F353752

General Info

Members Datasets Scaffolds Average Seq Length
241 141 482 76

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11878824|Ga0105242_118788242
Length 90
Sequence MARKLQVYETPEITVTFEPAICRHTGICVRGLPAVFDIRRKRWVAPEAASADAVHAQVARCPSGALKSYRPGEFVPPPEGERAEGDAHGG

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
128 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 23.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11878824 3300009176 Unclassified 639
2 Ga0070683_100410203 3300005329 Bacteria 1292
3 Ga0070690_100024281 3300005330 Bacteria 3727
4 Ga0070670_100049210 3300005331 Bacteria 3624
5 Ga0070677_10037293 3300005333 Bacteria 1895
6 Ga0070677_10042846 3300005333 Bacteria 1795
7 Ga0068869_100019977 3300005334 Bacteria 4587
8 Ga0068869_100677195 3300005334 Unclassified 878
9 Ga0070666_10206376 3300005335 Unclassified 1383
10 Ga0070666_10889645 3300005335 Bacteria 658
11 Ga0070682_101628017 3300005337 Bacteria 559
12 Ga0068868_101048158 3300005338 Bacteria 748
13 Ga0070689_100187712 3300005340 Unclassified 1682
14 Ga0070689_100208739 3300005340 Bacteria 1598
15 Ga0070691_10631889 3300005341 Bacteria 635
16 Ga0070687_100476841 3300005343 Unclassified 835
17 Ga0070669_100026049 3300005353 Unclassified 4206
18 Ga0070669_100210651 3300005353 Bacteria 1533
19 Ga0070669_100461109 3300005353 Unclassified 1049
20 Ga0070669_101702744 3300005353 Bacteria 550
21 Ga0070675_100001050 3300005354 Bacteria 19912
22 Ga0070675_100002375 3300005354 Bacteria 14018
23 Ga0070675_100039925 3300005354 Bacteria 3830
24 Ga0070675_100293714 3300005354 Bacteria 1430
25 Ga0070675_100328694 3300005354 Bacteria 1352
26 Ga0070675_100431905 3300005354 Bacteria 1179
27 Ga0070671_100033117 3300005355 Bacteria 4273
28 Ga0070674_100064563 3300005356 Bacteria 2566
29 Ga0070674_100485043 3300005356 Bacteria 1026
30 Ga0070673_100042203 3300005364 Bacteria 3515
31 Ga0070673_100077200 3300005364 Bacteria 2691
32 Ga0070673_100208405 3300005364 Unclassified 1687
33 Ga0070673_100300857 3300005364 Bacteria 1412
34 Ga0070667_100159177 3300005367 Bacteria 1988
35 Ga0070667_100578375 3300005367 Bacteria 1034
36 Ga0070711_101050739 3300005439 Unclassified 700
37 Ga0070705_100382685 3300005440 Unclassified 1036
38 Ga0070705_101259530 3300005440 Bacteria 611
39 Ga0070700_100026458 3300005441 Bacteria 3426
40 Ga0070694_100484255 3300005444 Bacteria 982
41 Ga0070708_101054844 3300005445 Unclassified 761
42 Ga0070663_100043254 3300005455 Bacteria 3169
43 Ga0070663_100947156 3300005455 Bacteria 746
44 Ga0070678_100897155 3300005456 Unclassified 810
45 Ga0070678_101996450 3300005456 Bacteria 549
46 Ga0068867_100006769 3300005459 Bacteria 8099
47 Ga0068867_100808580 3300005459 Bacteria 837
48 Ga0070685_10225832 3300005466 Unclassified 1229
49 Ga0070707_100098697 3300005468 Unclassified 2829
50 Ga0070707_100805659 3300005468 Bacteria 903
51 Ga0070707_101387063 3300005468 Unclassified 669
52 Ga0070698_100109298 3300005471 Bacteria 2732
53 Ga0070698_100674019 3300005471 Bacteria 976
54 Ga0070698_100709789 3300005471 Unclassified 948
55 Ga0070698_100755557 3300005471 Bacteria 915
56 Ga0070698_100969736 3300005471 Bacteria 797
57 Ga0070698_101597502 3300005471 Bacteria 604
58 Ga0070699_100009093 3300005518 Bacteria 8613
