F354466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 138 | 242 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_101998434|Ga0070707_1019984341 |
| Length | 140 |
| Sequence | MSKVSFTSTISGVSSCFEGMSDHEQVVLRYRDGRTERVTLEPIDATREVLLVKRDDGTSEIPFSELKAVFFPQTDPGGPLKTTANASLIAVEFTDGEVIRGLANYNPERNGFFLYPQDRTKNDRVFVVNSAIVSIEVEKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 110 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 111 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 114 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 119 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 120 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 121 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 122 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 123 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 124 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 92.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10048954 | 3300001991 | Bacteria | 859 |
| 2 | JGI24033J26618_1013283 | 3300002155 | Unclassified | 998 |
| 3 | Ga0065707_10155408 | 3300005295 | Bacteria | 1614 |
| 4 | Ga0070658_10344345 | 3300005327 | Unclassified | 1275 |
| 5 | Ga0070658_10574412 | 3300005327 | Unclassified | 976 |
| 6 | Ga0070676_10210241 | 3300005328 | Bacteria | 1280 |
| 7 | Ga0070683_100958871 | 3300005329 | Bacteria | 821 |
| 8 | Ga0070670_100108777 | 3300005331 | Bacteria | 2389 |
| 9 | Ga0070677_10315227 | 3300005333 | Unclassified | 799 |
| 10 | Ga0068869_100008355 | 3300005334 | Bacteria | 6670 |
| 11 | Ga0068869_100064307 | 3300005334 | Bacteria | 2698 |
| 12 | Ga0068869_100787705 | 3300005334 | Bacteria | 816 |
| 13 | Ga0068869_100849671 | 3300005334 | Bacteria | 787 |
| 14 | Ga0070680_100966771 | 3300005336 | Bacteria | 735 |
| 15 | Ga0070682_100000001 | 3300005337 | Bacteria | 569837 |
| 16 | Ga0070682_100399419 | 3300005337 | Bacteria | 1039 |
| 17 | Ga0068868_100000416 | 3300005338 | Bacteria | 28894 |
| 18 | Ga0068868_100737212 | 3300005338 | Bacteria | 884 |
| 19 | Ga0070689_100001226 | 3300005340 | Bacteria | 16289 |
| 20 | Ga0070689_100503721 | 3300005340 | Unclassified | 1038 |
| 21 | Ga0070689_100567961 | 3300005340 | Bacteria | 979 |
| 22 | Ga0070689_101548917 | 3300005340 | Unclassified | 601 |
| 23 | Ga0070691_10830011 | 3300005341 | Unclassified | 565 |
| 24 | Ga0070691_10966993 | 3300005341 | Unclassified | 529 |
| 25 | Ga0070692_10003292 | 3300005345 | Bacteria | 6521 |
| 26 | Ga0070675_100000048 | 3300005354 | Bacteria | 73894 |
| 27 | Ga0070673_100382385 | 3300005364 | Bacteria | 1255 |
| 28 | Ga0070659_101477256 | 3300005366 | Unclassified | 605 |
| 29 | Ga0070709_11211337 | 3300005434 | Unclassified | 607 |
| 30 | Ga0070713_100016418 | 3300005436 | Bacteria | 5567 |
| 31 | Ga0070713_100624456 | 3300005436 | Bacteria | 1025 |
| 32 | Ga0070713_100761092 | 3300005436 | Bacteria | 927 |
| 33 | Ga0070710_10737545 | 3300005437 | Bacteria | 698 |
| 34 | Ga0070701_10005175 | 3300005438 | Bacteria | 5359 |
| 35 | Ga0070705_100711101 | 3300005440 | Unclassified | 790 |
| 36 | Ga0070700_100000025 | 3300005441 | Bacteria | 126198 |
| 37 | Ga0070708_100001348 | 3300005445 | Bacteria | 18754 |
| 38 | Ga0070708_100028594 | 3300005445 | Bacteria | 4799 |
| 39 | Ga0070708_100278515 | 3300005445 | Bacteria | 1574 |
| 40 | Ga0070708_101707724 | 3300005445 | Unclassified | 585 |
| 41 | Ga0068867_100595295 | 3300005459 | Unclassified | 964 |
| 42 | Ga0070685_10659291 | 3300005466 | Unclassified | 759 |
| 43 | Ga0070706_100112870 | 3300005467 | Unclassified | 2530 |
| 44 | Ga0070706_100224507 | 3300005467 | Bacteria | 1753 |
| 45 | Ga0070706_100432619 | 3300005467 | Unclassified | 1225 |
| 46 | Ga0070706_100683014 | 3300005467 | Bacteria | 953 |
| 47 | Ga0070706_101178821 | 3300005467 | Unclassified | 704 |
| 48 | Ga0070707_100081044 | 3300005468 | Bacteria | 3133 |
| 49 | Ga0070707_100100745 | 3300005468 | Bacteria | 2799 |
| 50 | Ga0070707_100115148 | 3300005468 | Bacteria | 2609 |
| 51 | Ga0070707_100911193 | 3300005468 | Bacteria | 844 |
| 52 | Ga0070707_101203954 | 3300005468 | Bacteria | 724 |
| 53 | Ga0070707_101285212 | 3300005468 | Bacteria | 698 |
| 54 | Ga0070707_101998434 | 3300005468 | Bacteria | 547 |
| 55 | Ga0070698_100020592 | 3300005471 | Bacteria | 6916 |
| 56 | Ga0070698_100414770 | 3300005471 | Bacteria | 1280 |
