F353343

General Info

Members Datasets Scaffolds Average Seq Length
240 152 226 211

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842903701|2842905366
Length 211
Sequence LDENDLWFPDPSLADSDGLLAIGGDLSLARLELAYNHGIFPWYDDQTPILWYAPHERFILFPNELNVSKSMRKIIRSSVFTVTYNMAFKDVITNCAKVKRSGQDGTWITKEMQEAYVNLNKEGLAISVDVWQNAQLCGGLYGVICGKKQHVFCGESMFSLLPNASKLALIYLCNLNKFELIDCQIESEHLKSMGARMISREHYQKILHAVH

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
6 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
7 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
8 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
104 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
105 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
144 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
145 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
146 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 0
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.67
Nodule 0
Rhizoplane 0.42
Rhizosphere 82.08
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10083712 3300001979 Bacteria 832
2 JGI24737J22298_10000950 3300001990 Bacteria 10292
3 JGI24737J22298_10035559 3300001990 Bacteria 1541
4 JGI24735J21928_10000027 3300002067 Bacteria 83494
5 JGI25162J39368_1000408 3300002737 Bacteria 35183
6 JGI25162J39368_1001130 3300002737 Bacteria 16055
7 JGI25157J39369_1004104 3300002741 Bacteria 2730
8 JGI25164J39214_1001295 3300002772 Bacteria 6355
9 JGI25165J46597_1001079 3300003214 Bacteria 17498
10 rootH1_10031584 3300003316 Bacteria 16796
11 rootH2_10076799 3300003320 Bacteria 3017
12 rootL2_10008520 3300003322 Bacteria 11355
13 rootH1_10007236 3300003323 Bacteria 15279
14 rootH1_10140687 3300003323 Bacteria 4346
15 rootH1_10285976 3300003323 Unclassified 2260
16 Ga0065714_10007283 3300005288 Bacteria 4802
17 Ga0070676_10002416 3300005328 Bacteria 9573
18 Ga0070683_100017779 3300005329 Bacteria 6282
19 Ga0068868_100104161 3300005338 Bacteria 2299
20 Ga0070660_100020336 3300005339 Bacteria 4877
21 Ga0070675_100386108 3300005354 Bacteria 1247
22 Ga0070659_100000412 3300005366 Bacteria 32519
23 Ga0070678_100072911 3300005456 Bacteria 2575
24 Ga0070662_100000043 3300005457 Bacteria 70660
25 Ga0070684_100073586 3300005535 Bacteria 3011
26 Ga0068853_100084845 3300005539 Bacteria 2776
27 Ga0070665_100000017 3300005548 Bacteria 448013
28 Ga0068855_100000060 3300005563 Bacteria 133838
29 Ga0068855_100000489 3300005563 Bacteria 48884
30 Ga0068855_100026070 3300005563 Bacteria 6992
31 Ga0068855_100305497 3300005563 Bacteria 1761
32 Ga0068855_100620674 3300005563 Bacteria 1164
33 Ga0068857_100038001 3300005577 Bacteria 4265
34 Ga0068857_100259691 3300005577 Bacteria 1594
35 Ga0068854_100256417 3300005578 Bacteria 1399
36 Ga0068856_100015573 3300005614 Bacteria 7351
37 Ga0068856_100219196 3300005614 Bacteria 1918
38 Ga0068852_100001476 3300005616 Bacteria 15913
39 Ga0068852_100064985 3300005616 Bacteria 3182
40 Ga0068866_10101169 3300005718 Bacteria 1590
41 Ga0068858_100107579 3300005842 Bacteria 2603
42 Ga0075366_10000032 3300006195 Bacteria 48382
43 Ga0075366_10064659 3300006195 Bacteria 2175
44 Ga0075366_10237352 3300006195 Unclassified 1111
45 Ga0097621_100000099 3300006237 Bacteria 48404
46 Ga0075370_10116657 3300006353 Unclassified 1552
47 Ga0068871_100000290 3300006358 Bacteria 35074
48 Ga0075436_100154075 3300006914 Bacteria 1618
49 Ga0105240_10035982 3300009093 Bacteria 6374
50 Ga0105240_10075740 3300009093 Bacteria 4150
