F354466

General Info

Members Datasets Scaffolds Average Seq Length
242 138 242 120

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101998434|Ga0070707_1019984341
Length 140
Sequence MSKVSFTSTISGVSSCFEGMSDHEQVVLRYRDGRTERVTLEPIDATREVLLVKRDDGTSEIPFSELKAVFFPQTDPGGPLKTTANASLIAVEFTDGEVIRGLANYNPERNGFFLYPQDRTKNDRVFVVNSAIVSIEVEKL

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.83
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10048954 3300001991 Bacteria 859
2 JGI24033J26618_1013283 3300002155 Unclassified 998
3 Ga0065707_10155408 3300005295 Bacteria 1614
4 Ga0070658_10344345 3300005327 Unclassified 1275
5 Ga0070658_10574412 3300005327 Unclassified 976
6 Ga0070676_10210241 3300005328 Bacteria 1280
7 Ga0070683_100958871 3300005329 Bacteria 821
8 Ga0070670_100108777 3300005331 Bacteria 2389
9 Ga0070677_10315227 3300005333 Unclassified 799
10 Ga0068869_100008355 3300005334 Bacteria 6670
11 Ga0068869_100064307 3300005334 Bacteria 2698
12 Ga0068869_100787705 3300005334 Bacteria 816
13 Ga0068869_100849671 3300005334 Bacteria 787
14 Ga0070680_100966771 3300005336 Bacteria 735
15 Ga0070682_100000001 3300005337 Bacteria 569837
16 Ga0070682_100399419 3300005337 Bacteria 1039
17 Ga0068868_100000416 3300005338 Bacteria 28894
18 Ga0068868_100737212 3300005338 Bacteria 884
19 Ga0070689_100001226 3300005340 Bacteria 16289
20 Ga0070689_100503721 3300005340 Unclassified 1038
21 Ga0070689_100567961 3300005340 Bacteria 979
22 Ga0070689_101548917 3300005340 Unclassified 601
23 Ga0070691_10830011 3300005341 Unclassified 565
24 Ga0070691_10966993 3300005341 Unclassified 529
25 Ga0070692_10003292 3300005345 Bacteria 6521
26 Ga0070675_100000048 3300005354 Bacteria 73894
27 Ga0070673_100382385 3300005364 Bacteria 1255
28 Ga0070659_101477256 3300005366 Unclassified 605
29 Ga0070709_11211337 3300005434 Unclassified 607
30 Ga0070713_100016418 3300005436 Bacteria 5567
31 Ga0070713_100624456 3300005436 Bacteria 1025
32 Ga0070713_100761092 3300005436 Bacteria 927
33 Ga0070710_10737545 3300005437 Bacteria 698
34 Ga0070701_10005175 3300005438 Bacteria 5359
35 Ga0070705_100711101 3300005440 Unclassified 790
36 Ga0070700_100000025 3300005441 Bacteria 126198
37 Ga0070708_100001348 3300005445 Bacteria 18754
38 Ga0070708_100028594 3300005445 Bacteria 4799
39 Ga0070708_100278515 3300005445 Bacteria 1574
40 Ga0070708_101707724 3300005445 Unclassified 585
41 Ga0068867_100595295 3300005459 Unclassified 964
42 Ga0070685_10659291 3300005466 Unclassified 759
43 Ga0070706_100112870 3300005467 Unclassified 2530
44 Ga0070706_100224507 3300005467 Bacteria 1753
45 Ga0070706_100432619 3300005467 Unclassified 1225
46 Ga0070706_100683014 3300005467 Bacteria 953
47 Ga0070706_101178821 3300005467 Unclassified 704
48 Ga0070707_100081044 3300005468 Bacteria 3133
49 Ga0070707_100100745 3300005468 Bacteria 2799
50 Ga0070707_100115148 3300005468 Bacteria 2609
51 Ga0070707_100911193 3300005468 Bacteria 844
52 Ga0070707_101203954 3300005468 Bacteria 724
53 Ga0070707_101285212 3300005468 Bacteria 698
54 Ga0070707_101998434 3300005468 Bacteria 547
55 Ga0070698_100020592 3300005471 Bacteria 6916
56 Ga0070698_100414770 3300005471 Bacteria 1280
57 Ga0070698_100484532 3300005471 Bacteria 1174
58 Ga0070699_100004672 3300005518 Bacteria 12108
59 Ga0070699_100078137 3300005518 Unclassified 2882
60 Ga0070699_100188965 3300005518 Bacteria 1829
61 Ga0070699_100318568 3300005518 Bacteria 1397
62 Ga0070699_100991745 3300005518 Unclassified 770
63 Ga0070684_100072728 3300005535 Bacteria 3028
64 Ga0070697_100212321 3300005536 Bacteria 1648
