F354471

General Info

Members Datasets Scaffolds Average Seq Length
242 173 484 213

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100013658|Ga0070679_1000136587
Length 229
Sequence LRHGNTLDRGLGIPRAGAYVPGGANTLADLGMREPTRTYRIAMAVNLPVARWARLEVSGVETLPASGPLLVVGNHDSHWDPVMIGFAARKRRMIRALAKSQLWDVKALAPVLDGMGQIAQALANAIEALREGSCVGVFPEGTRSRGKVMRARSGVGRLALEVPEAHVSCVAVTGTTDLTGFPRRPRIAVRFFDPAGGQPRPDEEPAELSARLLSEIRAMAPPAISYRKR

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 11.57
Rhizosphere 85.12
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100013658 3300005530 Bacteria 7778
2 JGI25404J52841_10014476 3300003659 Unclassified 1712
3 Ga0070666_10103759 3300005335 Bacteria 1962
4 Ga0070682_100000080 3300005337 Bacteria 85683
5 Ga0070691_10000054 3300005341 Bacteria 32149
6 Ga0070661_100000005 3300005344 Bacteria 220455
7 Ga0070668_100008119 3300005347 Bacteria 7797
8 Ga0070675_100000058 3300005354 Bacteria 66874
9 Ga0070688_100005500 3300005365 Bacteria 6680
10 Ga0070659_100021011 3300005366 Bacteria 4965
11 Ga0070667_100005021 3300005367 Bacteria 11075
12 Ga0070667_100007958 3300005367 Bacteria 8790
13 Ga0070667_100697154 3300005367 Unclassified 939
14 Ga0070713_100000138 3300005436 Bacteria 48026
15 Ga0070713_100523915 3300005436 Bacteria 1120
16 Ga0070710_10311787 3300005437 Bacteria 1030
17 Ga0070663_100077594 3300005455 Bacteria 2432
18 Ga0070678_100004162 3300005456 Bacteria 8159
19 Ga0070685_10000293 3300005466 Bacteria 31562
20 Ga0068853_100065416 3300005539 Bacteria 3155
21 Ga0070672_100000004 3300005543 Bacteria 129970
22 Ga0070695_100118761 3300005545 Bacteria 1806
23 Ga0070665_100020304 3300005548 Bacteria 6671
24 Ga0070665_100083435 3300005548 Bacteria 3200
25 Ga0070665_100167424 3300005548 Bacteria 2200
26 Ga0070665_100493859 3300005548 Bacteria 1235
27 Ga0070665_101061437 3300005548 Bacteria 822
28 Ga0070704_100142683 3300005549 Bacteria 1872
29 Ga0070664_100121855 3300005564 Bacteria 2284
30 Ga0070664_100270347 3300005564 Unclassified 1531
31 Ga0068857_100706324 3300005577 Bacteria 958
32 Ga0068854_100001335 3300005578 Bacteria 14874
33 Ga0068856_100023907 3300005614 Bacteria 5944
34 Ga0068856_100056161 3300005614 Bacteria 3885
35 Ga0070702_100005915 3300005615 Bacteria 5744
36 Ga0068852_100033460 3300005616 Bacteria 4268
37 Ga0068866_10016171 3300005718 Bacteria 3330
38 Ga0068861_100041642 3300005719 Bacteria 3441
39 Ga0068851_10004367 3300005834 Bacteria 6365
40 Ga0068863_100019752 3300005841 Bacteria 6444
41 Ga0068863_100079552 3300005841 Bacteria 3104
42 Ga0068860_100044947 3300005843 Bacteria 4209
43 Ga0068862_100002825 3300005844 Bacteria 15226
44 Ga0081455_10009498 3300005937 Bacteria 9996
45 Ga0081455_10121728 3300005937 Bacteria 2055
46 Ga0081540_1000006 3300005983 Bacteria 208724
47 Ga0081539_10002242 3300005985 Bacteria 28126
48 Ga0070715_10172238 3300006163 Unclassified 1079
49 Ga0097621_100110806 3300006237 Bacteria 2319
50 Ga0068871_100191002 3300006358 Bacteria 1764
51 Ga0075430_100165615 3300006846 Bacteria 1839
52 Ga0075434_100761294 3300006871 Unclassified 985
53 Ga0068865_100000101 3300006881 Bacteria 44302
54 Ga0105245_10000056 3300009098 Bacteria 124109
55 Ga0105245_10003691 3300009098 Bacteria 13667