51 Ga0105240_10079149 3300009093 Bacteria 4045
52 Ga0105240_10347168 3300009093 Bacteria 1684
53 Ga0105243_10665228 3300009148 Unclassified 1011
54 Ga0105241_10001269 3300009174 Bacteria 19251
55 Ga0105241_10022435 3300009174 Bacteria 4676
56 Ga0105241_10925882 3300009174 Bacteria 811
57 Ga0105242_10032968 3300009176 Bacteria 4145
58 Ga0105237_10000198 3300009545 Bacteria 85302
59 Ga0105237_10001359 3300009545 Bacteria 32392
60 Ga0105237_10006338 3300009545 Bacteria 13151
61 Ga0105237_10013563 3300009545 Bacteria 8537
62 Ga0105237_10021909 3300009545 Bacteria 6562
63 Ga0105237_10881726 3300009545 Bacteria 902
64 Ga0105238_10018391 3300009551 Bacteria 7113
65 Ga0105238_10146766 3300009551 Bacteria 2335
66 Ga0105238_10388702 3300009551 Bacteria 1387
67 Ga0105239_10000008 3300010375 Bacteria 376925
68 Ga0105239_10000130 3300010375 Bacteria 105894
69 Ga0105239_10001373 3300010375 Bacteria 32651
70 Ga0105239_10002395 3300010375 Bacteria 23910
71 Ga0105239_10035545 3300010375 Bacteria 5471
72 Ga0105239_10079442 3300010375 Bacteria 3610
73 Ga0105239_10153183 3300010375 Bacteria 2573
74 Ga0105239_10395896 3300010375 Bacteria 1563
75 Ga0105239_10468821 3300010375 Unclassified 1430
76 Ga0105246_10034040 3300011119 Bacteria 3390
77 Ga0105246_10879867 3300011119 Bacteria 802
78 Ga0157373_10000327 3300013100 Bacteria 38493
79 Ga0157373_10005250 3300013100 Bacteria 9726
80 Ga0157373_10179221 3300013100 Bacteria 1492
81 Ga0157371_10000836 3300013102 Bacteria 35185
82 Ga0157371_10009832 3300013102 Bacteria 7499
83 Ga0157370_10074114 3300013104 Bacteria 3211
84 Ga0157370_10341698 3300013104 Bacteria 1380
85 Ga0157370_10875312 3300013104 Bacteria 816
86 Ga0157369_10469819 3300013105 Bacteria 1302
87 Ga0157369_10469823 3300013105 Bacteria 1302
88 Ga0157374_10000360 3300013296 Bacteria 42177
89 Ga0157378_10027617 3300013297 Bacteria 5007
90 Ga0163162_10000051 3300013306 Bacteria 117695
91 Ga0163162_10058924 3300013306 Bacteria 3870
92 Ga0163162_10132479 3300013306 Bacteria 2602
93 Ga0157372_10000158 3300013307 Bacteria 73709
94 Ga0157372_10000538 3300013307 Bacteria 41695
95 Ga0157372_10000980 3300013307 Bacteria 31160
96 Ga0157372_10187012 3300013307 Bacteria 2398
97 Ga0157372_10815442 3300013307 Unclassified 1084
98 Ga0157375_10005633 3300013308 Bacteria 10905
99 Ga0157375_10227729 3300013308 Bacteria 2023
100 Ga0157377_10011833 3300014745 Bacteria 4368
101 Ga0163161_10027842 3300017792 Bacteria 4010
102 Ga0213872_10003265 3300021361 Bacteria 9050
103 Ga0209563_109129 3300025230 Bacteria 1521
104 Ga0207427_100159 3300025231 Bacteria 76256
105 Ga0209437_100021 3300025233 Bacteria 646400
106 Ga0209437_100144 3300025233 Bacteria 164794
107 Ga0209026_1000246 3300025250 Bacteria 69164
108 Ga0209129_1010067 3300025258 Bacteria 2405
109 Ga0209233_1000035 3300025261 Bacteria 568478
110 Ga0209233_1000524 3300025261 Bacteria 22083
111 Ga0209455_1001628 3300025272 Bacteria 9806
112 Ga0207642_10443153 3300025899 Bacteria 785
113 Ga0207647_10000036 3300025904 Bacteria 98204
114 Ga0207647_10000346 3300025904 Bacteria 37532
115 Ga0207647_10127205 3300025904 Bacteria 1499
116 Ga0207645_10000312 3300025907 Bacteria 40968
117 Ga0207705_10000090 3300025909 Bacteria 113233
118 Ga0207705_10130704 3300025909 Bacteria 1869
119 Ga0207654_10073156 3300025911 Bacteria 2042
120 Ga0207654_10077552 3300025911 Bacteria 1992
121 Ga0207695_10000127 3300025913 Bacteria 227338
122 Ga0207695_10024261 3300025913 Bacteria 6829
123 Ga0207695_10036334 3300025913 Bacteria 5327
124 Ga0207695_10071090 3300025913 Bacteria 3554
125 Ga0207671_10000254 3300025914 Bacteria 79974
126 Ga0207671_10004576 3300025914 Bacteria 13143
127 Ga0207671_10023341 3300025914 Unclassified 4665
128 Ga0207671_10050514 3300025914 Bacteria 3079
129 Ga0207671_10080553 3300025914 Bacteria 2441
130 Ga0207671_10601333 3300025914 Bacteria 876
131 Ga0207671_10848891 3300025914 Bacteria 723
132 Ga0207657_10089742 3300025919 Bacteria 2566
133 Ga0207657_10131676 3300025919 Bacteria 2049
134 Ga0207694_10205626 3300025924 Bacteria 1603
135 Ga0207690_10000049 3300025932 Bacteria 113589
136 Ga0207690_10009341 3300025932 Bacteria 5825
137 Ga0207706_10000466 3300025933 Bacteria 43209
138 Ga0207686_10021688 3300025934 Bacteria 3690
139 Ga0207704_10000123 3300025938 Bacteria 41995
140 Ga0207661_10014978 3300025944 Bacteria 5694
141 Ga0207667_10000033 3300025949 Bacteria 314353
142 Ga0207667_10000408 3300025949 Bacteria 58389
143 Ga0207667_10056917 3300025949 Bacteria 4105
144 Ga0207667_10139435 3300025949 Bacteria 2497
145 Ga0207640_10341100 3300025981 Bacteria 1200
146 Ga0207677_10029951 3300026023 Bacteria 3467
147 Ga0207703_10222577 3300026035 Bacteria 1688
148 Ga0207639_10008486 3300026041 Bacteria 7043
149 Ga0207639_10227745 3300026041 Bacteria 1614
150 Ga0207639_11116192 3300026041 Bacteria 740
151 Ga0207702_10041295 3300026078 Bacteria 3868
152 Ga0207702_10191525 3300026078 Bacteria 1890
153 Ga0207648_10000913 3300026089 Bacteria 33285
154 Ga0207674_10049622 3300026116 Bacteria 4291
155 Ga0207674_10329053 3300026116 Bacteria 1478
156 Ga0207683_10042837 3300026121 Bacteria 3953
157 Ga0207698_10141257 3300026142 Bacteria 2075
158 Ga0209995_1018273 3300027471 Bacteria 1156
159 Ga0268266_10000037 3300028379 Bacteria 342368
160 Ga0265338_10057308 3300028800 Bacteria 3448
161 Ga0316177_1116921 3300030731 Bacteria 31477
162 Ga0316183_1054866 3300030742 Bacteria 36207
163 Ga0316181_1126086 3300030744 Bacteria 12112
164 Ga0265327_10176893 3300031251 Unclassified 978
165 Ga0307509_10049280 3300031507 Bacteria 4517
166 Ga0307412_10144394 3300031911 Bacteria 1747
167 Ga0307409_100249384 3300031995 Unclassified 1622
168 Ga0307414_10081165 3300032004 Bacteria 2374
169 Ga0307510_10001091 3300033180 Bacteria 28923
170 Ga0395899_0012363 3300037312 Bacteria 6536
171 Ga0395900_0000478 3300037418 Bacteria 56604
172 Ga0395900_0006013 3300037418 Bacteria 12660
173 Ga0395900_0219327 3300037418 Bacteria 1918
174 Ga0395898_0053528 3300037466 Bacteria 3942
175 Ga0395898_0615408 3300037466 Unclassified 1029
176 Ga0395901_0001267 3300038443 Bacteria 26781
177 Ga0436361_0530171 3300039447 Bacteria 11212
178 Ga0439448_0040090 3300042005 Unclassified 1511
179 Ga0439455_0026009 3300042012 Bacteria 1426
180 Ga0495638_0012148 3300046460 Bacteria 5912
181 Ga0495651_0299451 3300046462 Bacteria 1079
182 Ga0495585_0000308 3300046492 Bacteria 48809
183 Ga0495585_0324699 3300046492 Bacteria 752
184 Ga0495596_0025001 3300046500 Bacteria 2416
185 Ga0495583_0008886 3300046506 Bacteria 6075
186 Ga0495606_0000021 3300046507 Bacteria 271238
187 Ga0495606_0005365 3300046507 Bacteria 12298
188 Ga0495606_0028874 3300046507 Bacteria 3905
189 Ga0495610_0007113 3300046512 Bacteria 7547
190 Ga0495616_0001331 3300046513 Bacteria 17264
191 Ga0495631_0000646 3300046518 Bacteria 22598
192 Ga0495652_0047218 3300046529 Bacteria 3693
193 Ga0495652_0094110 3300046529 Bacteria 2445
194 Ga0495622_0233529 3300046557 Bacteria 812
195 Ga0495633_0009668 3300046558 Bacteria 5305
196 Ga0495625_0000183 3300046660 Bacteria 98174
197 Ga0495625_0012277 3300046660 Bacteria 6948
198 Ga0495625_0098104 3300046660 Bacteria 2016
199 Ga0495625_0161819 3300046660 Bacteria 1499
200 Ga0495625_0193011 3300046660 Bacteria 1348
201 Ga0495661_0002653 3300046665 Bacteria 13699
202 Ga0495671_0042769 3300046692 Bacteria 2276
203 Ga0495649_0000046 3300046694 Bacteria 120254
204 Ga0495660_0014777 3300046810 Bacteria 4515
205 Ga0495687_000556 3300047443 Bacteria 44028
206 Ga0495687_001728 3300047443 Bacteria 19328
207 Ga0495687_108866 3300047443 Bacteria 1023
208 Ga0495679_042266 3300047446 Bacteria 1407
209 Ga0495673_0095112 3300047469 Bacteria 1212
210 Ga0495686_0003222 3300047472 Bacteria 14353
211 Ga0495686_0067301 3300047472 Bacteria 2211
212 Ga0495686_0078685 3300047472 Bacteria 2018
213 Ga0501223_001181 3300049663 Bacteria 6168
214 nmdc:mga0k408_219275_c1 3300050493 Unclassified 1136
215 nmdc:mga07m45_103892_c1 3300050496 Unclassified 1633
216 nmdc:mga07m45_86669_c1 3300050496 Bacteria 1791
217 Ga0500635_0005944 3300053080 Bacteria 3237
218 Ga0500608_000596 3300053122 Bacteria 13310
219 Ga0500618_000015 3300053125 Bacteria 175864
220 Ga0500564_088689 3300053138 Bacteria 1379
221 Ga0500568_0076129 3300053139 Bacteria 1279
222 Ga0500616_0121122 3300053153 Bacteria 1250
223 Ga0500622_0000465 3300053156 Bacteria 38456
224 Ga0500622_0206166 3300053156 Bacteria 891
225 Ga0500624_000712 3300053157 Bacteria 8312
226 Ga0501084_0288510 3300054114 Bacteria 1386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0098104 Ga0495625_0098104_1417_1986 189
2 3300030731 Ga0316177_1116921 Ga0316177_11169213 201
3 3300030742 Ga0316183_1054866 Ga0316183_10548668 201
4 3300030744 Ga0316181_1126086 Ga0316181_11260862 201
5 3300031911 Ga0307412_10144394 Ga0307412_101443942 201
6 3300005616 Ga0068852_100064985 Ga0068852_1000649854 202
7 3300005842 Ga0068858_100107579 Ga0068858_1001075793 202
8 3300009093 Ga0105240_10035982 Ga0105240_100359823 202
9 3300013306 Ga0163162_10058924 Ga0163162_100589243 202
10 3300025913 Ga0207695_10036334 Ga0207695_100363343 202
11 3300054114 Ga0501084_0288510 Ga0501084_0288510_630_1313 203
12 iso_pu_bacteria 2977232053 2977234090 205
13 iso_pu_bacteria 2599185184 2599481740 206
14 iso_pu_bacteria 2842903701 2842905366 206
15 iso_pu_bacteria 2852623160 2852626277 206
16 iso_pu_bacteria 2884933994 2884934728 206
17 iso_pu_bacteria 2890737413 2890740764 206
18 iso_pu_bacteria 2895498888 2895500361 206
19 iso_pu_bacteria 2896344016 2896346853 206
20 iso_pu_bacteria 2898713307 2898713470 206
21 iso_pu_bacteria 2919437846 2919439409 206
22 iso_pu_bacteria 2928078545 2928082013 206
23 iso_pu_bacteria 2928147474 2928152033 206
24 iso_pu_bacteria 2932082852 2932088068 206
25 iso_pu_bacteria 8055588893 8055592124 206
26 3300005614 Ga0068856_100015573 Ga0068856_1000155734 207
27 3300026078 Ga0207702_10041295 Ga0207702_100412955 207
28 3300047443 Ga0495687_108866 Ga0495687_108866_257_883 208
29 3300047472 Ga0495686_0078685 Ga0495686_0078685_854_1480 208
30 3300053156 Ga0500622_0000465 Ga0500622_0000465_27787_28413 208
31 3300002741 JGI25157J39369_1004104 JGI25157J39369_10041043 209
32 3300003323 rootH1_10285976 rootH1_102859763 209
33 3300005329 Ga0070683_100017779 Ga0070683_1000177794 209
34 3300005535 Ga0070684_100073586 Ga0070684_1000735862 209
35 3300005563 Ga0068855_100000489 Ga0068855_10000048928 209