65 Ga0070697_100386276 3300005536 Unclassified 1213
66 Ga0070672_100007730 3300005543 Bacteria 7324
67 Ga0070672_100254662 3300005543 Bacteria 1479
68 Ga0070686_100343483 3300005544 Bacteria 1119
69 Ga0070686_100644896 3300005544 Unclassified 839
70 Ga0070686_101156431 3300005544 Unclassified 641
71 Ga0070696_100214043 3300005546 Unclassified 1443
72 Ga0070693_100013039 3300005547 Bacteria 4223
73 Ga0070693_100796321 3300005547 Bacteria 700
74 Ga0070704_101008720 3300005549 Unclassified 753
75 Ga0070664_100272090 3300005564 Bacteria 1526
76 Ga0070702_100093075 3300005615 Bacteria 1832
77 Ga0070702_100257564 3300005615 Bacteria 1186
78 Ga0070702_101629691 3300005615 Unclassified 535
79 Ga0068852_101259082 3300005616 Unclassified 761
80 Ga0068859_100279657 3300005617 Bacteria 1761
81 Ga0068859_101800860 3300005617 Bacteria 676
82 Ga0068864_100000091 3300005618 Bacteria 96169
83 Ga0068870_10069660 3300005840 Bacteria 1914
84 Ga0068870_10200301 3300005840 Unclassified 1210
85 Ga0068858_100000306 3300005842 Bacteria 52410
86 Ga0068858_100331692 3300005842 Bacteria 1455
87 Ga0070717_10000082 3300006028 Bacteria 77627
88 Ga0070717_10533825 3300006028 Unclassified 1062
89 Ga0097621_100503251 3300006237 Unclassified 1097
90 Ga0068871_101001290 3300006358 Bacteria 778
91 Ga0068871_101793885 3300006358 Unclassified 582
92 Ga0075428_100029115 3300006844 Bacteria 6110
93 Ga0075428_100851211 3300006844 Unclassified 968
94 Ga0075430_101121242 3300006846 Unclassified 648
95 Ga0075431_100022242 3300006847 Bacteria 6483
96 Ga0075431_100465655 3300006847 Unclassified 1258
97 Ga0075433_11296174 3300006852 Bacteria 631
98 Ga0075434_100673306 3300006871 Bacteria 1053
99 Ga0075434_102056605 3300006871 Unclassified 576
100 Ga0075429_100325459 3300006880 Unclassified 1345
101 Ga0068865_100026648 3300006881 Bacteria 3813
102 Ga0075436_100012717 3300006914 Bacteria 5769
103 Ga0075436_100455450 3300006914 Unclassified 932
104 Ga0097620_100279653 3300006931 Bacteria 1761
105 Ga0097620_101800625 3300006931 Bacteria 676
106 Ga0075435_100015832 3300007076 Bacteria 5676
107 Ga0075435_100082157 3300007076 Bacteria 2648
108 Ga0075435_100698891 3300007076 Unclassified 881
109 Ga0105244_10016419 3300009036 Bacteria 4216
110 Ga0105240_10042858 3300009093 Bacteria 5765
111 Ga0105240_10806867 3300009093 Bacteria 1016
112 Ga0111539_10000052 3300009094 Bacteria 116307
113 Ga0105245_10000226 3300009098 Bacteria 53639
114 Ga0105245_10000463 3300009098 Bacteria 37232
115 Ga0105245_10037994 3300009098 Bacteria 4282
116 Ga0105245_10977967 3300009098 Bacteria 890
117 Ga0105245_11381623 3300009098 Unclassified 754
118 Ga0114129_10524877 3300009147 Bacteria 1543
119 Ga0114129_11676740 3300009147 Bacteria 776
120 Ga0114129_12225169 3300009147 Bacteria 659
121 Ga0105241_11032762 3300009174 Bacteria 771
122 Ga0105242_10002139 3300009176 Bacteria 15595
123 Ga0105239_10091187 3300010375 Bacteria 3363
124 Ga0105246_10089660 3300011119 Bacteria 2213
125 Ga0105246_11428189 3300011119 Unclassified 647
126 Ga0157378_10001046 3300013297 Bacteria 25286
127 Ga0157378_10005681 3300013297 Bacteria 10915
128 Ga0157378_10014164 3300013297 Bacteria 6978
129 Ga0163162_10005494 3300013306 Bacteria 12249
130 Ga0163162_13304407 3300013306 Unclassified 516
131 Ga0157372_11511223 3300013307 Bacteria 774
132 Ga0157372_12186138 3300013307 Bacteria 636
133 Ga0157375_10000008 3300013308 Bacteria 373560
134 Ga0157375_10000146 3300013308 Bacteria 69095
135 Ga0157375_10472250 3300013308 Bacteria 1419
136 Ga0157375_10661580 3300013308 Bacteria 1200
137 Ga0157380_10009829 3300014326 Bacteria 6867