56 Ga0105247_10000202 3300009101 Bacteria 58345
57 Ga0105241_10176475 3300009174 Bacteria 1769
58 Ga0105242_10000357 3300009176 Bacteria 36537
59 Ga0105242_10000530 3300009176 Bacteria 30053
60 Ga0105248_10000032 3300009177 Bacteria 201114
61 Ga0105249_10650250 3300009553 Unclassified 1112
62 Ga0105239_10210774 3300010375 Bacteria 2178
63 Ga0105239_10224733 3300010375 Bacteria 2106
64 Ga0157371_10003156 3300013102 Bacteria 15182
65 Ga0157370_10007615 3300013104 Bacteria 11762
66 Ga0157369_10000099 3300013105 Bacteria 120032
67 Ga0157369_10183837 3300013105 Bacteria 2198
68 Ga0157378_10047697 3300013297 Bacteria 3809
69 Ga0157372_10026370 3300013307 Bacteria 6324
70 Ga0157375_10032670 3300013308 Bacteria 4937
71 Ga0163163_10157492 3300014325 Bacteria 2316
72 Ga0157380_10000219 3300014326 Bacteria 34156
73 Ga0157379_10031540 3300014968 Bacteria 4722
74 Ga0157376_10096829 3300014969 Bacteria 2569
75 Ga0163161_10087001 3300017792 Bacteria 2307
76 Ga0206356_11503659 3300020070 Bacteria 1847
77 Ga0207656_10002305 3300025321 Bacteria 6410
78 Ga0207642_10004062 3300025899 Bacteria 4687
79 Ga0207710_10000369 3300025900 Bacteria 31539
80 Ga0207680_10004342 3300025903 Bacteria 6717
81 Ga0207680_10015503 3300025903 Bacteria 3978
82 Ga0207680_10021602 3300025903 Bacteria 3485
83 Ga0207654_10140252 3300025911 Bacteria 1540
84 Ga0207671_10306938 3300025914 Unclassified 1254
85 Ga0207663_10066421 3300025916 Bacteria 2309
86 Ga0207649_10000005 3300025920 Bacteria 356179
87 Ga0207652_10048740 3300025921 Bacteria 3623
88 Ga0207650_10025386 3300025925 Bacteria 4221
89 Ga0207659_10000020 3300025926 Bacteria 151552
90 Ga0207687_10035866 3300025927 Bacteria 3376
91 Ga0207700_10000008 3300025928 Bacteria 341717
92 Ga0207700_10000016 3300025928 Bacteria 202434
93 Ga0207690_10008415 3300025932 Bacteria 6126
94 Ga0207686_10000032 3300025934 Bacteria 150341
95 Ga0207686_10000438 3300025934 Bacteria 27955
96 Ga0207704_10000025 3300025938 Bacteria 135523
97 Ga0207691_10000020 3300025940 Bacteria 133465
98 Ga0207711_10000020 3300025941 Bacteria 363325
99 Ga0207661_10420482 3300025944 Bacteria 1214
100 Ga0207679_10045085 3300025945 Bacteria 3187
101 Ga0207712_10080200 3300025961 Unclassified 2373
102 Ga0207668_10013116 3300025972 Bacteria 5093
103 Ga0207640_10000285 3300025981 Bacteria 33957
104 Ga0207658_10006057 3300025986 Bacteria 8259
105 Ga0207658_10025762 3300025986 Bacteria 4118
106 Ga0207703_10077133 3300026035 Bacteria 2766
107 Ga0207639_10292836 3300026041 Bacteria 1436
108 Ga0207678_10016115 3300026067 Bacteria 6563
109 Ga0207708_10365317 3300026075 Bacteria 1187
110 Ga0207702_10000016 3300026078 Bacteria 226633
111 Ga0207702_10003815 3300026078 Bacteria 13603
112 Ga0207641_10008529 3300026088 Bacteria 8466
113 Ga0207641_10014496 3300026088 Bacteria 6459
114 Ga0207641_10335970 3300026088 Bacteria 1436
115 Ga0207674_10184896 3300026116 Bacteria 2035
116 Ga0207683_10006404 3300026121 Bacteria 10083
117 Ga0207698_10024058 3300026142 Bacteria 4268
118 Ga0268266_10000216 3300028379 Bacteria 100792
119 Ga0268266_10000553 3300028379 Bacteria 52199
120 Ga0268266_10092441 3300028379 Bacteria 2654
121 Ga0268265_10011815 3300028380 Bacteria 5903