59 Ga0070699_100224422 3300005518 Bacteria 1675
60 Ga0070699_102045296 3300005518 Unclassified 523
61 Ga0070684_100573627 3300005535 Bacteria 1048
62 Ga0070697_101475340 3300005536 Bacteria 608
63 Ga0070672_100120853 3300005543 Bacteria 2144
64 Ga0070672_100285349 3300005543 Bacteria 1397
65 Ga0070672_100346299 3300005543 Unclassified 1266
66 Ga0070686_101143026 3300005544 Bacteria 645
67 Ga0070696_101897426 3300005546 Bacteria 516
68 Ga0070665_100222857 3300005548 Bacteria 1886
69 Ga0070665_101628977 3300005548 Bacteria 653
70 Ga0070664_100036585 3300005564 Bacteria 4124
71 Ga0068857_101012044 3300005577 Bacteria 800
72 Ga0068857_102116044 3300005577 Bacteria 552
73 Ga0068854_100116353 3300005578 Bacteria 2023
74 Ga0068864_101497942 3300005618 Bacteria 678
75 Ga0068861_100020328 3300005719 Bacteria 4753
76 Ga0068861_101251442 3300005719 Unclassified 720
77 Ga0068851_10090998 3300005834 Unclassified 1606
78 Ga0068870_10074298 3300005840 Bacteria 1862
79 Ga0068870_10152993 3300005840 Archaea 1360
80 Ga0068863_100031829 3300005841 Bacteria 5032
81 Ga0068863_100219382 3300005841 Bacteria 1832
82 Ga0068863_100256456 3300005841 Bacteria 1690
83 Ga0068858_102340783 3300005842 Bacteria 528
84 Ga0068860_100043870 3300005843 Bacteria 4264
85 Ga0068862_102258870 3300005844 Bacteria 556
86 Ga0097621_101196395 3300006237 Bacteria 716
87 Ga0097621_102283580 3300006237 Bacteria 518
88 Ga0068871_100298774 3300006358 Bacteria 1413
89 Ga0075428_100726284 3300006844 Bacteria 1057
90 Ga0075428_102197508 3300006844 Bacteria 569
91 Ga0075431_100249182 3300006847 Bacteria 1805
92 Ga0075434_100109685 3300006871 Bacteria 2770
93 Ga0075429_100025001 3300006880 Bacteria 5185
94 Ga0075429_100382841 3300006880 Unclassified 1232
95 Ga0068865_100021304 3300006881 Bacteria 4214
96 Ga0075435_100821579 3300007076 Unclassified 809
97 Ga0075435_101036914 3300007076 Bacteria 716
98 Ga0111539_10625130 3300009094 Bacteria 1254
99 Ga0105245_10632896 3300009098 Bacteria 1099
100 Ga0114129_10005744 3300009147 Bacteria 17579
101 Ga0114129_10262101 3300009147 Bacteria 2316
102 Ga0114129_10326167 3300009147 Bacteria 2040
103 Ga0114129_10348753 3300009147 Bacteria 1962
104 Ga0114129_10980643 3300009147 Bacteria 1065
105 Ga0105243_10266460 3300009148 Bacteria 1536
106 Ga0105242_10016099 3300009176 Bacteria 5810
107 Ga0105248_10426105 3300009177 Bacteria 1494
108 Ga0105248_10911944 3300009177 Unclassified 992
109 Ga0105238_10003494 3300009551 Bacteria 15639
110 Ga0105249_11228976 3300009553 Unclassified 820
111 Ga0105246_10040627 3300011119 Bacteria 3141
112 Ga0105246_11423648 3300011119 Bacteria 648
113 Ga0157375_10534739 3300013308 Unclassified 1335
114 Ga0157375_10660509 3300013308 Bacteria 1201
115 Ga0157375_12407927 3300013308 Unclassified 628
116 Ga0163163_10157451 3300014325 Bacteria 2316
117 Ga0163163_10292392 3300014325 Bacteria 1681
118 Ga0163163_10592070 3300014325 Bacteria 1172
119 Ga0163163_13057304 3300014325 Unclassified 522
120 Ga0157380_10009861 3300014326 Bacteria 6857
121 Ga0157380_10034674 3300014326 Bacteria 3893
122 Ga0157380_10116236 3300014326 Bacteria 2257
123 Ga0157380_10169823 3300014326 Bacteria 1904
124 Ga0157380_10303945 3300014326 Unclassified 1471
125 Ga0157380_11134227 3300014326 Bacteria 822