138 Ga0157380_12613440 3300014326 Bacteria 571
139 Ga0157377_10000024 3300014745 Bacteria 142391
140 Ga0157376_11900938 3300014969 Bacteria 632
141 Ga0213873_10000002 3300021358 Bacteria 1164195
142 Ga0213873_10000556 3300021358 Bacteria 6049
143 Ga0213876_10000001 3300021384 Bacteria 1186326
144 Ga0213876_10000080 3300021384 Bacteria 109125
145 Ga0213876_10003504 3300021384 Bacteria 8963
146 Ga0213876_10069514 3300021384 Archaea 1860
147 Ga0213876_10253528 3300021384 Unclassified 935
148 Ga0207699_10935038 3300025906 Bacteria 640
149 Ga0207699_11138561 3300025906 Bacteria 578
150 Ga0207645_10219452 3300025907 Bacteria 1253
151 Ga0207643_10174600 3300025908 Bacteria 1298
152 Ga0207705_10497869 3300025909 Unclassified 946
153 Ga0207684_10087383 3300025910 Unclassified 2656
154 Ga0207684_10172118 3300025910 Bacteria 1866
155 Ga0207684_10590057 3300025910 Bacteria 949
156 Ga0207695_10860603 3300025913 Bacteria 786
157 Ga0207662_10003413 3300025918 Bacteria 8176
158 Ga0207662_11069129 3300025918 Bacteria 573
159 Ga0207646_10084154 3300025922 Bacteria 2846
160 Ga0207646_10274574 3300025922 Bacteria 1523
161 Ga0207646_10875771 3300025922 Bacteria 797
162 Ga0207646_11215694 3300025922 Bacteria 660
163 Ga0207650_10028914 3300025925 Bacteria 3979
164 Ga0207659_10000007 3300025926 Bacteria 322984
165 Ga0207687_10000003 3300025927 Bacteria 875159
166 Ga0207687_10009953 3300025927 Bacteria 6224
167 Ga0207687_10057844 3300025927 Bacteria 2725
168 Ga0207687_10792219 3300025927 Bacteria 808
169 Ga0207687_10832143 3300025927 Bacteria 788
170 Ga0207700_10016716 3300025928 Bacteria 4883
171 Ga0207686_10009690 3300025934 Bacteria 5233
172 Ga0207670_10001884 3300025936 Bacteria 10953
173 Ga0207670_10356634 3300025936 Unclassified 1159
174 Ga0207670_11300047 3300025936 Unclassified 617
175 Ga0207704_10046658 3300025938 Unclassified 2584
176 Ga0207665_10296041 3300025939 Bacteria 1208
177 Ga0207665_10860758 3300025939 Bacteria 718
178 Ga0207691_10014932 3300025940 Bacteria 7399
179 Ga0207689_10005570 3300025942 Bacteria 11244
180 Ga0207689_10079606 3300025942 Bacteria 2693
181 Ga0207689_10458975 3300025942 Bacteria 1065
182 Ga0207661_10997582 3300025944 Unclassified 771
183 Ga0207679_10191954 3300025945 Bacteria 1699
184 Ga0207651_10256946 3300025960 Bacteria 1432
185 Ga0207677_10000045 3300026023 Bacteria 106591
186 Ga0207677_12315291 3300026023 Bacteria 500
187 Ga0207703_10000104 3300026035 Bacteria 99914
188 Ga0207639_10000003 3300026041 Bacteria 806887
189 Ga0207708_10000052 3300026075 Bacteria 105169
190 Ga0207648_11006189 3300026089 Unclassified 781
191 Ga0207676_10000013 3300026095 Bacteria 343067
192 Ga0207683_10321447 3300026121 Bacteria 1418
193 Ga0207698_11163293 3300026142 Unclassified 785
194 Ga0207428_10000003 3300027907 Bacteria 799783
195 Ga0307511_10016183 3300030521 Bacteria 7199
196 Ga0307408_100451424 3300031548 Unclassified 1115
197 Ga0307412_12073047 3300031911 Unclassified 528
198 Ga0307507_10662141 3300033179 Unclassified 528
199 Ga0373940_0032340 3300035088 Bacteria 1402
200 Ga0373940_0033660 3300035088 Bacteria 1379
201 Ga0373932_0001312 3300035112 Bacteria 7007
202 Ga0373957_0295211 3300035120 Unclassified 687
203 Ga0373960_0426501 3300035121 Bacteria 516
204 Ga0373943_0057135 3300035170 Bacteria 1938
205 Ga0373947_0169220 3300035725 Bacteria 1417
206 Ga0395901_1631028 3300038443 Unclassified 598
207 Ga0436365_0304642 3300039437 Unclassified 2199
208 Ga0436365_0404975 3300039437 Bacteria 180420
209 Ga0436365_1065184 3300039437 Bacteria 16160
