279 Ga0500559_0085279_594_899 98
161 3300053138 Ga0500564_334326 Ga0500564_334326_229_534 98
162 3300053140 Ga0500573_0186623 Ga0500573_0186623_347_652 98
163 3300053148 Ga0500590_061113 Ga0500590_061113_1390_1695 98
164 3300053150 Ga0500603_031881 Ga0500603_031881_562_867 98
165 3300053154 Ga0500619_054592 Ga0500619_054592_444_749 98
166 3300053163 Ga0500639_068501 Ga0500639_068501_685_990 98
167 3300053163 Ga0500639_135485 Ga0500639_135485_441_746 98
168 3300053177 Ga0500636_0006383 Ga0500636_0006383_550_873 98
169 3300053177 Ga0500636_0064008 Ga0500636_0064008_742_1047 98
170 3300053177 Ga0500636_0138164 Ga0500636_0138164_795_1100 98
171 3300053178 Ga0500637_0176826 Ga0500637_0176826_845_1150 98
172 3300053733 Ga0500552_001654 Ga0500552_001654_492_797 98
173 3300053735 Ga0500596_001701 Ga0500596_001701_2208_2513 98
174 3300053735 Ga0500596_007250 Ga0500596_007250_707_1012 98
175 3300005327 Ga0070658_10150173 Ga0070658_101501732 99
176 3300005329 Ga0070683_100017979 Ga0070683_1000179793 99
177 3300005331 Ga0070670_100451844 Ga0070670_1004518442 99
178 3300005336 Ga0070680_100042514 Ga0070680_1000425142 99
179 3300005339 Ga0070660_100009001 Ga0070660_1000090015 99
180 3300005439 Ga0070711_101146510 Ga0070711_1011465101 99
181 3300005456 Ga0070678_100818370 Ga0070678_1008183701 99
182 3300005458 Ga0070681_10279438 Ga0070681_102794381 99
183 3300005458 Ga0070681_10450954 Ga0070681_104509542 99
184 3300005530 Ga0070679_100104736 Ga0070679_1001047362 99
185 3300005535 Ga0070684_100246456 Ga0070684_1002464562 99
186 3300005539 Ga0068853_100003512 Ga0068853_1000035126 99
187 3300005563 Ga0068855_100146049 Ga0068855_1001460492 99
188 3300005577 Ga0068857_100025802 Ga0068857_1000258027 99
189 3300005614 Ga0068856_100001102 Ga0068856_10000110223 99
190 3300005834 Ga0068851_10004151 Ga0068851_100041515 99
191 3300006028 Ga0070717_10562890 Ga0070717_105628901 99
192 3300006038 Ga0075365_10685568 Ga0075365_106855682 99
193 3300006175 Ga0070712_100072790 Ga0070712_1000727902 99
194 3300009093 Ga0105240_10018413 Ga0105240_100184137 99
195 3300009101 Ga0105247_11625261 Ga0105247_116252611 99
196 3300009545 Ga0105237_10068239 Ga0105237_100682392 99
197 3300009551 Ga0105238_10169549 Ga0105238_101695492 99
198 3300010159 Ga0099796_10196846 Ga0099796_101968462 99
199 3300010375 Ga0105239_10041984 Ga0105239_100419842 99
200 3300013104 Ga0157370_10336125 Ga0157370_103361252 99
201 3300013105 Ga0157369_10019914 Ga0157369_100199147 99
202 3300014325 Ga0163163_10920813 Ga0163163_109208132 99
203 3300014326 Ga0157380_11363495 Ga0157380_113634951 99
204 3300025321 Ga0207656_10011036 Ga0207656_100110363 99
205 3300025898 Ga0207692_10477818 Ga0207692_104778182 99
206 3300025912 Ga0207707_10005224 Ga0207707_100052248 99
207 3300025914 Ga0207671_10215535 Ga0207671_102155351 99
208 3300025915 Ga0207693_10061321 Ga0207693_100613212 99
209 3300025917 Ga0207660_10152379 Ga0207660_101523792 99
210 3300025919 Ga0207657_10086040 Ga0207657_100860402 99
211 3300025921 Ga0207652_10265875 Ga0207652_102658752 99
212 3300025924 Ga0207694_10204430 Ga0207694_102044301 99
213 3300025925 Ga0207650_10365328 Ga0207650_103653282 99
214 3300025936 Ga0207670_10372818 Ga0207670_103728181 99