126 Ga0157380_12763922 3300014326 Unclassified 557
127 Ga0157377_10028335 3300014745 Bacteria 3014
128 Ga0157377_10248253 3300014745 Bacteria 1152
129 Ga0157376_11132704 3300014969 Bacteria 809
130 Ga0163161_10871711 3300017792 Bacteria 761
131 Ga0207656_10120219 3300025321 Bacteria 1222
132 Ga0207682_10016865 3300025893 Bacteria 2850
133 Ga0207682_10124710 3300025893 Unclassified 1145
134 Ga0207682_10208539 3300025893 Bacteria 901
135 Ga0207642_10003387 3300025899 Bacteria 5029
136 Ga0207645_10008005 3300025907 Bacteria 7415
137 Ga0207645_10513593 3300025907 Bacteria 812
138 Ga0207643_10036079 3300025908 Bacteria 2773
139 Ga0207643_10083680 3300025908 Bacteria 1851
140 Ga0207643_10530155 3300025908 Bacteria 755
141 Ga0207684_11385788 3300025910 Bacteria 576
142 Ga0207662_10030591 3300025918 Bacteria 3125
143 Ga0207646_10036432 3300025922 Bacteria 4441
144 Ga0207646_11586857 3300025922 Bacteria 565
145 Ga0207681_10017615 3300025923 Bacteria 4488
146 Ga0207681_10075766 3300025923 Bacteria 2361
147 Ga0207681_10140737 3300025923 Unclassified 1796
148 Ga0207681_10173464 3300025923 Bacteria 1636
149 Ga0207650_10308361 3300025925 Archaea 1294
150 Ga0207659_10006878 3300025926 Bacteria 6995
151 Ga0207659_10007656 3300025926 Bacteria 6664
152 Ga0207659_10069252 3300025926 Bacteria 2569
153 Ga0207659_10128219 3300025926 Bacteria 1954
154 Ga0207659_10730218 3300025926 Unclassified 849
155 Ga0207659_10824479 3300025926 Bacteria 797
156 Ga0207687_10841350 3300025927 Bacteria 784
157 Ga0207644_10115409 3300025931 Bacteria 2036
158 Ga0207686_10066608 3300025934 Bacteria 2300
159 Ga0207709_10270841 3300025935 Unclassified 1250
160 Ga0207670_10010043 3300025936 Bacteria 5431
161 Ga0207670_10062724 3300025936 Bacteria 2541
162 Ga0207669_10321721 3300025937 Bacteria 1184
163 Ga0207704_10001915 3300025938 Bacteria 9328
164 Ga0207704_10997542 3300025938 Unclassified 708
165 Ga0207691_10042034 3300025940 Bacteria 4216
166 Ga0207691_10047969 3300025940 Unclassified 3917
167 Ga0207691_10096784 3300025940 Bacteria 2639
168 Ga0207691_10311334 3300025940 Bacteria 1351
169 Ga0207691_10892348 3300025940 Bacteria 744
170 Ga0207689_10013682 3300025942 Bacteria 6919
171 Ga0207689_10094052 3300025942 Bacteria 2462
172 Ga0207661_10194166 3300025944 Bacteria 1781
173 Ga0207679_10100734 3300025945 Bacteria 2258
174 Ga0207651_10067607 3300025960 Bacteria 2515
175 Ga0207651_10085861 3300025960 Unclassified 2285
176 Ga0207651_10963490 3300025960 Bacteria 761
177 Ga0207668_11157988 3300025972 Bacteria 694
178 Ga0207640_10054949 3300025981 Bacteria 2606
179 Ga0207658_10268753 3300025986 Bacteria 1456
180 Ga0207677_10954801 3300026023 Bacteria 775
181 Ga0207703_11971240 3300026035 Bacteria 560
182 Ga0207678_10101636 3300026067 Bacteria 2455
183 Ga0207678_10467731 3300026067 Bacteria 1097
184 Ga0207708_10004076 3300026075 Bacteria 10744
185 Ga0207641_10048463 3300026088 Unclassified 3586
186 Ga0207641_10686313 3300026088 Archaea 1008
187 Ga0207648_10000802 3300026089 Bacteria 35458
188 Ga0207676_10200146 3300026095 Bacteria 1764
189 Ga0207674_11793291 3300026116 Bacteria 581
190 Ga0207675_100017282 3300026118 Bacteria 6735
191 Ga0207675_102634785 3300026118 Unclassified 512
192 Ga0207683_11124642 3300026121 Unclassified 728