| 57 | Ga0070698_100484532 | 3300005471 | Bacteria | 1174 |
| 58 | Ga0070699_100004672 | 3300005518 | Bacteria | 12108 |
| 59 | Ga0070699_100078137 | 3300005518 | Unclassified | 2882 |
| 60 | Ga0070699_100188965 | 3300005518 | Bacteria | 1829 |
| 61 | Ga0070699_100318568 | 3300005518 | Bacteria | 1397 |
| 62 | Ga0070699_100991745 | 3300005518 | Unclassified | 770 |
| 63 | Ga0070684_100072728 | 3300005535 | Bacteria | 3028 |
| 64 | Ga0070697_100212321 | 3300005536 | Bacteria | 1648 |
| 65 | Ga0070697_100386276 | 3300005536 | Unclassified | 1213 |
| 66 | Ga0070672_100007730 | 3300005543 | Bacteria | 7324 |
| 67 | Ga0070672_100254662 | 3300005543 | Bacteria | 1479 |
| 68 | Ga0070686_100343483 | 3300005544 | Bacteria | 1119 |
| 69 | Ga0070686_100644896 | 3300005544 | Unclassified | 839 |
| 70 | Ga0070686_101156431 | 3300005544 | Unclassified | 641 |
| 71 | Ga0070696_100214043 | 3300005546 | Unclassified | 1443 |
| 72 | Ga0070693_100013039 | 3300005547 | Bacteria | 4223 |
| 73 | Ga0070693_100796321 | 3300005547 | Bacteria | 700 |
| 74 | Ga0070704_101008720 | 3300005549 | Unclassified | 753 |
| 75 | Ga0070664_100272090 | 3300005564 | Bacteria | 1526 |
| 76 | Ga0070702_100093075 | 3300005615 | Bacteria | 1832 |
| 77 | Ga0070702_100257564 | 3300005615 | Bacteria | 1186 |
| 78 | Ga0070702_101629691 | 3300005615 | Unclassified | 535 |
| 79 | Ga0068852_101259082 | 3300005616 | Unclassified | 761 |
| 80 | Ga0068859_100279657 | 3300005617 | Bacteria | 1761 |
| 81 | Ga0068859_101800860 | 3300005617 | Bacteria | 676 |
| 82 | Ga0068864_100000091 | 3300005618 | Bacteria | 96169 |
| 83 | Ga0068870_10069660 | 3300005840 | Bacteria | 1914 |
| 84 | Ga0068870_10200301 | 3300005840 | Unclassified | 1210 |
| 85 | Ga0068858_100000306 | 3300005842 | Bacteria | 52410 |
| 86 | Ga0068858_100331692 | 3300005842 | Bacteria | 1455 |
| 87 | Ga0070717_10000082 | 3300006028 | Bacteria | 77627 |
| 88 | Ga0070717_10533825 | 3300006028 | Unclassified | 1062 |
| 89 | Ga0097621_100503251 | 3300006237 | Unclassified | 1097 |
| 90 | Ga0068871_101001290 | 3300006358 | Bacteria | 778 |
| 91 | Ga0068871_101793885 | 3300006358 | Unclassified | 582 |
| 92 | Ga0075428_100029115 | 3300006844 | Bacteria | 6110 |
| 93 | Ga0075428_100851211 | 3300006844 | Unclassified | 968 |
| 94 | Ga0075430_101121242 | 3300006846 | Unclassified | 648 |
| 95 | Ga0075431_100022242 | 3300006847 | Bacteria | 6483 |
| 96 | Ga0075431_100465655 | 3300006847 | Unclassified | 1258 |
| 97 | Ga0075433_11296174 | 3300006852 | Bacteria | 631 |
| 98 | Ga0075434_100673306 | 3300006871 | Bacteria | 1053 |
| 99 | Ga0075434_102056605 | 3300006871 | Unclassified | 576 |
| 100 | Ga0075429_100325459 | 3300006880 | Unclassified | 1345 |
| 101 | Ga0068865_100026648 | 3300006881 | Bacteria | 3813 |
| 102 | Ga0075436_100012717 | 3300006914 | Bacteria | 5769 |
| 103 | Ga0075436_100455450 | 3300006914 | Unclassified | 932 |
| 104 | Ga0097620_100279653 | 3300006931 | Bacteria | 1761 |
| 105 | Ga0097620_101800625 | 3300006931 | Bacteria | 676 |
| 106 | Ga0075435_100015832 | 3300007076 | Bacteria | 5676 |
| 107 | Ga0075435_100082157 | 3300007076 | Bacteria | 2648 |
| 108 | Ga0075435_100698891 | 3300007076 | Unclassified | 881 |
| 109 | Ga0105244_10016419 | 3300009036 | Bacteria | 4216 |
| 110 | Ga0105240_10042858 | 3300009093 | Bacteria | 5765 |
| 111 | Ga0105240_10806867 | 3300009093 | Bacteria | 1016 |
| 112 | Ga0111539_10000052 | 3300009094 | Bacteria | 116307 |
| 113 | Ga0105245_10000226 | 3300009098 | Bacteria | 53639 |
| 114 | Ga0105245_10000463 | 3300009098 | Bacteria | 37232 |
| 115 | Ga0105245_10037994 | 3300009098 | Bacteria | 4282 |
| 116 | Ga0105245_10977967 | 3300009098 | Bacteria | 890 |
| 117 | Ga0105245_11381623 | 3300009098 | Unclassified | 754 |
| 118 | Ga0114129_10524877 | 3300009147 | Bacteria | 1543 |
| 119 | Ga0114129_11676740 | 3300009147 | Bacteria | 776 |
| 120 | Ga0114129_12225169 | 3300009147 | Bacteria | 659 |
| 121 | Ga0105241_11032762 | 3300009174 | Bacteria | 771 |
| 122 | Ga0105242_10002139 | 3300009176 | Bacteria | 15595 |
| 123 | Ga0105239_10091187 | 3300010375 | Bacteria | 3363 |
| 124 | Ga0105246_10089660 | 3300011119 | Bacteria | 2213 |
| 125 | Ga0105246_11428189 | 3300011119 | Unclassified | 647 |
| 126 | Ga0157378_10001046 | 3300013297 | Bacteria | 25286 |
| 127 | Ga0157378_10005681 | 3300013297 | Bacteria | 10915 |