36 3300006195 Ga0075366_10237352 Ga0075366_102373521 209
37 3300006353 Ga0075370_10116657 Ga0075370_101166572 209
38 3300006914 Ga0075436_100154075 Ga0075436_1001540752 209
39 3300009093 Ga0105240_10347168 Ga0105240_103471682 209
40 3300009545 Ga0105237_10006338 Ga0105237_1000633810 209
41 3300009545 Ga0105237_10021909 Ga0105237_100219091 209
42 3300010375 Ga0105239_10000130 Ga0105239_100001302 209
43 3300010375 Ga0105239_10079442 Ga0105239_100794425 209
44 3300013100 Ga0157373_10000327 Ga0157373_1000032714 209
45 3300013307 Ga0157372_10000980 Ga0157372_1000098013 209
46 3300017792 Ga0163161_10027842 Ga0163161_100278423 209
47 3300025250 Ga0209026_1000246 Ga0209026_100024643 209
48 3300025914 Ga0207671_10004576 Ga0207671_1000457610 209
49 3300025914 Ga0207671_10023341 Ga0207671_100233412 209
50 3300025914 Ga0207671_10848891 Ga0207671_108488911 209
51 3300025944 Ga0207661_10014978 Ga0207661_100149784 209
52 3300025949 Ga0207667_10000408 Ga0207667_1000040829 209
53 3300025949 Ga0207667_10139435 Ga0207667_101394352 209
54 3300027471 Ga0209995_1018273 Ga0209995_10182732 209
55 3300028800 Ga0265338_10057308 Ga0265338_100573082 209
56 3300046460 Ga0495638_0012148 Ga0495638_0012148_2118_2843 209
57 3300046507 Ga0495606_0005365 Ga0495606_0005365_342_971 209
58 3300050493 nmdc:mga0k408_219275_c1 nmdc:mga0k408_219275_c1_436_1065 209
59 3300050496 nmdc:mga07m45_103892_c1 nmdc:mga07m45_103892_c1_496_1125 209
60 3300053138 Ga0500564_088689 Ga0500564_088689_584_1213 209
61 3300001979 JGI24740J21852_10083712 JGI24740J21852_100837122 210
62 3300001990 JGI24737J22298_10000950 JGI24737J22298_100009506 210
63 3300001990 JGI24737J22298_10035559 JGI24737J22298_100355592 210
64 3300002067 JGI24735J21928_10000027 JGI24735J21928_1000002747 210
65 3300002737 JGI25162J39368_1000408 JGI25162J39368_100040829 210
66 3300002737 JGI25162J39368_1001130 JGI25162J39368_10011308 210
67 3300002772 JGI25164J39214_1001295 JGI25164J39214_10012954 210
68 3300003214 JGI25165J46597_1001079 JGI25165J46597_10010793 210
69 3300003316 rootH1_10031584 rootH1_100315843 210
70 3300003320 rootH2_10076799 rootH2_100767992 210
71 3300003322 rootL2_10008520 rootL2_100085205 210
72 3300003323 rootH1_10007236 rootH1_100072368 210
73 3300003323 rootH1_10140687 rootH1_101406872 210
74 3300005288 Ga0065714_10007283 Ga0065714_100072832 210
75 3300005328 Ga0070676_10002416 Ga0070676_100024163 210
76 3300005338 Ga0068868_100104161 Ga0068868_1001041611 210
77 3300005339 Ga0070660_100020336 Ga0070660_1000203363 210
78 3300005354 Ga0070675_100386108 Ga0070675_1003861081 210
79 3300005366 Ga0070659_100000412 Ga0070659_1000004125 210
80 3300005456 Ga0070678_100072911 Ga0070678_1000729114 210
81 3300005457 Ga0070662_100000043 Ga0070662_10000004333 210
82 3300005539 Ga0068853_100084845 Ga0068853_1000848452 210
83 3300005548 Ga0070665_100000017 Ga0070665_100000017210 210
84 3300005563 Ga0068855_100000060 Ga0068855_10000006037 210
85 3300005563 Ga0068855_100026070 Ga0068855_1000260704 210
86 3300005563 Ga0068855_100305497 Ga0068855_1003054972 210
87 3300005563 Ga0068855_100620674 Ga0068855_1006206741 210
88 3300005577 Ga0068857_100038001 Ga0068857_1000380013 210
89 3300005577 Ga0068857_100259691 Ga0068857_1002596912 210
90 3300005578 Ga0068854_100256417 Ga0068854_1002564172 210
91 3300005614 Ga0068856_100219196 Ga0068856_1002191962 210
92 3300005616 Ga0068852_100001476 Ga0068852_10000147611 210
93 3300005718 Ga0068866_10101169 Ga0068866_101011692 210
94 3300006195 Ga0075366_10000032 Ga0075366_1000003217 210
95 3300006195 Ga0075366_10064659 Ga0075366_100646592 210
96 3300006237 Ga0097621_100000099 Ga0097621_10000009922 210
97 3300006358 Ga0068871_100000290 Ga0068871_1000002902 210
98 3300009093 Ga0105240_10075740 Ga0105240_100757403 210
99 3300009093 Ga0105240_10079149 Ga0105240_100791492 210
100 3300009148 Ga0105243_10665228 Ga0105243_106652282 210
101 3300009174 Ga0105241_10001269 Ga0105241_100012695 210
102 3300009174 Ga0105241_10022435 Ga0105241_100224353 210
103 3300009174 Ga0105241_10925882 Ga0105241_109258821 210
104 3300009176 Ga0105242_10032968 Ga0105242_100329683 210
105 3300009545 Ga0105237_10000198 Ga0105237_1000019815 210
106 3300009545 Ga0105237_10001359 Ga0105237_1000135920 210
107 3300009545 Ga0105237_10013563 Ga0105237_100135639 210
108 3300009545 Ga0105237_10881726 Ga0105237_108817261 210
109 3300009551 Ga0105238_10018391 Ga0105238_100183918 210
110 3300009551 Ga0105238_10146766 Ga0105238_101467661 210
111 3300009551 Ga0105238_10388702 Ga0105238_103887021 210
112 3300010375 Ga0105239_10000008 Ga0105239_10000008127 210
113 3300010375 Ga0105239_10001373 Ga0105239_100013732 210
114 3300010375 Ga0105239_10002395 Ga0105239_100023954 210
115 3300010375 Ga0105239_10035545 Ga0105239_100355452 210
116 3300010375 Ga0105239_10153183 Ga0105239_101531832 210
117 3300010375 Ga0105239_10395896 Ga0105239_103958961 210
118 3300010375 Ga0105239_10468821 Ga0105239_104688211 210
119 3300011119 Ga0105246_10034040 Ga0105246_100340403 210
120 3300011119 Ga0105246_10879867 Ga0105246_108798671 210
121 3300013100 Ga0157373_10005250 Ga0157373_100052507 210
122 3300013100 Ga0157373_10179221 Ga0157373_101792212 210
123 3300013102 Ga0157371_10000836 Ga0157371_1000083612 210
124 3300013102 Ga0157371_10009832 Ga0157371_100098324 210
125 3300013104 Ga0157370_10074114 Ga0157370_100741143 210
126 3300013104 Ga0157370_10341698 Ga0157370_103416982 210
127 3300013104 Ga0157370_10875312 Ga0157370_108753122 210
128 3300013105 Ga0157369_10469819 Ga0157369_104698191 210
129 3300013105 Ga0157369_10469823 Ga0157369_104698231 210
130 3300013296 Ga0157374_10000360 Ga0157374_1000036036 210
131 3300013297 Ga0157378_10027617 Ga0157378_100276177 210
132 3300013306 Ga0163162_10000051 Ga0163162_1000005180 210
133 3300013306 Ga0163162_10132479 Ga0163162_101324793 210
134 3300013307 Ga0157372_10000158 Ga0157372_1000015833 210
135 3300013307 Ga0157372_10000538 Ga0157372_100005388 210
136 3300013307 Ga0157372_10187012 Ga0157372_101870122 210
137 3300013307 Ga0157372_10815442 Ga0157372_108154422 210
138 3300013308 Ga0157375_10005633 Ga0157375_1000563311 210
139 3300013308 Ga0157375_10227729 Ga0157375_102277292 210
140 3300014745 Ga0157377_10011833 Ga0157377_100118335 210
141 3300021361 Ga0213872_10003265 Ga0213872_100032655 210
142 3300025230 Ga0209563_109129 Ga0209563_1091291 210
143 3300025231 Ga0207427_100159 Ga0207427_10015976 210
144 3300025233 Ga0209437_100021 Ga0209437_10002196 210
145 3300025233 Ga0209437_100144 Ga0209437_100144133 210
146 3300025258 Ga0209129_1010067 Ga0209129_10100672 210
147 3300025261 Ga0209233_1000035 Ga0209233_1000035541 210
148 3300025261 Ga0209233_1000524 Ga0209233_10005243 210
149 3300025272 Ga0209455_1001628 Ga0209455_100162811 210
150 3300025899 Ga0207642_10443153 Ga0207642_104431531 210
151 3300025904 Ga0207647_10000036 Ga0207647_1000003613 210
152 3300025904 Ga0207647_10000346 Ga0207647_100003466 210
153 3300025904 Ga0207647_10127205 Ga0207647_101272052 210