210 Ga0436365_1070820 3300039437 Unclassified 637
211 Ga0436365_1309399 3300039437 Unclassified 1004
212 Ga0436365_1340026 3300039437 Archaea 1860
213 Ga0436365_1645708 3300039437 Bacteria 58473
214 Ga0436363_0359896 3300039450 Bacteria 847
215 Ga0436363_1229360 3300039450 Unclassified 598
216 Ga0436362_0407005 3300039453 Bacteria 15587
217 Ga0436362_0660519 3300039453 Bacteria 832172
218 Ga0451839_1291018 3300041496 Bacteria 2920
219 Ga0453683_0044274 3300044673 Bacteria 2792
220 Ga0453683_0572252 3300044673 Unclassified 736
221 Ga0466964_0303680 3300044706 Unclassified 805
222 Ga0495620_0001501 3300046515 Bacteria 13890
223 Ga0495669_0442176 3300046684 Unclassified 631
224 Ga0495679_018766 3300047446 Bacteria 2446
225 Ga0496100_1475081 3300048903 Unclassified 537
226 Ga0496104_1041649 3300048907 Unclassified 722
227 Ga0501073_0000867 3300049589 Bacteria 21612
228 Ga0501080_0044787 3300049742 Bacteria 4118
229 nmdc:mga05p37_1487930_c1 3300050507 Bacteria 675
230 nmdc:mga05p37_195884_c1 3300050507 Bacteria 2450
231 nmdc:mga05p37_425195_c1 3300050507 Bacteria 1545
232 nmdc:mga09592_337175_c1 3300050508 Bacteria 1305
233 nmdc:mga06r32_18545_c1 3300050510 Bacteria 6373
234 nmdc:mga08y16_4_c1 3300050511 Bacteria 916963
235 nmdc:mga0n895_897128_c1 3300050512 Bacteria 872
236 nmdc:mga0rr50_1151_c1 3300050513 Bacteria 14387
237 nmdc:mga0rr50_286215_c1 3300050513 Unclassified 1376
238 nmdc:mga0rr50_71453_c1 3300050513 Bacteria 2648
239 nmdc:mga08x19_153321_c1 3300050514 Unclassified 1561
240 nmdc:mga08x19_1942_c1 3300050514 Bacteria 12647
241 nmdc:mga08x19_552036_c1 3300050514 Unclassified 815
242 Ga0495655_0000031 3300053083 Bacteria 30487

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10806867 Ga0105240_108068673 109
2 3300025913 Ga0207695_10860603 Ga0207695_108606032 109
3 3300005329 Ga0070683_100958871 Ga0070683_1009588712 113
4 3300005338 Ga0068868_100000416 Ga0068868_10000041616 113
5 3300005544 Ga0070686_100343483 Ga0070686_1003434831 113
6 3300013308 Ga0157375_10661580 Ga0157375_106615802 113
7 3300026023 Ga0207677_10000045 Ga0207677_1000004562 113
8 3300026023 Ga0207677_12315291 Ga0207677_123152912 113
9 3300021384 Ga0213876_10253528 Ga0213876_102535282 114
10 3300025936 Ga0207670_10356634 Ga0207670_103566342 114
11 3300039437 Ga0436365_1309399 Ga0436365_1309399_469_825 114
12 3300039450 Ga0436363_0359896 Ga0436363_0359896_483_830 114
13 3300005327 Ga0070658_10344345 Ga0070658_103443452 116
14 3300005466 Ga0070685_10659291 Ga0070685_106592912 116
15 3300005615 Ga0070702_100257564 Ga0070702_1002575641 116
16 3300006844 Ga0075428_100851211 Ga0075428_1008512112 116
17 3300025918 Ga0207662_10003413 Ga0207662_100034134 116
18 3300025918 Ga0207662_11069129 Ga0207662_110691292 116
19 3300031911 Ga0307412_12073047 Ga0307412_120730471 116
20 3300005295 Ga0065707_10155408 Ga0065707_101554082 117
21 3300005340 Ga0070689_100567961 Ga0070689_1005679612 117
22 3300005616 Ga0068852_101259082 Ga0068852_1012590822 117
23 3300006028 Ga0070717_10533825 Ga0070717_105338252 117
24 3300006358 Ga0068871_101001290 Ga0068871_1010012902 117
25 3300009093 Ga0105240_10042858 Ga0105240_100428585 117
26 3300009094 Ga0111539_10000052 Ga0111539_1000005227 117
27 3300013307 Ga0157372_11511223 Ga0157372_115112232 117
28 3300026041 Ga0207639_10000003 Ga0207639_100000035 117
29 3300026142 Ga0207698_11163293 Ga0207698_111632932 117
30 3300027907 Ga0207428_10000003 Ga0207428_1000000327 117
31 3300035088 Ga0373940_0032340 Ga0373940_0032340_54_413 117
32 3300039450 Ga0436363_1229360 Ga0436363_1229360_78_437 117