| 128 | Ga0157378_10014164 | 3300013297 | Bacteria | 6978 |
| 129 | Ga0163162_10005494 | 3300013306 | Bacteria | 12249 |
| 130 | Ga0163162_13304407 | 3300013306 | Unclassified | 516 |
| 131 | Ga0157372_11511223 | 3300013307 | Bacteria | 774 |
| 132 | Ga0157372_12186138 | 3300013307 | Bacteria | 636 |
| 133 | Ga0157375_10000008 | 3300013308 | Bacteria | 373560 |
| 134 | Ga0157375_10000146 | 3300013308 | Bacteria | 69095 |
| 135 | Ga0157375_10472250 | 3300013308 | Bacteria | 1419 |
| 136 | Ga0157375_10661580 | 3300013308 | Bacteria | 1200 |
| 137 | Ga0157380_10009829 | 3300014326 | Bacteria | 6867 |
| 138 | Ga0157380_12613440 | 3300014326 | Bacteria | 571 |
| 139 | Ga0157377_10000024 | 3300014745 | Bacteria | 142391 |
| 140 | Ga0157376_11900938 | 3300014969 | Bacteria | 632 |
| 141 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 142 | Ga0213873_10000556 | 3300021358 | Bacteria | 6049 |
| 143 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 144 | Ga0213876_10000080 | 3300021384 | Bacteria | 109125 |
| 145 | Ga0213876_10003504 | 3300021384 | Bacteria | 8963 |
| 146 | Ga0213876_10069514 | 3300021384 | Archaea | 1860 |
| 147 | Ga0213876_10253528 | 3300021384 | Unclassified | 935 |
| 148 | Ga0207699_10935038 | 3300025906 | Bacteria | 640 |
| 149 | Ga0207699_11138561 | 3300025906 | Bacteria | 578 |
| 150 | Ga0207645_10219452 | 3300025907 | Bacteria | 1253 |
| 151 | Ga0207643_10174600 | 3300025908 | Bacteria | 1298 |
| 152 | Ga0207705_10497869 | 3300025909 | Unclassified | 946 |
| 153 | Ga0207684_10087383 | 3300025910 | Unclassified | 2656 |
| 154 | Ga0207684_10172118 | 3300025910 | Bacteria | 1866 |
| 155 | Ga0207684_10590057 | 3300025910 | Bacteria | 949 |
| 156 | Ga0207695_10860603 | 3300025913 | Bacteria | 786 |
| 157 | Ga0207662_10003413 | 3300025918 | Bacteria | 8176 |
| 158 | Ga0207662_11069129 | 3300025918 | Bacteria | 573 |
| 159 | Ga0207646_10084154 | 3300025922 | Bacteria | 2846 |
| 160 | Ga0207646_10274574 | 3300025922 | Bacteria | 1523 |
| 161 | Ga0207646_10875771 | 3300025922 | Bacteria | 797 |
| 162 | Ga0207646_11215694 | 3300025922 | Bacteria | 660 |
| 163 | Ga0207650_10028914 | 3300025925 | Bacteria | 3979 |
| 164 | Ga0207659_10000007 | 3300025926 | Bacteria | 322984 |
| 165 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 166 | Ga0207687_10009953 | 3300025927 | Bacteria | 6224 |
| 167 | Ga0207687_10057844 | 3300025927 | Bacteria | 2725 |
| 168 | Ga0207687_10792219 | 3300025927 | Bacteria | 808 |
| 169 | Ga0207687_10832143 | 3300025927 | Bacteria | 788 |
| 170 | Ga0207700_10016716 | 3300025928 | Bacteria | 4883 |
| 171 | Ga0207686_10009690 | 3300025934 | Bacteria | 5233 |
| 172 | Ga0207670_10001884 | 3300025936 | Bacteria | 10953 |
| 173 | Ga0207670_10356634 | 3300025936 | Unclassified | 1159 |
| 174 | Ga0207670_11300047 | 3300025936 | Unclassified | 617 |
| 175 | Ga0207704_10046658 | 3300025938 | Unclassified | 2584 |
| 176 | Ga0207665_10296041 | 3300025939 | Bacteria | 1208 |
| 177 | Ga0207665_10860758 | 3300025939 | Bacteria | 718 |
| 178 | Ga0207691_10014932 | 3300025940 | Bacteria | 7399 |
| 179 | Ga0207689_10005570 | 3300025942 | Bacteria | 11244 |
| 180 | Ga0207689_10079606 | 3300025942 | Bacteria | 2693 |
| 181 | Ga0207689_10458975 | 3300025942 | Bacteria | 1065 |
| 182 | Ga0207661_10997582 | 3300025944 | Unclassified | 771 |
| 183 | Ga0207679_10191954 | 3300025945 | Bacteria | 1699 |
| 184 | Ga0207651_10256946 | 3300025960 | Bacteria | 1432 |
| 185 | Ga0207677_10000045 | 3300026023 | Bacteria | 106591 |
| 186 | Ga0207677_12315291 | 3300026023 | Bacteria | 500 |
| 187 | Ga0207703_10000104 | 3300026035 | Bacteria | 99914 |
| 188 | Ga0207639_10000003 | 3300026041 | Bacteria | 806887 |
| 189 | Ga0207708_10000052 | 3300026075 | Bacteria | 105169 |
| 190 | Ga0207648_11006189 | 3300026089 | Unclassified | 781 |
| 191 | Ga0207676_10000013 | 3300026095 | Bacteria | 343067 |
| 192 | Ga0207683_10321447 | 3300026121 | Bacteria | 1418 |
| 193 | Ga0207698_11163293 | 3300026142 | Unclassified | 785 |
| 194 | Ga0207428_10000003 | 3300027907 | Bacteria | 799783 |
| 195 | Ga0307511_10016183 | 3300030521 | Bacteria | 7199 |
| 196 | Ga0307408_100451424 | 3300031548 | Unclassified | 1115 |
| 197 | Ga0307412_12073047 | 3300031911 | Unclassified | 528 |
| 198 | Ga0307507_10662141 | 3300033179 | Unclassified | 528 |
| 199 | Ga0373940_0032340 | 3300035088 | Bacteria | 1402 |