122 Ga0265334_10160950 3300028573 Bacteria 789
123 Ga0307415_100001131 3300032126 Bacteria 12469
124 Ga0451807_1261771 3300041486 Unclassified 1052
125 Ga0451849_0060202 3300041505 Bacteria 1332
126 Ga0451853_0093663 3300041512 Unclassified 870
127 Ga0466963_0043513 3300044694 Bacteria 2953
128 Ga0466957_0003681 3300044842 Bacteria 8460
129 Ga0466957_0494524 3300044842 Bacteria 847
130 Ga0466967_0000046 3300045976 Bacteria 43911
131 Ga0466967_0076226 3300045976 Bacteria 3016
132 Ga0495592_0034411 3300046454 Bacteria 3819
133 Ga0495629_0005520 3300046459 Bacteria 9437
134 Ga0495629_0032469 3300046459 Bacteria 3696
135 Ga0495638_0076143 3300046460 Bacteria 2044
136 Ga0495653_0071930 3300046463 Bacteria 2584
137 Ga0495653_0202904 3300046463 Bacteria 1345
138 Ga0495662_0024365 3300046476 Bacteria 2920
139 Ga0495594_0000013 3300046499 Bacteria 103201
140 Ga0495608_0000031 3300046511 Bacteria 145255
141 Ga0495620_0032869 3300046515 Bacteria 2360
142 Ga0495628_0000323 3300046516 Bacteria 43212
143 Ga0495628_0224099 3300046516 Bacteria 1411
144 Ga0495628_0344809 3300046516 Bacteria 1096
145 Ga0495630_0000062 3300046517 Bacteria 86140
146 Ga0495630_0035038 3300046517 Bacteria 3751
147 Ga0495630_0363563 3300046517 Bacteria 1108
148 Ga0495652_0000003 3300046529 Bacteria 597094
149 Ga0495652_0149863 3300046529 Bacteria 1824
150 Ga0495640_0041629 3300046533 Bacteria 3209
151 Ga0495587_0001970 3300046536 Bacteria 13697
152 Ga0495587_0038396 3300046536 Bacteria 2871
153 Ga0495645_0008797 3300046543 Bacteria 7051
154 Ga0495645_0264198 3300046543 Unclassified 1138
155 Ga0495645_0441529 3300046543 Bacteria 822
156 Ga0495622_0000014 3300046557 Bacteria 182142
157 Ga0495634_0008958 3300046642 Bacteria 7410
158 Ga0495634_0031511 3300046642 Bacteria 3652
159 Ga0495625_0000029 3300046660 Bacteria 244646
160 Ga0495635_0032104 3300046663 Bacteria 3644
161 Ga0495657_0000024 3300046675 Bacteria 145255
162 Ga0495657_0034502 3300046675 Bacteria 3514
163 Ga0495658_0005510 3300046683 Bacteria 6224
164 Ga0495613_0000309 3300046689 Bacteria 44163
165 Ga0495624_0132167 3300046690 Bacteria 1530
166 Ga0495600_0003314 3300046809 Bacteria 9451
167 Ga0495604_0003466 3300047317 Bacteria 12570
168 Ga0495604_0006459 3300047317 Bacteria 9300
169 Ga0495604_0283983 3300047317 Bacteria 1117
170 Ga0495674_0000042 3300047319 Bacteria 94820
171 Ga0495672_0099538 3300047320 Bacteria 1580
172 Ga0495676_0008140 3300047321 Bacteria 9616
173 Ga0495676_0357216 3300047321 Bacteria 976
174 Ga0495680_0165199 3300047322 Bacteria 1605
175 Ga0495680_0276856 3300047322 Bacteria 1183
176 Ga0495675_0000209 3300047444 Bacteria 42691
177 Ga0495675_0008166 3300047444 Bacteria 6479
178 Ga0495686_0064023 3300047472 Unclassified 2277
179 Ga0495593_0024075 3300047673 Bacteria 3378
180 Ga0495602_0000228 3300048088 Bacteria 52649
181 Ga0495602_0007339 3300048088 Bacteria 11540
182 Ga0496100_0000038 3300048903 Bacteria 94110
183 Ga0496101_0000010 3300048904 Bacteria 281990
184 Ga0496102_0000584 3300048905 Bacteria 38605
185 Ga0496102_0023784 3300048905 Bacteria 5444
186 Ga0496103_0000043 3300048906 Bacteria 167983
187 Ga0496104_0000002 3300048907 Bacteria 686017
188 Ga0496104_0000576 3300048907 Bacteria 31360
189 Ga0496104_0285779 3300048907 Bacteria 1562
190 Ga0496105_0000001 3300048908 Bacteria 1328178
191 Ga0496105_0009052 3300048908 Bacteria 7768
192 Ga0496106_0000018 3300048909 Bacteria 175028
193 Ga0496107_0000032 3300048910 Bacteria 99848
194 Ga0496108_0000045 3300048911 Bacteria 137416
195 Ga0496108_0063752 3300048911 Bacteria 3104
196 Ga0496109_0000032 3300048912 Bacteria 162984
197 Ga0496109_0004023 3300048912 Bacteria 12277
198 Ga0496109_0073771 3300048912 Bacteria 3136
199 Ga0496110_0000033 3300048913 Bacteria 65539
200 Ga0496110_0024862 3300048913 Bacteria 5111
201 Ga0496111_0000125 3300048914 Bacteria 33642
202 Ga0496111_0160376 3300048914 Unclassified 1669
203 Ga0496112_0017217 3300048915 Bacteria 6785
204 Ga0496113_0000007 3300048916 Bacteria 95884
205 Ga0496113_0086030 3300048916 Bacteria 2415
206 Ga0496113_0759934 3300048916 Bacteria 771
207 Ga0496114_0000014 3300048917 Bacteria 297902
208 Ga0496115_0000255 3300048918 Bacteria 47200
209 Ga0496118_0253691 3300048921 Bacteria 998
210 Ga0496124_0327901 3300048927 Bacteria 1093
211 Ga0496126_0070574 3300048929 Bacteria 3112
212 Ga0501032_0263581 3300049569 Unclassified 1117
213 Ga0501042_0012726 3300049578 Bacteria 5709
214 Ga0501042_0082734 3300049578 Bacteria 2301
215 Ga0501047_0119094 3300049581 Bacteria 2522
216 Ga0501068_0087271 3300049584 Bacteria 1921
217 Ga0501070_0017711 3300049586 Bacteria 5981
218 Ga0501070_0017845 3300049586 Bacteria 5959
219 Ga0501070_0283791 3300049586 Unclassified 1350
220 Ga0501071_0403759 3300049587 Unclassified 1043
221 Ga0501074_0278797 3300049590 Unclassified 1188
222 Ga0501076_0011312 3300049592 Bacteria 6642
223 Ga0501080_0463143 3300049742 Unclassified 1135
224 Ga0501044_0028510 3300049823 Bacteria 5893
225 Ga0495601_0000072 3300053077 Bacteria 56009
226 Ga0495601_0000097 3300053077 Bacteria 48380
227 Ga0495601_0000972 3300053077 Bacteria 15644
228 Ga0495601_0016152 3300053077 Bacteria 4521
229 Ga0495601_0030309 3300053077 Bacteria 3358
230 Ga0495612_0000767 3300053078 Bacteria 13097
231 Ga0495655_0000011 3300053083 Bacteria 118490
232 Ga0495655_0001739 3300053083 Bacteria 3377
233 Ga0495595_0000014 3300053084 Bacteria 145255
234 Ga0495595_0027010 3300053084 Bacteria 2554
235 Ga0495619_0000022 3300053085 Bacteria 184144
236 Ga0495619_0000121 3300053085 Bacteria 57613
237 Ga0495619_0000319 3300053085 Bacteria 33678
238 Ga0495619_0002591 3300053085 Bacteria 11817
239 Ga0495619_0169264 3300053085 Unclassified 1510
240 Ga0500566_0005120 3300053094 Bacteria 7815
241 Ga0500641_0002398 3300053096 Bacteria 6646
242 Ga0500628_000058 3300053129 Bacteria 32870
243 Ga0070679_100013658
244 JGI25404J52841_10014476
245 Ga0070666_10103759
246 Ga0070682_100000080
247 Ga0070691_10000054
248 Ga0070661_100000005
249 Ga0070668_100008119
250 Ga0070675_100000058
251 Ga0070688_100005500
252 Ga0070659_100021011
253 Ga0070667_100005021
254 Ga0070667_100007958
255 Ga0070667_100697154
256 Ga0070713_100000138
257 Ga0070713_100523915
258 Ga0070710_10311787
259 Ga0070663_100077594
260 Ga0070678_100004162
261 Ga0070685_10000293
262 Ga0068853_100065416
263 Ga0070672_100000004
264 Ga0070695_100118761
265 Ga0070665_100020304
266 Ga0070665_100083435
267 Ga0070665_100167424
268 Ga0070665_100493859
269 Ga0070665_101061437
270 Ga0070704_100142683
271 Ga0070664_100121855
272 Ga0070664_100270347
273 Ga0068857_100706324
274 Ga0068854_100001335
275 Ga0068856_100023907
276 Ga0068856_100056161
277 Ga0070702_100005915
278 Ga0068852_100033460
279 Ga0068866_10016171
280 Ga0068861_100041642
281 Ga0068851_10004367
282 Ga0068863_100019752
283 Ga0068863_100079552
284 Ga0068860_100044947
285 Ga0068862_100002825
286 Ga0081455_10009498
287 Ga0081455_10121728
288 Ga0081540_1000006
289 Ga0081539_10002242
290 Ga0070715_10172238
291 Ga0097621_100110806
292 Ga0068871_100191002
293 Ga0075430_100165615
294 Ga0075434_100761294
295 Ga0068865_100000101
296 Ga0105245_10000056
297 Ga0105245_10003691
298 Ga0105247_10000202
299 Ga0105241_10176475
300 Ga0105242_10000357
301 Ga0105242_10000530
302 Ga0105248_10000032
303 Ga0105249_10650250
304 Ga0105239_10210774
305 Ga0105239_10224733
306 Ga0157371_10003156
307 Ga0157370_10007615
308 Ga0157369_10000099
309 Ga0157369_10183837
310 Ga0157378_10047697
311 Ga0157372_10026370
312 Ga0157375_10032670
313 Ga0163163_10157492
314 Ga0157380_10000219
315 Ga0157379_10031540
316 Ga0157376_10096829
317 Ga0163161_10087001
318 Ga0206356_11503659
319 Ga0207656_10002305
320 Ga0207642_10004062
321 Ga0207710_10000369
322 Ga0207680_10004342
323 Ga0207680_10015503
324 Ga0207680_10021602
325 Ga0207654_10140252
326 Ga0207671_10306938
327 Ga0207663_10066421
328 Ga0207649_10000005
329 Ga0207652_10048740
330 Ga0207650_10025386
331 Ga0207659_10000020
332 Ga0207687_10035866
333 Ga0207700_10000008
334 Ga0207700_10000016
335 Ga0207690_10008415
336 Ga0207686_10000032
337 Ga0207686_10000438
338 Ga0207704_10000025
339 Ga0207691_10000020
340 Ga0207711_10000020
341 Ga0207661_10420482
342 Ga0207679_10045085
343 Ga0207712_10080200
344 Ga0207668_10013116
345 Ga0207640_10000285
346 Ga0207658_10006057
347 Ga0207658_10025762
348 Ga0207703_10077133
349 Ga0207639_10292836
350 Ga0207678_10016115
351 Ga0207708_10365317
352 Ga0207702_10000016
353 Ga0207702_10003815
354 Ga0207641_10008529
355 Ga0207641_10014496
356 Ga0207641_10335970
357 Ga0207674_10184896
358 Ga0207683_10006404
359 Ga0207698_10024058
360 Ga0268266_10000216
361 Ga0268266_10000553
362 Ga0268266_10092441
363 Ga0268265_10011815
364 Ga0265334_10160950
365 Ga0307415_100001131
366 Ga0451807_1261771
367 Ga0451849_0060202
368 Ga0451853_0093663
369 Ga0466963_0043513
370 Ga0466957_0003681
371 Ga0466957_0494524
372 Ga0466967_0000046
373 Ga0466967_0076226
374 Ga0495592_0034411
375 Ga0495629_0005520
376 Ga0495629_0032469
377 Ga0495638_0076143
378 Ga0495653_0071930
379 Ga0495653_0202904
380 Ga0495662_0024365
381 Ga0495594_0000013
382 Ga0495608_0000031
383 Ga0495620_0032869
384 Ga0495628_0000323
385 Ga0495628_0224099
386 Ga0495628_0344809
387 Ga0495630_0000062
388 Ga0495630_0035038
389 Ga0495630_0363563
390 Ga0495652_0000003
391 Ga0495652_0149863
392 Ga0495640_0041629
393 Ga0495587_0001970
394 Ga0495587_0038396
395 Ga0495645_0008797
396 Ga0495645_0264198
397 Ga0495645_0441529
398 Ga0495622_0000014
399 Ga0495634_0008958
400 Ga0495634_0031511
401 Ga0495625_0000029
402 Ga0495635_0032104
403 Ga0495657_0000024