33 3300050511 nmdc:mga08y16_4_c1 nmdc:mga08y16_4_c1_889906_890262 117
34 3300005328 Ga0070676_10210241 Ga0070676_102102412 118
35 3300005334 Ga0068869_100064307 Ga0068869_1000643074 118
36 3300005334 Ga0068869_100787705 Ga0068869_1007877052 118
37 3300005338 Ga0068868_100737212 Ga0068868_1007372122 118
38 3300005340 Ga0070689_100503721 Ga0070689_1005037212 118
39 3300005340 Ga0070689_101548917 Ga0070689_1015489172 118
40 3300005341 Ga0070691_10966993 Ga0070691_109669931 118
41 3300005354 Ga0070675_100000048 Ga0070675_10000004835 118
42 3300005366 Ga0070659_101477256 Ga0070659_1014772561 118
43 3300005434 Ga0070709_11211337 Ga0070709_112113371 118
44 3300005436 Ga0070713_100016418 Ga0070713_1000164185 118
45 3300005438 Ga0070701_10005175 Ga0070701_100051755 118
46 3300005440 Ga0070705_100711101 Ga0070705_1007111012 118
47 3300005441 Ga0070700_100000025 Ga0070700_10000002585 118
48 3300005445 Ga0070708_100028594 Ga0070708_1000285941 118
49 3300005459 Ga0068867_100595295 Ga0068867_1005952952 118
50 3300005467 Ga0070706_100224507 Ga0070706_1002245073 118
51 3300005468 Ga0070707_100115148 Ga0070707_1001151482 118
52 3300005471 Ga0070698_100020592 Ga0070698_1000205921 118
53 3300005471 Ga0070698_100484532 Ga0070698_1004845321 118
54 3300005518 Ga0070699_100188965 Ga0070699_1001889652 118
55 3300005518 Ga0070699_100318568 Ga0070699_1003185682 118
56 3300005544 Ga0070686_101156431 Ga0070686_1011564311 118
57 3300005546 Ga0070696_100214043 Ga0070696_1002140432 118
58 3300005547 Ga0070693_100013039 Ga0070693_1000130394 118
59 3300005615 Ga0070702_101629691 Ga0070702_1016296911 118
60 3300005617 Ga0068859_100279657 Ga0068859_1002796572 118
61 3300005617 Ga0068859_101800860 Ga0068859_1018008602 118
62 3300005840 Ga0068870_10069660 Ga0068870_100696602 118
63 3300006028 Ga0070717_10000082 Ga0070717_1000008243 118
64 3300006847 Ga0075431_100022242 Ga0075431_1000222426 118
65 3300006852 Ga0075433_11296174 Ga0075433_112961742 118
66 3300006871 Ga0075434_100673306 Ga0075434_1006733062 118
67 3300006880 Ga0075429_100325459 Ga0075429_1003254592 118
68 3300006914 Ga0075436_100012717 Ga0075436_1000127175 118
69 3300006931 Ga0097620_100279653 Ga0097620_1002796532 118
70 3300006931 Ga0097620_101800625 Ga0097620_1018006252 118
71 3300007076 Ga0075435_100015832 Ga0075435_1000158325 118
72 3300007076 Ga0075435_100082157 Ga0075435_1000821573 118
73 3300009036 Ga0105244_10016419 Ga0105244_100164193 118
74 3300009147 Ga0114129_10524877 Ga0114129_105248773 118
75 3300009147 Ga0114129_11676740 Ga0114129_116767402 118
76 3300009147 Ga0114129_12225169 Ga0114129_122251691 118
77 3300009176 Ga0105242_10002139 Ga0105242_100021394 118
78 3300014326 Ga0157380_12613440 Ga0157380_126134402 118
79 3300014745 Ga0157377_10000024 Ga0157377_1000002485 118
80 3300014969 Ga0157376_11900938 Ga0157376_119009382 118
81 3300021358 Ga0213873_10000002 Ga0213873_10000002870 118
82 3300021384 Ga0213876_10000001 Ga0213876_10000001953 118
83 3300021384 Ga0213876_10069514 Ga0213876_100695142 118
84 3300025907 Ga0207645_10219452 Ga0207645_102194522 118
85 3300025908 Ga0207643_10174600 Ga0207643_101746002 118
86 3300025922 Ga0207646_10875771 Ga0207646_108757712 118
87 3300025926 Ga0207659_10000007 Ga0207659_10000007264 118
88 3300025928 Ga0207700_10016716 Ga0207700_100167164 118
89 3300025934 Ga0207686_10009690 Ga0207686_100096904 118
90 3300025936 Ga0207670_11300047 Ga0207670_113000472 118
91 3300025939 Ga0207665_10860758 Ga0207665_108607582 118
92 3300025942 Ga0207689_10079606 Ga0207689_100796063 118
93 3300026075 Ga0207708_10000052 Ga0207708_1000005263 118