| 200 | Ga0373940_0033660 | 3300035088 | Bacteria | 1379 |
| 201 | Ga0373932_0001312 | 3300035112 | Bacteria | 7007 |
| 202 | Ga0373957_0295211 | 3300035120 | Unclassified | 687 |
| 203 | Ga0373960_0426501 | 3300035121 | Bacteria | 516 |
| 204 | Ga0373943_0057135 | 3300035170 | Bacteria | 1938 |
| 205 | Ga0373947_0169220 | 3300035725 | Bacteria | 1417 |
| 206 | Ga0395901_1631028 | 3300038443 | Unclassified | 598 |
| 207 | Ga0436365_0304642 | 3300039437 | Unclassified | 2199 |
| 208 | Ga0436365_0404975 | 3300039437 | Bacteria | 180420 |
| 209 | Ga0436365_1065184 | 3300039437 | Bacteria | 16160 |
| 210 | Ga0436365_1070820 | 3300039437 | Unclassified | 637 |
| 211 | Ga0436365_1309399 | 3300039437 | Unclassified | 1004 |
| 212 | Ga0436365_1340026 | 3300039437 | Archaea | 1860 |
| 213 | Ga0436365_1645708 | 3300039437 | Bacteria | 58473 |
| 214 | Ga0436363_0359896 | 3300039450 | Bacteria | 847 |
| 215 | Ga0436363_1229360 | 3300039450 | Unclassified | 598 |
| 216 | Ga0436362_0407005 | 3300039453 | Bacteria | 15587 |
| 217 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 218 | Ga0451839_1291018 | 3300041496 | Bacteria | 2920 |
| 219 | Ga0453683_0044274 | 3300044673 | Bacteria | 2792 |
| 220 | Ga0453683_0572252 | 3300044673 | Unclassified | 736 |
| 221 | Ga0466964_0303680 | 3300044706 | Unclassified | 805 |
| 222 | Ga0495620_0001501 | 3300046515 | Bacteria | 13890 |
| 223 | Ga0495669_0442176 | 3300046684 | Unclassified | 631 |
| 224 | Ga0495679_018766 | 3300047446 | Bacteria | 2446 |
| 225 | Ga0496100_1475081 | 3300048903 | Unclassified | 537 |
| 226 | Ga0496104_1041649 | 3300048907 | Unclassified | 722 |
| 227 | Ga0501073_0000867 | 3300049589 | Bacteria | 21612 |
| 228 | Ga0501080_0044787 | 3300049742 | Bacteria | 4118 |
| 229 | nmdc:mga05p37_1487930_c1 | 3300050507 | Bacteria | 675 |
| 230 | nmdc:mga05p37_195884_c1 | 3300050507 | Bacteria | 2450 |
| 231 | nmdc:mga05p37_425195_c1 | 3300050507 | Bacteria | 1545 |
| 232 | nmdc:mga09592_337175_c1 | 3300050508 | Bacteria | 1305 |
| 233 | nmdc:mga06r32_18545_c1 | 3300050510 | Bacteria | 6373 |
| 234 | nmdc:mga08y16_4_c1 | 3300050511 | Bacteria | 916963 |
| 235 | nmdc:mga0n895_897128_c1 | 3300050512 | Bacteria | 872 |
| 236 | nmdc:mga0rr50_1151_c1 | 3300050513 | Bacteria | 14387 |
| 237 | nmdc:mga0rr50_286215_c1 | 3300050513 | Unclassified | 1376 |
| 238 | nmdc:mga0rr50_71453_c1 | 3300050513 | Bacteria | 2648 |
| 239 | nmdc:mga08x19_153321_c1 | 3300050514 | Unclassified | 1561 |
| 240 | nmdc:mga08x19_1942_c1 | 3300050514 | Bacteria | 12647 |
| 241 | nmdc:mga08x19_552036_c1 | 3300050514 | Unclassified | 815 |
| 242 | Ga0495655_0000031 | 3300053083 | Bacteria | 30487 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10806867 | Ga0105240_108068673 | 109 |
| 2 | 3300025913 | Ga0207695_10860603 | Ga0207695_108606032 | 109 |
| 3 | 3300005329 | Ga0070683_100958871 | Ga0070683_1009588712 | 113 |
| 4 | 3300005338 | Ga0068868_100000416 | Ga0068868_10000041616 | 113 |
| 5 | 3300005544 | Ga0070686_100343483 | Ga0070686_1003434831 | 113 |
| 6 | 3300013308 | Ga0157375_10661580 | Ga0157375_106615802 | 113 |
| 7 | 3300026023 | Ga0207677_10000045 | Ga0207677_1000004562 | 113 |
| 8 | 3300026023 | Ga0207677_12315291 | Ga0207677_123152912 | 113 |
| 9 | 3300021384 | Ga0213876_10253528 | Ga0213876_102535282 | 114 |
| 10 | 3300025936 | Ga0207670_10356634 | Ga0207670_103566342 | 114 |
| 11 | 3300039437 | Ga0436365_1309399 | Ga0436365_1309399_469_825 | 114 |
| 12 | 3300039450 | Ga0436363_0359896 | Ga0436363_0359896_483_830 | 114 |
| 13 | 3300005327 | Ga0070658_10344345 | Ga0070658_103443452 | 116 |
| 14 | 3300005466 | Ga0070685_10659291 | Ga0070685_106592912 | 116 |
| 15 | 3300005615 | Ga0070702_100257564 | Ga0070702_1002575641 | 116 |
| 16 | 3300006844 | Ga0075428_100851211 | Ga0075428_1008512112 | 116 |
| 17 | 3300025918 | Ga0207662_10003413 | Ga0207662_100034134 | 116 |
| 18 | 3300025918 | Ga0207662_11069129 | Ga0207662_110691292 | 116 |
| 19 | 3300031911 | Ga0307412_12073047 | Ga0307412_120730471 | 116 |
| 20 | 3300005295 | Ga0065707_10155408 | Ga0065707_101554082 | 117 |
| 21 | 3300005340 | Ga0070689_100567961 | Ga0070689_1005679612 | 117 |
| 22 | 3300005616 | Ga0068852_101259082 | Ga0068852_1012590822 | 117 |
| 23 | 3300006028 | Ga0070717_10533825 | Ga0070717_105338252 | 117 |
| 24 | 3300006358 | Ga0068871_101001290 | Ga0068871_1010012902 | 117 |