193 Ga0207683_11291208 3300026121 Bacteria 676
194 Ga0207683_11370521 3300026121 Bacteria 654
195 Ga0207698_10789479 3300026142 Bacteria 951
196 Ga0268266_10165344 3300028379 Bacteria 2004
197 Ga0268265_11316155 3300028380 Bacteria 723
198 Ga0268264_10046363 3300028381 Bacteria 3610
199 Ga0265314_10015681 3300031711 Bacteria 6006
200 Ga0307412_10254314 3300031911 Bacteria 1366
201 Ga0307416_100588148 3300032002 Bacteria 1191
202 Ga0307411_10539202 3300032005 Bacteria 994
203 Ga0373937_0274409 3300036401 Unclassified 1592
204 Ga0439435_0068630 3300042436 Bacteria 1046
205 Ga0451577_0968971 3300042876 Unclassified 764
206 Ga0466960_0753490 3300044901 Bacteria 587
207 Ga0451576_0027564 3300045051 Bacteria 6100
208 Ga0451576_0499887 3300045051 Unclassified 1277
209 Ga0451576_1546604 3300045051 Bacteria 689
210 Ga0495603_0446436 3300046455 Unclassified 741
211 Ga0495580_1021040 3300046472 Unclassified 526
212 Ga0495598_0329853 3300046537 Unclassified 583
213 Ga0495636_0063335 3300047318 Unclassified 1567
214 Ga0501036_1549802 3300049572 Unclassified 536
215 Ga0501040_0873795 3300049576 Unclassified 651
216 Ga0501067_0460711 3300049583 Unclassified 710
217 Ga0501075_0682236 3300049591 Bacteria 783
218 Ga0501207_038147 3300049654 Bacteria 828
219 Ga0501235_043594 3300049669 Bacteria 1030
220 Ga0501080_0888792 3300049742 Bacteria 777
221 Ga0501080_1528541 3300049742 Unclassified 567
222 Ga0501081_0087994 3300049743 Unclassified 2182
223 Ga0501081_0093780 3300049743 Bacteria 2114
224 Ga0501279_101076 3300049775 Unclassified 519
225 Ga0501035_0209106 3300049822 Bacteria 1670
226 Ga0501045_0163223 3300049824 Bacteria 1659
227 nmdc:mga05p37_182047_c1 3300050507 Bacteria 2556
228 nmdc:mga05p37_288001_c1 3300050507 Bacteria 1956
229 nmdc:mga05p37_446456_c1 3300050507 Bacteria 1498
230 nmdc:mga09592_153756_c1 3300050508 Bacteria 1985
231 nmdc:mga09592_267569_c1 3300050508 Unclassified 1482
232 nmdc:mga09592_574837_c1 3300050508 Unclassified 967
233 nmdc:mga06r32_135067_c1 3300050510 Bacteria 2441
234 nmdc:mga06r32_852322_c1 3300050510 Bacteria 870
235 nmdc:mga08y16_640023_c1 3300050511 Bacteria 1068
236 nmdc:mga0n895_1563593_c1 3300050512 Bacteria 625
237 nmdc:mga0rr50_791203_c1 3300050513 Unclassified 809
238 nmdc:mga0a205_1420478_c1 3300050515 Bacteria 542
239 Ga0501082_0334793 3300060353 Bacteria 1319
240 Ga0501082_0978655 3300060353 Unclassified 740
241 Ga0501082_1323113 3300060353 Bacteria 629
242 Ga0105242_11878824
243 Ga0070683_100410203
244 Ga0070690_100024281
245 Ga0070670_100049210
246 Ga0070677_10037293
247 Ga0070677_10042846
248 Ga0068869_100019977
249 Ga0068869_100677195
250 Ga0070666_10206376
251 Ga0070666_10889645
252 Ga0070682_101628017
253 Ga0068868_101048158
254 Ga0070689_100187712
255 Ga0070689_100208739
256 Ga0070691_10631889
257 Ga0070687_100476841
258 Ga0070669_100026049
259 Ga0070669_100210651
260 Ga0070669_100461109
261 Ga0070669_101702744
262 Ga0070675_100001050
263 Ga0070675_100002375
264 Ga0070675_100039925
265 Ga0070675_100293714
266 Ga0070675_100328694
267 Ga0070675_100431905
268 Ga0070671_100033117
269 Ga0070674_100064563
270 Ga0070674_100485043
271 Ga0070673_100042203
272 Ga0070673_100077200
273 Ga0070673_100208405
274 Ga0070673_100300857
275 Ga0070667_100159177
276 Ga0070667_100578375
277 Ga0070711_101050739
278 Ga0070705_100382685
279 Ga0070705_101259530
280 Ga0070700_100026458
281 Ga0070694_100484255
282 Ga0070708_101054844
283 Ga0070663_100043254
284 Ga0070663_100947156
285 Ga0070678_100897155
286 Ga0070678_101996450
287 Ga0068867_100006769
288 Ga0068867_100808580
289 Ga0070685_10225832
290 Ga0070707_100098697
291 Ga0070707_100805659
292 Ga0070707_101387063
293 Ga0070698_100109298
294 Ga0070698_100674019
295 Ga0070698_100709789
296 Ga0070698_100755557
297 Ga0070698_100969736
298 Ga0070698_101597502
299 Ga0070699_100009093
300 Ga0070699_100224422
301 Ga0070699_102045296
302 Ga0070684_100573627
303 Ga0070697_101475340
304 Ga0070672_100120853
305 Ga0070672_100285349
306 Ga0070672_100346299
307 Ga0070686_101143026
308 Ga0070696_101897426
309 Ga0070665_100222857
310 Ga0070665_101628977
311 Ga0070664_100036585
312 Ga0068857_101012044
313 Ga0068857_102116044
314 Ga0068854_100116353
315 Ga0068864_101497942
316 Ga0068861_100020328
317 Ga0068861_101251442
318 Ga0068851_10090998
319 Ga0068870_10074298
320 Ga0068870_10152993
321 Ga0068863_100031829
322 Ga0068863_100219382
323 Ga0068863_100256456
324 Ga0068858_102340783
325 Ga0068860_100043870
326 Ga0068862_102258870
327 Ga0097621_101196395
328 Ga0097621_102283580
329 Ga0068871_100298774
330 Ga0075428_100726284
331 Ga0075428_102197508
332 Ga0075431_100249182
333 Ga0075434_100109685
334 Ga0075429_100025001
335 Ga0075429_100382841
336 Ga0068865_100021304
337 Ga0075435_100821579
338 Ga0075435_101036914
339 Ga0111539_10625130
340 Ga0105245_10632896
341 Ga0114129_10005744
342 Ga0114129_10262101
343 Ga0114129_10326167
344 Ga0114129_10348753
345 Ga0114129_10980643
346 Ga0105243_10266460
347 Ga0105242_10016099
348 Ga0105248_10426105
349 Ga0105248_10911944
350 Ga0105238_10003494
351 Ga0105249_11228976
352 Ga0105246_10040627
353 Ga0105246_11423648
354 Ga0157375_10534739
355 Ga0157375_10660509
356 Ga0157375_12407927
357 Ga0163163_10157451
358 Ga0163163_10292392
359 Ga0163163_10592070
360 Ga0163163_13057304
361 Ga0157380_10009861
362 Ga0157380_10034674
363 Ga0157380_10116236
364 Ga0157380_10169823
365 Ga0157380_10303945
366 Ga0157380_11134227
367 Ga0157380_12763922
368 Ga0157377_10028335
369 Ga0157377_10248253
370 Ga0157376_11132704
371 Ga0163161_10871711
372 Ga0207656_10120219
373 Ga0207682_10016865
374 Ga0207682_10124710
375 Ga0207682_10208539
376 Ga0207642_10003387
377 Ga0207645_10008005
378 Ga0207645_10513593
379 Ga0207643_10036079
380 Ga0207643_10083680
381 Ga0207643_10530155
382 Ga0207684_11385788
383 Ga0207662_10030591
384 Ga0207646_10036432
385 Ga0207646_11586857
386 Ga0207681_10017615
387 Ga0207681_10075766
388 Ga0207681_10140737
389 Ga0207681_10173464
390 Ga0207650_10308361
391 Ga0207659_10006878
392 Ga0207659_10007656
393 Ga0207659_10069252
394 Ga0207659_10128219
395 Ga0207659_10730218
396 Ga0207659_10824479
397 Ga0207687_10841350
398 Ga0207644_10115409
399 Ga0207686_10066608
400 Ga0207709_10270841
401 Ga0207670_10010043
402 Ga0207670_10062724
403 Ga0207669_10321721
404 Ga0207704_10001915
405 Ga0207704_10997542
406 Ga0207691_10042034
407 Ga0207691_10047969
408 Ga0207691_10096784
409 Ga0207691_10311334
410 Ga0207691_10892348
411 Ga0207689_10013682
412 Ga0207689_10094052
413 Ga0207661_10194166
414 Ga0207679_10100734
415 Ga0207651_10067607