94 3300026089 Ga0207648_11006189 Ga0207648_110061892 118
95 3300035088 Ga0373940_0033660 Ga0373940_0033660_1010_1369 118
96 3300035112 Ga0373932_0001312 Ga0373932_0001312_5828_6187 118
97 3300039437 Ga0436365_0304642 Ga0436365_0304642_786_1142 118
98 3300039437 Ga0436365_0404975 Ga0436365_0404975_140712_141068 118
99 3300039437 Ga0436365_1340026 Ga0436365_1340026_610_966 118
100 3300039453 Ga0436362_0660519 Ga0436362_0660519_54049_54405 118
101 3300044673 Ga0453683_0572252 Ga0453683_0572252_214_573 118
102 3300046515 Ga0495620_0001501 Ga0495620_0001501_7601_7963 118
103 3300046684 Ga0495669_0442176 Ga0495669_0442176_124_483 118
104 3300049589 Ga0501073_0000867 Ga0501073_0000867_1769_2131 118
105 3300049742 Ga0501080_0044787 Ga0501080_0044787_1246_1608 118
106 3300050507 nmdc:mga05p37_1487930_c1 nmdc:mga05p37_1487930_c1_56_415 118
107 3300050507 nmdc:mga05p37_195884_c1 nmdc:mga05p37_195884_c1_1022_1384 118
108 3300050508 nmdc:mga09592_337175_c1 nmdc:mga09592_337175_c1_528_890 118
109 3300050510 nmdc:mga06r32_18545_c1 nmdc:mga06r32_18545_c1_5311_5673 118
110 3300050512 nmdc:mga0n895_897128_c1 nmdc:mga0n895_897128_c1_473_832 118
111 3300050513 nmdc:mga0rr50_1151_c1 nmdc:mga0rr50_1151_c1_2480_2839 118
112 3300050513 nmdc:mga0rr50_71453_c1 nmdc:mga0rr50_71453_c1_1955_2314 118
113 3300050514 nmdc:mga08x19_1942_c1 nmdc:mga08x19_1942_c1_9038_9397 118
114 3300050514 nmdc:mga08x19_552036_c1 nmdc:mga08x19_552036_c1_441_800 118
115 3300053083 Ga0495655_0000031 Ga0495655_0000031_19198_19557 118
116 3300002155 JGI24033J26618_1013283 JGI24033J26618_10132832 119
117 3300005437 Ga0070710_10737545 Ga0070710_107375452 119
118 3300005445 Ga0070708_100278515 Ga0070708_1002785152 119
119 3300005468 Ga0070707_100100745 Ga0070707_1001007452 119
120 3300005468 Ga0070707_101203954 Ga0070707_1012039542 119
121 3300005468 Ga0070707_101998434 Ga0070707_1019984341 119
122 3300005471 Ga0070698_100414770 Ga0070698_1004147701 119
123 3300005518 Ga0070699_100991745 Ga0070699_1009917451 119
124 3300005549 Ga0070704_101008720 Ga0070704_1010087202 119
125 3300005840 Ga0068870_10200301 Ga0068870_102003012 119
126 3300006844 Ga0075428_100029115 Ga0075428_1000291157 119
127 3300006847 Ga0075431_100465655 Ga0075431_1004656552 119
128 3300006914 Ga0075436_100455450 Ga0075436_1004554502 119
129 3300021384 Ga0213876_10003504 Ga0213876_100035048 119
130 3300025922 Ga0207646_10084154 Ga0207646_100841544 119
131 3300026121 Ga0207683_10321447 Ga0207683_103214472 119
132 3300030521 Ga0307511_10016183 Ga0307511_100161838 119
133 3300035170 Ga0373943_0057135 Ga0373943_0057135_1187_1549 119
134 3300039437 Ga0436365_1065184 Ga0436365_1065184_7397_7759 119
135 3300039437 Ga0436365_1070820 Ga0436365_1070820_205_567 119
136 3300044706 Ga0466964_0303680 Ga0466964_0303680_29_394 119
137 3300048903 Ga0496100_1475081 Ga0496100_1475081_57_422 119
138 3300048907 Ga0496104_1041649 Ga0496104_1041649_32_394 119
139 3300050514 nmdc:mga08x19_153321_c1 nmdc:mga08x19_153321_c1_253_615 119
140 3300001991 JGI24743J22301_10048954 JGI24743J22301_100489542 120
141 3300005327 Ga0070658_10574412 Ga0070658_105744122 120
142 3300005331 Ga0070670_100108777 Ga0070670_1001087772 120
143 3300005333 Ga0070677_10315227 Ga0070677_103152272 120
144 3300005334 Ga0068869_100008355 Ga0068869_1000083554 120
145 3300005334 Ga0068869_100849671 Ga0068869_1008496712 120
146 3300005336 Ga0070680_100966771 Ga0070680_1009667712 120
147 3300005337 Ga0070682_100000001 Ga0070682_100000001470 120
148 3300005337 Ga0070682_100399419 Ga0070682_1003994192 120
149 3300005340 Ga0070689_100001226 Ga0070689_10000122614 120