| 25 | 3300009093 | Ga0105240_10042858 | Ga0105240_100428585 | 117 |
| 26 | 3300009094 | Ga0111539_10000052 | Ga0111539_1000005227 | 117 |
| 27 | 3300013307 | Ga0157372_11511223 | Ga0157372_115112232 | 117 |
| 28 | 3300026041 | Ga0207639_10000003 | Ga0207639_100000035 | 117 |
| 29 | 3300026142 | Ga0207698_11163293 | Ga0207698_111632932 | 117 |
| 30 | 3300027907 | Ga0207428_10000003 | Ga0207428_1000000327 | 117 |
| 31 | 3300035088 | Ga0373940_0032340 | Ga0373940_0032340_54_413 | 117 |
| 32 | 3300039450 | Ga0436363_1229360 | Ga0436363_1229360_78_437 | 117 |
| 33 | 3300050511 | nmdc:mga08y16_4_c1 | nmdc:mga08y16_4_c1_889906_890262 | 117 |
| 34 | 3300005328 | Ga0070676_10210241 | Ga0070676_102102412 | 118 |
| 35 | 3300005334 | Ga0068869_100064307 | Ga0068869_1000643074 | 118 |
| 36 | 3300005334 | Ga0068869_100787705 | Ga0068869_1007877052 | 118 |
| 37 | 3300005338 | Ga0068868_100737212 | Ga0068868_1007372122 | 118 |
| 38 | 3300005340 | Ga0070689_100503721 | Ga0070689_1005037212 | 118 |
| 39 | 3300005340 | Ga0070689_101548917 | Ga0070689_1015489172 | 118 |
| 40 | 3300005341 | Ga0070691_10966993 | Ga0070691_109669931 | 118 |
| 41 | 3300005354 | Ga0070675_100000048 | Ga0070675_10000004835 | 118 |
| 42 | 3300005366 | Ga0070659_101477256 | Ga0070659_1014772561 | 118 |
| 43 | 3300005434 | Ga0070709_11211337 | Ga0070709_112113371 | 118 |
| 44 | 3300005436 | Ga0070713_100016418 | Ga0070713_1000164185 | 118 |
| 45 | 3300005438 | Ga0070701_10005175 | Ga0070701_100051755 | 118 |
| 46 | 3300005440 | Ga0070705_100711101 | Ga0070705_1007111012 | 118 |
| 47 | 3300005441 | Ga0070700_100000025 | Ga0070700_10000002585 | 118 |
| 48 | 3300005445 | Ga0070708_100028594 | Ga0070708_1000285941 | 118 |
| 49 | 3300005459 | Ga0068867_100595295 | Ga0068867_1005952952 | 118 |
| 50 | 3300005467 | Ga0070706_100224507 | Ga0070706_1002245073 | 118 |
| 51 | 3300005468 | Ga0070707_100115148 | Ga0070707_1001151482 | 118 |
| 52 | 3300005471 | Ga0070698_100020592 | Ga0070698_1000205921 | 118 |
| 53 | 3300005471 | Ga0070698_100484532 | Ga0070698_1004845321 | 118 |
| 54 | 3300005518 | Ga0070699_100188965 | Ga0070699_1001889652 | 118 |
| 55 | 3300005518 | Ga0070699_100318568 | Ga0070699_1003185682 | 118 |
| 56 | 3300005544 | Ga0070686_101156431 | Ga0070686_1011564311 | 118 |
| 57 | 3300005546 | Ga0070696_100214043 | Ga0070696_1002140432 | 118 |
| 58 | 3300005547 | Ga0070693_100013039 | Ga0070693_1000130394 | 118 |
| 59 | 3300005615 | Ga0070702_101629691 | Ga0070702_1016296911 | 118 |
| 60 | 3300005617 | Ga0068859_100279657 | Ga0068859_1002796572 | 118 |
| 61 | 3300005617 | Ga0068859_101800860 | Ga0068859_1018008602 | 118 |
| 62 | 3300005840 | Ga0068870_10069660 | Ga0068870_100696602 | 118 |
| 63 | 3300006028 | Ga0070717_10000082 | Ga0070717_1000008243 | 118 |
| 64 | 3300006847 | Ga0075431_100022242 | Ga0075431_1000222426 | 118 |
| 65 | 3300006852 | Ga0075433_11296174 | Ga0075433_112961742 | 118 |
| 66 | 3300006871 | Ga0075434_100673306 | Ga0075434_1006733062 | 118 |
| 67 | 3300006880 | Ga0075429_100325459 | Ga0075429_1003254592 | 118 |
| 68 | 3300006914 | Ga0075436_100012717 | Ga0075436_1000127175 | 118 |
| 69 | 3300006931 | Ga0097620_100279653 | Ga0097620_1002796532 | 118 |
| 70 | 3300006931 | Ga0097620_101800625 | Ga0097620_1018006252 | 118 |
| 71 | 3300007076 | Ga0075435_100015832 | Ga0075435_1000158325 | 118 |
| 72 | 3300007076 | Ga0075435_100082157 | Ga0075435_1000821573 | 118 |
| 73 | 3300009036 | Ga0105244_10016419 | Ga0105244_100164193 | 118 |
| 74 | 3300009147 | Ga0114129_10524877 | Ga0114129_105248773 | 118 |
| 75 | 3300009147 | Ga0114129_11676740 | Ga0114129_116767402 | 118 |
| 76 | 3300009147 | Ga0114129_12225169 | Ga0114129_122251691 | 118 |
| 77 | 3300009176 | Ga0105242_10002139 | Ga0105242_100021394 | 118 |
| 78 | 3300014326 | Ga0157380_12613440 | Ga0157380_126134402 | 118 |
| 79 | 3300014745 | Ga0157377_10000024 | Ga0157377_1000002485 | 118 |
| 80 | 3300014969 | Ga0157376_11900938 | Ga0157376_119009382 | 118 |
| 81 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002870 | 118 |
| 82 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001953 | 118 |
| 83 | 3300021384 | Ga0213876_10069514 | Ga0213876_100695142 | 118 |
| 84 | 3300025907 | Ga0207645_10219452 | Ga0207645_102194522 | 118 |
| 85 | 3300025908 | Ga0207643_10174600 | Ga0207643_101746002 | 118 |
| 86 | 3300025922 | Ga0207646_10875771 | Ga0207646_108757712 | 118 |