215 3300025944 Ga0207661_10178265 Ga0207661_101782652 99
216 3300025949 Ga0207667_10088277 Ga0207667_100882772 99
217 3300025972 Ga0207668_10190754 Ga0207668_101907542 99
218 3300026078 Ga0207702_10001047 Ga0207702_100010476 99
219 3300026116 Ga0207674_10012072 Ga0207674_1001207210 99
220 3300026121 Ga0207683_11124108 Ga0207683_111241081 99
221 3300026142 Ga0207698_10993532 Ga0207698_109935322 99
222 3300028379 Ga0268266_10825131 Ga0268266_108251312 99
223 3300031711 Ga0265314_10001300 Ga0265314_100013007 99
224 3300031712 Ga0265342_10039127 Ga0265342_100391272 99
225 3300037312 Ga0395899_0714386 Ga0395899_0714386_255_572 99
226 3300037418 Ga0395900_0838304 Ga0395900_0838304_393_710 99
227 3300037466 Ga0395898_0231247 Ga0395898_0231247_293_610 99
228 3300046460 Ga0495638_0171315 Ga0495638_0171315_462_770 99
229 3300046615 Ga0495656_0055070 Ga0495656_0055070_859_1167 99
230 3300047320 Ga0495672_0232824 Ga0495672_0232824_236_544 99
231 3300048905 Ga0496102_1225977 Ga0496102_1225977_211_519 99
232 3300048924 Ga0496121_0028894 Ga0496121_0028894_1032_1340 99
233 3300048929 Ga0496126_0089300 Ga0496126_0089300_763_1071 99
234 3300053083 Ga0495655_0236184 Ga0495655_0236184_76_384 99
235 3300053085 Ga0495619_0653556 Ga0495619_0653556_151_459 99
236 3300053088 Ga0500644_0332343 Ga0500644_0332343_18_326 99
237 3300053093 Ga0500651_0012062 Ga0500651_0012062_2514_2822 99
238 3300053130 Ga0500642_0009138 Ga0500642_0009138_2433_2741 99
239 3300053151 Ga0500604_0157170 Ga0500604_0157170_369_677 99
240 3300053158 Ga0500627_0380051 Ga0500627_0380051_222_530 99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mfj-assembly1.cif.gz_A solution structure of blo t 19, a minor dust mite allergen from blomia tropicalis 0.6601 32 61
3t2n-assembly1.cif.gz_A human hepsin protease in complex with the fab fragment of an inhibitory antibody 0.6171 41 99
3t2n-assembly2.cif.gz_B human hepsin protease in complex with the fab fragment of an inhibitory antibody 0.6158 41 99
1z8g-assembly1.cif.gz_A crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate. 0.604 41 99
5ce1-assembly1.cif.gz_A crystal structure of serine protease hepsin in complex with inhibitor 0.5766 41 99
ID Description Score Start End Superfamily
af_Q9H3S3_116_213_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6642 47 99 3.10.250.10
af_A5PF55_136_229_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.661 25 68 3.10.250.10
af_A0A2R8Q7N1_200_302_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6454 42 97 3.10.250.10
af_P98073_679_785_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.6088 46 97 3.10.250.10
af_P13379_29_134_3.10.250.10 Alpha Beta;Roll;Mac-2 Binding Protein;SRCR-like domain 0.5909 37 99 3.10.250.10
ID Description Score Start End GO Terms
AF-A0A537PRQ5-F1-model_v4 DUF3551 domain-containing protein 0.8231 10 99
AF-Q07Q43-F1-model_v4 Uncharacterized protein 0.7815 11 99
AF-A0A2P5LXW3-F1-model_v4 Secreted protein 0.7479 10 99
AF-A0A366FMN9-F1-model_v4 Uncharacterized protein 0.7382 12 99
AF-A0A1Q4DG29-F1-model_v4 DUF4189 domain-containing protein 0.7332 10 99

Feature Viewer

pLDDT pTM Quality
68 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map