150 3300005341 Ga0070691_10830011 Ga0070691_108300112 120
151 3300005345 Ga0070692_10003292 Ga0070692_100032924 120
152 3300005364 Ga0070673_100382385 Ga0070673_1003823852 120
153 3300005436 Ga0070713_100624456 Ga0070713_1006244561 120
154 3300005436 Ga0070713_100761092 Ga0070713_1007610921 120
155 3300005445 Ga0070708_100001348 Ga0070708_10000134816 120
156 3300005445 Ga0070708_101707724 Ga0070708_1017077241 120
157 3300005467 Ga0070706_100112870 Ga0070706_1001128703 120
158 3300005467 Ga0070706_100432619 Ga0070706_1004326191 120
159 3300005467 Ga0070706_100683014 Ga0070706_1006830142 120
160 3300005467 Ga0070706_101178821 Ga0070706_1011788212 120
161 3300005468 Ga0070707_100081044 Ga0070707_1000810441 120
162 3300005468 Ga0070707_100911193 Ga0070707_1009111932 120
163 3300005468 Ga0070707_101285212 Ga0070707_1012852121 120
164 3300005518 Ga0070699_100004672 Ga0070699_10000467213 120
165 3300005518 Ga0070699_100078137 Ga0070699_1000781373 120
166 3300005535 Ga0070684_100072728 Ga0070684_1000727282 120
167 3300005536 Ga0070697_100212321 Ga0070697_1002123212 120
168 3300005536 Ga0070697_100386276 Ga0070697_1003862762 120
169 3300005543 Ga0070672_100007730 Ga0070672_1000077301 120
170 3300005543 Ga0070672_100254662 Ga0070672_1002546622 120
171 3300005544 Ga0070686_100644896 Ga0070686_1006448962 120
172 3300005547 Ga0070693_100796321 Ga0070693_1007963211 120
173 3300005564 Ga0070664_100272090 Ga0070664_1002720902 120
174 3300005615 Ga0070702_100093075 Ga0070702_1000930754 120
175 3300005618 Ga0068864_100000091 Ga0068864_10000009126 120
176 3300005842 Ga0068858_100000306 Ga0068858_10000030646 120
177 3300005842 Ga0068858_100331692 Ga0068858_1003316922 120
178 3300006237 Ga0097621_100503251 Ga0097621_1005032512 120
179 3300006358 Ga0068871_101793885 Ga0068871_1017938852 120
180 3300006846 Ga0075430_101121242 Ga0075430_1011212422 120
181 3300006871 Ga0075434_102056605 Ga0075434_1020566052 120
182 3300006881 Ga0068865_100026648 Ga0068865_1000266486 120
183 3300007076 Ga0075435_100698891 Ga0075435_1006988912 120
184 3300009098 Ga0105245_10000226 Ga0105245_1000022628 120
185 3300009098 Ga0105245_10000463 Ga0105245_1000046325 120
186 3300009098 Ga0105245_10037994 Ga0105245_100379947 120
187 3300009098 Ga0105245_10977967 Ga0105245_109779672 120
188 3300009098 Ga0105245_11381623 Ga0105245_113816232 120
189 3300009174 Ga0105241_11032762 Ga0105241_110327621 120
190 3300010375 Ga0105239_10091187 Ga0105239_100911873 120
191 3300011119 Ga0105246_10089660 Ga0105246_100896603 120
192 3300011119 Ga0105246_11428189 Ga0105246_114281892 120
193 3300013297 Ga0157378_10001046 Ga0157378_100010467 120
194 3300013297 Ga0157378_10005681 Ga0157378_100056817 120
195 3300013297 Ga0157378_10014164 Ga0157378_100141642 120
196 3300013306 Ga0163162_10005494 Ga0163162_1000549410 120
197 3300013306 Ga0163162_13304407 Ga0163162_133044071 120
198 3300013307 Ga0157372_12186138 Ga0157372_121861381 120
199 3300013308 Ga0157375_10000008 Ga0157375_10000008242 120
200 3300013308 Ga0157375_10000146 Ga0157375_1000014625 120
201 3300013308 Ga0157375_10472250 Ga0157375_104722502 120
202 3300014326 Ga0157380_10009829 Ga0157380_100098298 120
203 3300021358 Ga0213873_10000556 Ga0213873_100005565 120
204 3300021384 Ga0213876_10000080 Ga0213876_1000008074 120
205 3300025906 Ga0207699_10935038 Ga0207699_109350382 120
206 3300025906 Ga0207699_11138561 Ga0207699_111385612 120
207 3300025909 Ga0207705_10497869 Ga0207705_104978692 120
208 3300025910 Ga0207684_10087383 Ga0207684_100873834 120
209 3300025910 Ga0207684_10172118 Ga0207684_101721183 120