| 87 | 3300025926 | Ga0207659_10000007 | Ga0207659_10000007264 | 118 |
| 88 | 3300025928 | Ga0207700_10016716 | Ga0207700_100167164 | 118 |
| 89 | 3300025934 | Ga0207686_10009690 | Ga0207686_100096904 | 118 |
| 90 | 3300025936 | Ga0207670_11300047 | Ga0207670_113000472 | 118 |
| 91 | 3300025939 | Ga0207665_10860758 | Ga0207665_108607582 | 118 |
| 92 | 3300025942 | Ga0207689_10079606 | Ga0207689_100796063 | 118 |
| 93 | 3300026075 | Ga0207708_10000052 | Ga0207708_1000005263 | 118 |
| 94 | 3300026089 | Ga0207648_11006189 | Ga0207648_110061892 | 118 |
| 95 | 3300035088 | Ga0373940_0033660 | Ga0373940_0033660_1010_1369 | 118 |
| 96 | 3300035112 | Ga0373932_0001312 | Ga0373932_0001312_5828_6187 | 118 |
| 97 | 3300039437 | Ga0436365_0304642 | Ga0436365_0304642_786_1142 | 118 |
| 98 | 3300039437 | Ga0436365_0404975 | Ga0436365_0404975_140712_141068 | 118 |
| 99 | 3300039437 | Ga0436365_1340026 | Ga0436365_1340026_610_966 | 118 |
| 100 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_54049_54405 | 118 |
| 101 | 3300044673 | Ga0453683_0572252 | Ga0453683_0572252_214_573 | 118 |
| 102 | 3300046515 | Ga0495620_0001501 | Ga0495620_0001501_7601_7963 | 118 |
| 103 | 3300046684 | Ga0495669_0442176 | Ga0495669_0442176_124_483 | 118 |
| 104 | 3300049589 | Ga0501073_0000867 | Ga0501073_0000867_1769_2131 | 118 |
| 105 | 3300049742 | Ga0501080_0044787 | Ga0501080_0044787_1246_1608 | 118 |
| 106 | 3300050507 | nmdc:mga05p37_1487930_c1 | nmdc:mga05p37_1487930_c1_56_415 | 118 |
| 107 | 3300050507 | nmdc:mga05p37_195884_c1 | nmdc:mga05p37_195884_c1_1022_1384 | 118 |
| 108 | 3300050508 | nmdc:mga09592_337175_c1 | nmdc:mga09592_337175_c1_528_890 | 118 |
| 109 | 3300050510 | nmdc:mga06r32_18545_c1 | nmdc:mga06r32_18545_c1_5311_5673 | 118 |
| 110 | 3300050512 | nmdc:mga0n895_897128_c1 | nmdc:mga0n895_897128_c1_473_832 | 118 |
| 111 | 3300050513 | nmdc:mga0rr50_1151_c1 | nmdc:mga0rr50_1151_c1_2480_2839 | 118 |
| 112 | 3300050513 | nmdc:mga0rr50_71453_c1 | nmdc:mga0rr50_71453_c1_1955_2314 | 118 |
| 113 | 3300050514 | nmdc:mga08x19_1942_c1 | nmdc:mga08x19_1942_c1_9038_9397 | 118 |
| 114 | 3300050514 | nmdc:mga08x19_552036_c1 | nmdc:mga08x19_552036_c1_441_800 | 118 |
| 115 | 3300053083 | Ga0495655_0000031 | Ga0495655_0000031_19198_19557 | 118 |
| 116 | 3300002155 | JGI24033J26618_1013283 | JGI24033J26618_10132832 | 119 |
| 117 | 3300005437 | Ga0070710_10737545 | Ga0070710_107375452 | 119 |
| 118 | 3300005445 | Ga0070708_100278515 | Ga0070708_1002785152 | 119 |
| 119 | 3300005468 | Ga0070707_100100745 | Ga0070707_1001007452 | 119 |
| 120 | 3300005468 | Ga0070707_101203954 | Ga0070707_1012039542 | 119 |
| 121 | 3300005468 | Ga0070707_101998434 | Ga0070707_1019984341 | 119 |
| 122 | 3300005471 | Ga0070698_100414770 | Ga0070698_1004147701 | 119 |
| 123 | 3300005518 | Ga0070699_100991745 | Ga0070699_1009917451 | 119 |
| 124 | 3300005549 | Ga0070704_101008720 | Ga0070704_1010087202 | 119 |
| 125 | 3300005840 | Ga0068870_10200301 | Ga0068870_102003012 | 119 |
| 126 | 3300006844 | Ga0075428_100029115 | Ga0075428_1000291157 | 119 |
| 127 | 3300006847 | Ga0075431_100465655 | Ga0075431_1004656552 | 119 |
| 128 | 3300006914 | Ga0075436_100455450 | Ga0075436_1004554502 | 119 |
| 129 | 3300021384 | Ga0213876_10003504 | Ga0213876_100035048 | 119 |
| 130 | 3300025922 | Ga0207646_10084154 | Ga0207646_100841544 | 119 |
| 131 | 3300026121 | Ga0207683_10321447 | Ga0207683_103214472 | 119 |
| 132 | 3300030521 | Ga0307511_10016183 | Ga0307511_100161838 | 119 |
| 133 | 3300035170 | Ga0373943_0057135 | Ga0373943_0057135_1187_1549 | 119 |
| 134 | 3300039437 | Ga0436365_1065184 | Ga0436365_1065184_7397_7759 | 119 |
| 135 | 3300039437 | Ga0436365_1070820 | Ga0436365_1070820_205_567 | 119 |
| 136 | 3300044706 | Ga0466964_0303680 | Ga0466964_0303680_29_394 | 119 |
| 137 | 3300048903 | Ga0496100_1475081 | Ga0496100_1475081_57_422 | 119 |
| 138 | 3300048907 | Ga0496104_1041649 | Ga0496104_1041649_32_394 | 119 |
| 139 | 3300050514 | nmdc:mga08x19_153321_c1 | nmdc:mga08x19_153321_c1_253_615 | 119 |
| 140 | 3300001991 | JGI24743J22301_10048954 | JGI24743J22301_100489542 | 120 |
| 141 | 3300005327 | Ga0070658_10574412 | Ga0070658_105744122 | 120 |
| 142 | 3300005331 | Ga0070670_100108777 | Ga0070670_1001087772 | 120 |
| 143 | 3300005333 | Ga0070677_10315227 | Ga0070677_103152272 | 120 |