404 Ga0495657_0034502
405 Ga0495658_0005510
406 Ga0495613_0000309
407 Ga0495624_0132167
408 Ga0495600_0003314
409 Ga0495604_0003466
410 Ga0495604_0006459
411 Ga0495604_0283983
412 Ga0495674_0000042
413 Ga0495672_0099538
414 Ga0495676_0008140
415 Ga0495676_0357216
416 Ga0495680_0165199
417 Ga0495680_0276856
418 Ga0495675_0000209
419 Ga0495675_0008166
420 Ga0495686_0064023
421 Ga0495593_0024075
422 Ga0495602_0000228
423 Ga0495602_0007339
424 Ga0496100_0000038
425 Ga0496101_0000010
426 Ga0496102_0000584
427 Ga0496102_0023784
428 Ga0496103_0000043
429 Ga0496104_0000002
430 Ga0496104_0000576
431 Ga0496104_0285779
432 Ga0496105_0000001
433 Ga0496105_0009052
434 Ga0496106_0000018
435 Ga0496107_0000032
436 Ga0496108_0000045
437 Ga0496108_0063752
438 Ga0496109_0000032
439 Ga0496109_0004023
440 Ga0496109_0073771
441 Ga0496110_0000033
442 Ga0496110_0024862
443 Ga0496111_0000125
444 Ga0496111_0160376
445 Ga0496112_0017217
446 Ga0496113_0000007
447 Ga0496113_0086030
448 Ga0496113_0759934
449 Ga0496114_0000014
450 Ga0496115_0000255
451 Ga0496118_0253691
452 Ga0496124_0327901
453 Ga0496126_0070574
454 Ga0501032_0263581
455 Ga0501042_0012726
456 Ga0501042_0082734
457 Ga0501047_0119094
458 Ga0501068_0087271
459 Ga0501070_0017711
460 Ga0501070_0017845
461 Ga0501070_0283791
462 Ga0501071_0403759
463 Ga0501074_0278797
464 Ga0501076_0011312
465 Ga0501080_0463143
466 Ga0501044_0028510
467 Ga0495601_0000072
468 Ga0495601_0000097
469 Ga0495601_0000972
470 Ga0495601_0016152
471 Ga0495601_0030309
472 Ga0495612_0000767
473 Ga0495655_0000011
474 Ga0495655_0001739
475 Ga0495595_0000014
476 Ga0495595_0027010
477 Ga0495619_0000022
478 Ga0495619_0000121
479 Ga0495619_0000319
480 Ga0495619_0002591
481 Ga0495619_0169264
482 Ga0500566_0005120
483 Ga0500641_0002398
484 Ga0500628_000058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

54

174

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7588 8 198
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7546 8 212
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6886 8 198
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6639 8 212
4xrp-assembly1.cif.gz_D structure of the pnkp1/rnl/hen1 rna repair complex 0.5988 36 146
ID Description Score Start End Superfamily
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.854 27 146 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8391 24 146 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8184 25 146 3.40.50.2000
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8087 25 146 3.40.50.620
af_Q4DTE0_69_208_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8057 36 146 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7Y5XTJ2-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9425 5 163 GO:0003841
GO:0006654
AF-H0EB85-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9407 1 211 GO:0003841
GO:0006654
AF-A0A6N7Y838-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9374 1 203 GO:0003841
GO:0006654
AF-A0A286EHS3-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9366 5 210 GO:0003841
GO:0005886
GO:0006654
AF-A0A1M5T7Z4-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9351 4 210 GO:0003841
GO:0005886
GO:0006654

Map