210 3300025910 Ga0207684_10590057 Ga0207684_105900572 120
211 3300025922 Ga0207646_10274574 Ga0207646_102745742 120
212 3300025922 Ga0207646_11215694 Ga0207646_112156942 120
213 3300025925 Ga0207650_10028914 Ga0207650_100289145 120
214 3300025927 Ga0207687_10000003 Ga0207687_10000003195 120
215 3300025927 Ga0207687_10009953 Ga0207687_100099537 120
216 3300025927 Ga0207687_10057844 Ga0207687_100578442 120
217 3300025927 Ga0207687_10792219 Ga0207687_107922192 120
218 3300025927 Ga0207687_10832143 Ga0207687_108321432 120
219 3300025936 Ga0207670_10001884 Ga0207670_100018849 120
220 3300025938 Ga0207704_10046658 Ga0207704_100466583 120
221 3300025939 Ga0207665_10296041 Ga0207665_102960412 120
222 3300025940 Ga0207691_10014932 Ga0207691_100149321 120
223 3300025942 Ga0207689_10005570 Ga0207689_100055704 120
224 3300025942 Ga0207689_10458975 Ga0207689_104589752 120
225 3300025944 Ga0207661_10997582 Ga0207661_109975822 120
226 3300025945 Ga0207679_10191954 Ga0207679_101919542 120
227 3300025960 Ga0207651_10256946 Ga0207651_102569462 120
228 3300026035 Ga0207703_10000104 Ga0207703_1000010437 120
229 3300026095 Ga0207676_10000013 Ga0207676_10000013175 120
230 3300031548 Ga0307408_100451424 Ga0307408_1004514242 120
231 3300033179 Ga0307507_10662141 Ga0307507_106621411 120
232 3300035120 Ga0373957_0295211 Ga0373957_0295211_235_600 120
233 3300035121 Ga0373960_0426501 Ga0373960_0426501_65_427 120
234 3300035725 Ga0373947_0169220 Ga0373947_0169220_769_1134 120
235 3300038443 Ga0395901_1631028 Ga0395901_1631028_214_576 120
236 3300039437 Ga0436365_1645708 Ga0436365_1645708_11801_12166 120
237 3300039453 Ga0436362_0407005 Ga0436362_0407005_2939_3304 120
238 3300041496 Ga0451839_1291018 Ga0451839_1291018_2371_2733 120
239 3300044673 Ga0453683_0044274 Ga0453683_0044274_382_747 120
240 3300047446 Ga0495679_018766 Ga0495679_018766_89_451 120
241 3300050507 nmdc:mga05p37_425195_c1 nmdc:mga05p37_425195_c1_917_1282 120
242 3300050513 nmdc:mga0rr50_286215_c1 nmdc:mga0rr50_286215_c1_268_633 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22478

DUF6982

Family of unknown function (DUF6982)

22

139

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5szd-assembly1.cif.gz_A crystal structure of aquifex aeolicus hfq at 1.5a 0.8391 67 120
3fif-assembly6.cif.gz_F crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a. 0.8368 5 58
6gwk-assembly4.cif.gz_W the crystal structure of hfq from caulobacter crescentus 0.8339 3 56
8bvh-assembly1.cif.gz_C cryo-em structure of the hfq-crc-amie translation repression assembly. 0.8313 4 57
6gwk-assembly4.cif.gz_T the crystal structure of hfq from caulobacter crescentus 0.8226 67 120
ID Description Score Start End Superfamily
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.8684 4 51 2.30.30.100
6gwkT00 Mainly Beta;Roll;SH3 type barrels.; 0.8226 67 120 2.30.30.100
3hfoB00 Mainly Beta;Roll;SH3 type barrels.; 0.8225 4 56 2.30.30.100
af_P9WH17_92_157_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8195 66 120 2.30.30.100
3hfnB00 Mainly Beta;Roll;SH3 type barrels.; 0.8056 66 118 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A2V7YEH2-F1-model_v4 Uncharacterized protein 0.9573 1 120
AF-A0A661NHW6-F1-model_v4 Uncharacterized protein 0.9281 5 118
AF-A0A0D6QDM3-F1-model_v4 IgA FC receptor 0.9119 5 118
AF-A0A7X9DVG4-F1-model_v4 Uncharacterized protein 0.9046 1 120
AF-Q2IM12-F1-model_v4 CheA signal transduction histidine kinase 0.9045 5 118

Feature Viewer

pLDDT pTM Quality
90.79 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map