| 144 | 3300005334 | Ga0068869_100008355 | Ga0068869_1000083554 | 120 |
| 145 | 3300005334 | Ga0068869_100849671 | Ga0068869_1008496712 | 120 |
| 146 | 3300005336 | Ga0070680_100966771 | Ga0070680_1009667712 | 120 |
| 147 | 3300005337 | Ga0070682_100000001 | Ga0070682_100000001470 | 120 |
| 148 | 3300005337 | Ga0070682_100399419 | Ga0070682_1003994192 | 120 |
| 149 | 3300005340 | Ga0070689_100001226 | Ga0070689_10000122614 | 120 |
| 150 | 3300005341 | Ga0070691_10830011 | Ga0070691_108300112 | 120 |
| 151 | 3300005345 | Ga0070692_10003292 | Ga0070692_100032924 | 120 |
| 152 | 3300005364 | Ga0070673_100382385 | Ga0070673_1003823852 | 120 |
| 153 | 3300005436 | Ga0070713_100624456 | Ga0070713_1006244561 | 120 |
| 154 | 3300005436 | Ga0070713_100761092 | Ga0070713_1007610921 | 120 |
| 155 | 3300005445 | Ga0070708_100001348 | Ga0070708_10000134816 | 120 |
| 156 | 3300005445 | Ga0070708_101707724 | Ga0070708_1017077241 | 120 |
| 157 | 3300005467 | Ga0070706_100112870 | Ga0070706_1001128703 | 120 |
| 158 | 3300005467 | Ga0070706_100432619 | Ga0070706_1004326191 | 120 |
| 159 | 3300005467 | Ga0070706_100683014 | Ga0070706_1006830142 | 120 |
| 160 | 3300005467 | Ga0070706_101178821 | Ga0070706_1011788212 | 120 |
| 161 | 3300005468 | Ga0070707_100081044 | Ga0070707_1000810441 | 120 |
| 162 | 3300005468 | Ga0070707_100911193 | Ga0070707_1009111932 | 120 |
| 163 | 3300005468 | Ga0070707_101285212 | Ga0070707_1012852121 | 120 |
| 164 | 3300005518 | Ga0070699_100004672 | Ga0070699_10000467213 | 120 |
| 165 | 3300005518 | Ga0070699_100078137 | Ga0070699_1000781373 | 120 |
| 166 | 3300005535 | Ga0070684_100072728 | Ga0070684_1000727282 | 120 |
| 167 | 3300005536 | Ga0070697_100212321 | Ga0070697_1002123212 | 120 |
| 168 | 3300005536 | Ga0070697_100386276 | Ga0070697_1003862762 | 120 |
| 169 | 3300005543 | Ga0070672_100007730 | Ga0070672_1000077301 | 120 |
| 170 | 3300005543 | Ga0070672_100254662 | Ga0070672_1002546622 | 120 |
| 171 | 3300005544 | Ga0070686_100644896 | Ga0070686_1006448962 | 120 |
| 172 | 3300005547 | Ga0070693_100796321 | Ga0070693_1007963211 | 120 |
| 173 | 3300005564 | Ga0070664_100272090 | Ga0070664_1002720902 | 120 |
| 174 | 3300005615 | Ga0070702_100093075 | Ga0070702_1000930754 | 120 |
| 175 | 3300005618 | Ga0068864_100000091 | Ga0068864_10000009126 | 120 |
| 176 | 3300005842 | Ga0068858_100000306 | Ga0068858_10000030646 | 120 |
| 177 | 3300005842 | Ga0068858_100331692 | Ga0068858_1003316922 | 120 |
| 178 | 3300006237 | Ga0097621_100503251 | Ga0097621_1005032512 | 120 |
| 179 | 3300006358 | Ga0068871_101793885 | Ga0068871_1017938852 | 120 |
| 180 | 3300006846 | Ga0075430_101121242 | Ga0075430_1011212422 | 120 |
| 181 | 3300006871 | Ga0075434_102056605 | Ga0075434_1020566052 | 120 |
| 182 | 3300006881 | Ga0068865_100026648 | Ga0068865_1000266486 | 120 |
| 183 | 3300007076 | Ga0075435_100698891 | Ga0075435_1006988912 | 120 |
| 184 | 3300009098 | Ga0105245_10000226 | Ga0105245_1000022628 | 120 |
| 185 | 3300009098 | Ga0105245_10000463 | Ga0105245_1000046325 | 120 |
| 186 | 3300009098 | Ga0105245_10037994 | Ga0105245_100379947 | 120 |
| 187 | 3300009098 | Ga0105245_10977967 | Ga0105245_109779672 | 120 |
| 188 | 3300009098 | Ga0105245_11381623 | Ga0105245_113816232 | 120 |
| 189 | 3300009174 | Ga0105241_11032762 | Ga0105241_110327621 | 120 |
| 190 | 3300010375 | Ga0105239_10091187 | Ga0105239_100911873 | 120 |
| 191 | 3300011119 | Ga0105246_10089660 | Ga0105246_100896603 | 120 |
| 192 | 3300011119 | Ga0105246_11428189 | Ga0105246_114281892 | 120 |
| 193 | 3300013297 | Ga0157378_10001046 | Ga0157378_100010467 | 120 |
| 194 | 3300013297 | Ga0157378_10005681 | Ga0157378_100056817 | 120 |
| 195 | 3300013297 | Ga0157378_10014164 | Ga0157378_100141642 | 120 |
| 196 | 3300013306 | Ga0163162_10005494 | Ga0163162_1000549410 | 120 |
| 197 | 3300013306 | Ga0163162_13304407 | Ga0163162_133044071 | 120 |
| 198 | 3300013307 | Ga0157372_12186138 | Ga0157372_121861381 | 120 |
| 199 | 3300013308 | Ga0157375_10000008 | Ga0157375_10000008242 | 120 |
| 200 | 3300013308 | Ga0157375_10000146 | Ga0157375_1000014625 | 120 |
| 201 | 3300013308 | Ga0157375_10472250 | Ga0157375_104722502 | 120 |
| 202 | 3300014326 | Ga0157380_10009829 | Ga0157380_100098298 | 120 |
| 203 | 3300021358 | Ga0213873_10000556 | Ga0213873_100005565 | 120 |
| 204 | 3300021384 | Ga0213876_10000080 | Ga0213876_1000008074 | 120 |