416 Ga0207651_10085861
417 Ga0207651_10963490
418 Ga0207668_11157988
419 Ga0207640_10054949
420 Ga0207658_10268753
421 Ga0207677_10954801
422 Ga0207703_11971240
423 Ga0207678_10101636
424 Ga0207678_10467731
425 Ga0207708_10004076
426 Ga0207641_10048463
427 Ga0207641_10686313
428 Ga0207648_10000802
429 Ga0207676_10200146
430 Ga0207674_11793291
431 Ga0207675_100017282
432 Ga0207675_102634785
433 Ga0207683_11124642
434 Ga0207683_11291208
435 Ga0207683_11370521
436 Ga0207698_10789479
437 Ga0268266_10165344
438 Ga0268265_11316155
439 Ga0268264_10046363
440 Ga0265314_10015681
441 Ga0307412_10254314
442 Ga0307416_100588148
443 Ga0307411_10539202
444 Ga0373937_0274409
445 Ga0439435_0068630
446 Ga0451577_0968971
447 Ga0466960_0753490
448 Ga0451576_0027564
449 Ga0451576_0499887
450 Ga0451576_1546604
451 Ga0495603_0446436
452 Ga0495580_1021040
453 Ga0495598_0329853
454 Ga0495636_0063335
455 Ga0501036_1549802
456 Ga0501040_0873795
457 Ga0501067_0460711
458 Ga0501075_0682236
459 Ga0501207_038147
460 Ga0501235_043594
461 Ga0501080_0888792
462 Ga0501080_1528541
463 Ga0501081_0087994
464 Ga0501081_0093780
465 Ga0501279_101076
466 Ga0501035_0209106
467 Ga0501045_0163223
468 nmdc:mga05p37_182047_c1
469 nmdc:mga05p37_288001_c1
470 nmdc:mga05p37_446456_c1
471 nmdc:mga09592_153756_c1
472 nmdc:mga09592_267569_c1
473 nmdc:mga09592_574837_c1
474 nmdc:mga06r32_135067_c1
475 nmdc:mga06r32_852322_c1
476 nmdc:mga08y16_640023_c1
477 nmdc:mga0n895_1563593_c1
478 nmdc:mga0rr50_791203_c1
479 nmdc:mga0a205_1420478_c1
480 Ga0501082_0334793
481 Ga0501082_0978655
482 Ga0501082_1323113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06902

Fer4_19

Divergent 4Fe-4S mono-cluster

8

71

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_S 39s large subunit of the porcine mitochondrial ribosome 0.9281 5 17
1u02-assembly1.cif.gz_A crystal structure of trehalose-6-phosphate phosphatase related protein 0.9041 5 17
7ope-assembly1.cif.gz_S rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.8881 5 17
5ag9-assembly2.cif.gz_B crystal structure of a mutant (665sxa) c-terminal domain of rgpb 0.7433 5 19
3og4-assembly1.cif.gz_B the crystal structure of human interferon lambda 1 complexed with its high affinity receptor in space group p21212 0.6843 3 18
ID Description Score Start End Superfamily
af_A0A0P0XDX2_25_77_3.10.20.370 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7742 4 17 3.10.20.370
3wcyA04 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7558 4 17 2.60.40.10
af_Q108X5_23_276_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7486 4 20 2.120.10.80
af_Q9VIG1_173_412_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7474 4 17 2.130.10.10
1sz0B03 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.7334 5 18 2.70.130.10
ID Description Score Start End GO Terms
AF-A0A1J5L2Y2-F1-model_v4 Iron-binding zinc finger CDGSH type domain-containing protein 0.844 4 70 GO:0005737
GO:0043231
GO:0046872
GO:0051537
AF-A0A7Y8Y341-F1-model_v4 (4Fe-4S)-binding protein 0.8428 4 70
AF-A0A530K9I8-F1-model_v4 Iron-binding protein 0.832 4 70
AF-A0A562M9L2-F1-model_v4 Putative Fe-S cluster protein YjdI 0.8293 4 70
AF-A0A435GWF4-F1-model_v4 Iron-binding protein 0.8292 4 70 GO:0005737
GO:0043231
GO:0046872
GO:0051537

Map