154 3300025907 Ga0207645_10000312 Ga0207645_1000031239 210
155 3300025909 Ga0207705_10000090 Ga0207705_10000090100 210
156 3300025909 Ga0207705_10130704 Ga0207705_101307042 210
157 3300025911 Ga0207654_10073156 Ga0207654_100731562 210
158 3300025911 Ga0207654_10077552 Ga0207654_100775522 210
159 3300025913 Ga0207695_10000127 Ga0207695_10000127186 210
160 3300025913 Ga0207695_10024261 Ga0207695_100242611 210
161 3300025913 Ga0207695_10071090 Ga0207695_100710902 210
162 3300025914 Ga0207671_10000254 Ga0207671_1000025415 210
163 3300025914 Ga0207671_10050514 Ga0207671_100505142 210
164 3300025914 Ga0207671_10080553 Ga0207671_100805534 210
165 3300025914 Ga0207671_10601333 Ga0207671_106013331 210
166 3300025919 Ga0207657_10089742 Ga0207657_100897423 210
167 3300025919 Ga0207657_10131676 Ga0207657_101316763 210
168 3300025924 Ga0207694_10205626 Ga0207694_102056262 210
169 3300025932 Ga0207690_10000049 Ga0207690_1000004960 210
170 3300025932 Ga0207690_10009341 Ga0207690_100093413 210
171 3300025933 Ga0207706_10000466 Ga0207706_1000046634 210
172 3300025934 Ga0207686_10021688 Ga0207686_100216883 210
173 3300025938 Ga0207704_10000123 Ga0207704_100001236 210
174 3300025949 Ga0207667_10000033 Ga0207667_10000033252 210
175 3300025949 Ga0207667_10056917 Ga0207667_100569172 210
176 3300025981 Ga0207640_10341100 Ga0207640_103411001 210
177 3300026023 Ga0207677_10029951 Ga0207677_100299512 210
178 3300026035 Ga0207703_10222577 Ga0207703_102225772 210
179 3300026041 Ga0207639_10008486 Ga0207639_100084863 210
180 3300026041 Ga0207639_10227745 Ga0207639_102277452 210
181 3300026041 Ga0207639_11116192 Ga0207639_111161921 210
182 3300026078 Ga0207702_10191525 Ga0207702_101915252 210
183 3300026089 Ga0207648_10000913 Ga0207648_100009138 210
184 3300026116 Ga0207674_10049622 Ga0207674_100496223 210
185 3300026116 Ga0207674_10329053 Ga0207674_103290532 210
186 3300026121 Ga0207683_10042837 Ga0207683_100428372 210
187 3300026142 Ga0207698_10141257 Ga0207698_101412572 210
188 3300028379 Ga0268266_10000037 Ga0268266_10000037108 210
189 3300031251 Ga0265327_10176893 Ga0265327_101768931 210
190 3300031507 Ga0307509_10049280 Ga0307509_100492804 210
191 3300031995 Ga0307409_100249384 Ga0307409_1002493842 210
192 3300032004 Ga0307414_10081165 Ga0307414_100811652 210
193 3300033180 Ga0307510_10001091 Ga0307510_1000109127 210
194 3300037312 Ga0395899_0012363 Ga0395899_0012363_2029_2667 210
195 3300037418 Ga0395900_0000478 Ga0395900_0000478_16372_17007 210
196 3300037418 Ga0395900_0006013 Ga0395900_0006013_8840_9478 210
197 3300037418 Ga0395900_0219327 Ga0395900_0219327_1237_1872 210
198 3300037466 Ga0395898_0053528 Ga0395898_0053528_677_1315 210
199 3300037466 Ga0395898_0615408 Ga0395898_0615408_212_850 210
200 3300038443 Ga0395901_0001267 Ga0395901_0001267_3536_4174 210
201 3300039447 Ga0436361_0530171 Ga0436361_0530171_8644_9282 210
202 3300042005 Ga0439448_0040090 Ga0439448_0040090_37_675 210
203 3300042012 Ga0439455_0026009 Ga0439455_0026009_109_747 210
204 3300046462 Ga0495651_0299451 Ga0495651_0299451_407_1039 210
205 3300046492 Ga0495585_0000308 Ga0495585_0000308_18336_18974 210
206 3300046492 Ga0495585_0324699 Ga0495585_0324699_41_685 210
207 3300046500 Ga0495596_0025001 Ga0495596_0025001_808_1446 210
208 3300046506 Ga0495583_0008886 Ga0495583_0008886_2100_2738 210
209 3300046507 Ga0495606_0000021 Ga0495606_0000021_220907_221545 210
210 3300046507 Ga0495606_0028874 Ga0495606_0028874_1304_1942 210
211 3300046512 Ga0495610_0007113 Ga0495610_0007113_1946_2584 210
212 3300046513 Ga0495616_0001331 Ga0495616_0001331_5484_6122 210
213 3300046518 Ga0495631_0000646 Ga0495631_0000646_717_1355 210
214 3300046529 Ga0495652_0047218 Ga0495652_0047218_2285_2917 210
215 3300046529 Ga0495652_0094110 Ga0495652_0094110_1118_1756 210
216 3300046557 Ga0495622_0233529 Ga0495622_0233529_85_723 210
217 3300046558 Ga0495633_0009668 Ga0495633_0009668_4538_5176 210
218 3300046660 Ga0495625_0000183 Ga0495625_0000183_55435_56073 210
219 3300046660 Ga0495625_0012277 Ga0495625_0012277_993_1631 210
220 3300046660 Ga0495625_0161819 Ga0495625_0161819_162_800 210
221 3300046660 Ga0495625_0193011 Ga0495625_0193011_616_1254 210
222 3300046665 Ga0495661_0002653 Ga0495661_0002653_4566_5204 210
223 3300046692 Ga0495671_0042769 Ga0495671_0042769_805_1443 210
224 3300046694 Ga0495649_0000046 Ga0495649_0000046_55531_56169 210
225 3300046810 Ga0495660_0014777 Ga0495660_0014777_292_930 210
226 3300047443 Ga0495687_000556 Ga0495687_000556_34678_35316 210
227 3300047443 Ga0495687_001728 Ga0495687_001728_2470_3108 210
228 3300047446 Ga0495679_042266 Ga0495679_042266_266_904 210
229 3300047469 Ga0495673_0095112 Ga0495673_0095112_72_710 210
230 3300047472 Ga0495686_0003222 Ga0495686_0003222_6829_7467 210
231 3300047472 Ga0495686_0067301 Ga0495686_0067301_243_881 210
232 3300049663 Ga0501223_001181 Ga0501223_001181_3662_4303 210
233 3300050496 nmdc:mga07m45_86669_c1 nmdc:mga07m45_86669_c1_966_1604 210
234 3300053080 Ga0500635_0005944 Ga0500635_0005944_239_883 210
235 3300053122 Ga0500608_000596 Ga0500608_000596_6284_6922 210
236 3300053125 Ga0500618_000015 Ga0500618_000015_52551_53189 210
237 3300053139 Ga0500568_0076129 Ga0500568_0076129_406_1044 210
238 3300053153 Ga0500616_0121122 Ga0500616_0121122_557_1192 210
239 3300053156 Ga0500622_0206166 Ga0500622_0206166_75_713 210
240 3300053157 Ga0500624_000712 Ga0500624_000712_4037_4675 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

28

199

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9135 1 209
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9053 1 209
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9048 2 209
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9023 1 209
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.9004 1 209
ID Description Score Start End Superfamily
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9171 59 209 3.40.630.70
af_O96210_178_350_3.40.630.70 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.8634 60 210 3.40.630.70
af_Q4DMU6_186_375_3.40.630.70 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.8463 60 210 3.40.630.70
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.8325 1 57 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.8248 1 57 3.30.70.3550
ID Description Score Start End GO Terms
AF-A0A5E6NCZ2-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC) (EC 2.3.2.6) 0.9836 82 199 GO:0005737
GO:0008914
GO:0030163
AF-A0A6M1Q578-F1-model_v4 deleted 0.9713 65 208
AF-A0A1W1D738-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) 0.9655 52 209 GO:0005737
GO:0008914
GO:0030163
AF-A0A519LPZ8-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) 0.9647 60 210 GO:0005737
GO:0008914
GO:0030163
AF-A0A353F9J5-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase 0.9612 49 207 GO:0005737
GO:0008914
GO:0030163

Feature Viewer

pLDDT pTM Quality
89.82 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map