| 205 | 3300025906 | Ga0207699_10935038 | Ga0207699_109350382 | 120 |
| 206 | 3300025906 | Ga0207699_11138561 | Ga0207699_111385612 | 120 |
| 207 | 3300025909 | Ga0207705_10497869 | Ga0207705_104978692 | 120 |
| 208 | 3300025910 | Ga0207684_10087383 | Ga0207684_100873834 | 120 |
| 209 | 3300025910 | Ga0207684_10172118 | Ga0207684_101721183 | 120 |
| 210 | 3300025910 | Ga0207684_10590057 | Ga0207684_105900572 | 120 |
| 211 | 3300025922 | Ga0207646_10274574 | Ga0207646_102745742 | 120 |
| 212 | 3300025922 | Ga0207646_11215694 | Ga0207646_112156942 | 120 |
| 213 | 3300025925 | Ga0207650_10028914 | Ga0207650_100289145 | 120 |
| 214 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003195 | 120 |
| 215 | 3300025927 | Ga0207687_10009953 | Ga0207687_100099537 | 120 |
| 216 | 3300025927 | Ga0207687_10057844 | Ga0207687_100578442 | 120 |
| 217 | 3300025927 | Ga0207687_10792219 | Ga0207687_107922192 | 120 |
| 218 | 3300025927 | Ga0207687_10832143 | Ga0207687_108321432 | 120 |
| 219 | 3300025936 | Ga0207670_10001884 | Ga0207670_100018849 | 120 |
| 220 | 3300025938 | Ga0207704_10046658 | Ga0207704_100466583 | 120 |
| 221 | 3300025939 | Ga0207665_10296041 | Ga0207665_102960412 | 120 |
| 222 | 3300025940 | Ga0207691_10014932 | Ga0207691_100149321 | 120 |
| 223 | 3300025942 | Ga0207689_10005570 | Ga0207689_100055704 | 120 |
| 224 | 3300025942 | Ga0207689_10458975 | Ga0207689_104589752 | 120 |
| 225 | 3300025944 | Ga0207661_10997582 | Ga0207661_109975822 | 120 |
| 226 | 3300025945 | Ga0207679_10191954 | Ga0207679_101919542 | 120 |
| 227 | 3300025960 | Ga0207651_10256946 | Ga0207651_102569462 | 120 |
| 228 | 3300026035 | Ga0207703_10000104 | Ga0207703_1000010437 | 120 |
| 229 | 3300026095 | Ga0207676_10000013 | Ga0207676_10000013175 | 120 |
| 230 | 3300031548 | Ga0307408_100451424 | Ga0307408_1004514242 | 120 |
| 231 | 3300033179 | Ga0307507_10662141 | Ga0307507_106621411 | 120 |
| 232 | 3300035120 | Ga0373957_0295211 | Ga0373957_0295211_235_600 | 120 |
| 233 | 3300035121 | Ga0373960_0426501 | Ga0373960_0426501_65_427 | 120 |
| 234 | 3300035725 | Ga0373947_0169220 | Ga0373947_0169220_769_1134 | 120 |
| 235 | 3300038443 | Ga0395901_1631028 | Ga0395901_1631028_214_576 | 120 |
| 236 | 3300039437 | Ga0436365_1645708 | Ga0436365_1645708_11801_12166 | 120 |
| 237 | 3300039453 | Ga0436362_0407005 | Ga0436362_0407005_2939_3304 | 120 |
| 238 | 3300041496 | Ga0451839_1291018 | Ga0451839_1291018_2371_2733 | 120 |
| 239 | 3300044673 | Ga0453683_0044274 | Ga0453683_0044274_382_747 | 120 |
| 240 | 3300047446 | Ga0495679_018766 | Ga0495679_018766_89_451 | 120 |
| 241 | 3300050507 | nmdc:mga05p37_425195_c1 | nmdc:mga05p37_425195_c1_917_1282 | 120 |
| 242 | 3300050513 | nmdc:mga0rr50_286215_c1 | nmdc:mga0rr50_286215_c1_268_633 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5szd-assembly1.cif.gz_A | crystal structure of aquifex aeolicus hfq at 1.5a | 0.8391 | 67 | 120 |
| 3fif-assembly6.cif.gz_F | crystal structure of the ygdr protein from e.coli. northeast structural genomics target er382a. | 0.8368 | 5 | 58 |
| 6gwk-assembly4.cif.gz_W | the crystal structure of hfq from caulobacter crescentus | 0.8339 | 3 | 56 |
| 8bvh-assembly1.cif.gz_C | cryo-em structure of the hfq-crc-amie translation repression assembly. | 0.8313 | 4 | 57 |
| 6gwk-assembly4.cif.gz_T | the crystal structure of hfq from caulobacter crescentus | 0.8226 | 67 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qsuF00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8684 | 4 | 51 | 2.30.30.100 |
| 6gwkT00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8226 | 67 | 120 | 2.30.30.100 |
| 3hfoB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8225 | 4 | 56 | 2.30.30.100 |
| af_P9WH17_92_157_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.8195 | 66 | 120 | 2.30.30.100 |
| 3hfnB00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8056 | 66 | 118 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7YEH2-F1-model_v4 | Uncharacterized protein | 0.9573 | 1 | 120 |
|
| AF-A0A661NHW6-F1-model_v4 | Uncharacterized protein | 0.9281 | 5 | 118 |
|
| AF-A0A0D6QDM3-F1-model_v4 | IgA FC receptor | 0.9119 | 5 | 118 |
|
| AF-A0A7X9DVG4-F1-model_v4 | Uncharacterized protein | 0.9046 | 1 | 120 |
|
| AF-Q2IM12-F1-model_v4 | CheA signal transduction histidine kinase | 0.9045 | 5 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar