F354551

General Info

Members Datasets Scaffolds Average Seq Length
242 157 484 321

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100004036|Ga0075428_1000040367
Length 339
Sequence MTVRVAVDALGGDRGPDEVIVGAVEASEAGVRPILFGPGELDPHGLDLVAAAQEISMEEKPAEAVRAKPDSSLVAACRAVGEGRAEAVVSAGNTGAMLAACLLELRRLPGVMRPAIAVPIPAIRGRPSVLIDSGANADARPEHLLQFAYMGAIFAEEILGISRPSVRLLSIGEEPEKGNQLTLEAHELLAGSDLRFDGNAESRDLLSGAADVVVCDGFTGNIALKLMEGTIKSVLNALREEITRTRRGRAGGLLIRGAARGLRDRLDPDTYGGAYLLGLNGIAVIAHGNSSAHAIANAIELAARGVEHNVVGRLAERLPDRRNAVLTSARSQPDSRQEE

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 10.33
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100004036 3300006844 Bacteria 16129
2 Ga0070666_10118869 3300005335 Bacteria 1832
3 Ga0070680_100144179 3300005336 Bacteria 1998
4 Ga0070682_100074750 3300005337 Bacteria 2177
5 Ga0070660_100025684 3300005339 Bacteria 4380
6 Ga0070687_100046501 3300005343 Bacteria 2222
7 Ga0070668_100229213 3300005347 Bacteria 1535
8 Ga0070675_100063854 3300005354 Bacteria 3044
9 Ga0070674_100294894 3300005356 Bacteria 1291
10 Ga0070688_100025852 3300005365 Bacteria 3480
11 Ga0070667_100025132 3300005367 Bacteria 4951
12 Ga0070714_100001136 3300005435 Bacteria 19099
13 Ga0070701_10049983 3300005438 Bacteria 2163
14 Ga0070711_100064655 3300005439 Unclassified 2557
15 Ga0070708_100097633 3300005445 Bacteria 2686
16 Ga0070708_100262762 3300005445 Bacteria 1623
17 Ga0070663_100029461 3300005455 Bacteria 3751
18 Ga0070685_10026655 3300005466 Bacteria 3186
19 Ga0070706_100019552 3300005467 Bacteria 6246
20 Ga0070707_100042853 3300005468 Bacteria 4334
21 Ga0070698_100021312 3300005471 Bacteria 6789
22 Ga0070698_100065859 3300005471 Bacteria 3648
23 Ga0070699_100032650 3300005518 Bacteria 4496
24 Ga0070699_100312691 3300005518 Bacteria 1410
25 Ga0070679_100052651 3300005530 Bacteria 4053
26 Ga0070679_100100278 3300005530 Bacteria 2882
27 Ga0070679_100461481 3300005530 Bacteria 1215
28 Ga0070684_100094879 3300005535 Bacteria 2658
29 Ga0070684_100211681 3300005535 Bacteria 1767
30 Ga0070672_100166078 3300005543 Bacteria 1833
31 Ga0070665_100204766 3300005548 Bacteria 1974
32 Ga0068854_100225466 3300005578 Bacteria 1485
33 Ga0068856_100032170 3300005614 Bacteria 5135
34 Ga0068852_100263538 3300005616 Bacteria 1656
35 Ga0068864_100272702 3300005618 Bacteria 1577
36 Ga0068866_10005598 3300005718 Bacteria 5197
37 Ga0068860_100031478 3300005843 Bacteria 5100
38 Ga0075365_10059960 3300006038 Bacteria 2538
39 Ga0075432_10008353 3300006058 Bacteria 3530
40 Ga0070712_100156349 3300006175 Bacteria 1756
41 Ga0075428_100026058 3300006844 Bacteria 6475
42 Ga0075430_100021503 3300006846 Bacteria 5483
43 Ga0075431_100211873 3300006847 Bacteria 1979
44 Ga0075429_100249385 3300006880 Bacteria 1555
45 Ga0075436_100021756 3300006914 Bacteria 4401
46 Ga0075435_100324214 3300007076 Bacteria 1318
47 Ga0099795_10061830 3300007788 Bacteria 1392
48 Ga0111539_10043572 3300009094 Bacteria 5379
49 Ga0111539_10135400 3300009094 Bacteria 2885
50 Ga0111539_10256224 3300009094 Bacteria 2037
51 Ga0111539_10564969 3300009094 Unclassified 1325
52 Ga0105245_10008055 3300009098 Bacteria 9214
53 Ga0105245_10128550 3300009098 Bacteria 2374
54 Ga0114129_10014133 3300009147 Bacteria 11372
55 Ga0114129_10018664 3300009147 Bacteria 9875
56 Ga0114129_10110080 3300009147 Bacteria 3802
57 Ga0105243_10451960 3300009148 Unclassified 1206
58 Ga0105242_10097170 3300009176 Bacteria 2490
59 Ga0105248_10048506 3300009177 Bacteria 4764
60 Ga0105248_10295382 3300009177 Bacteria 1824
61 Ga0105249_10191805 3300009553 Bacteria 1995
62 Ga0157369_10468160 3300013105 Bacteria 1305
63 Ga0157374_10177384 3300013296 Bacteria 2080
64 Ga0157375_10131164 3300013308 Bacteria 2625
65 Ga0157379_10243155 3300014968 Unclassified 1633
66 Ga0207688_10006345 3300025901 Bacteria 6436
67 Ga0207680_10100407 3300025903 Bacteria 1858
68 Ga0207647_10118704 3300025904 Unclassified 1560
69 Ga0207693_10001729 3300025915 Bacteria 19191
70 Ga0207663_10057177 3300025916 Bacteria 2457
71 Ga0207657_10064115 3300025919 Bacteria 3138
72 Ga0207652_10029375 3300025921 Bacteria 4596
73 Ga0207652_10298316 3300025921 Bacteria 1454
74 Ga0207652_10444057 3300025921 Bacteria 1169
75 Ga0207646_10033998 3300025922 Bacteria 4608
76 Ga0207646_10119827 3300025922 Bacteria 2364
77 Ga0207659_10047280 3300025926 Bacteria 3043
78 Ga0207687_10019201 3300025927 Bacteria 4526
79 Ga0207687_10062730 3300025927 Bacteria 2629
80 Ga0207664_10024421 3300025929 Bacteria 4542
81 Ga0207706_10201581 3300025933 Bacteria 1745
82 Ga0207686_10025706 3300025934 Bacteria 3429
83 Ga0207691_10010426 3300025940 Bacteria 8916
84 Ga0207711_10099684 3300025941 Unclassified 2568
85 Ga0207689_10106418 3300025942 Bacteria 2304
86 Ga0207639_10156833 3300026041 Bacteria 1913
87 Ga0207678_10040193 3300026067 Bacteria 4057
88 Ga0207708_10210278 3300026075 Bacteria 1555
89 Ga0207702_10136401 3300026078 Bacteria 2214
90 Ga0207648_10001442 3300026089 Bacteria 26183
91 Ga0207648_10020753 3300026089 Bacteria 5914
92 Ga0207428_10001025 3300027907 Bacteria 30847
93 Ga0265338_10003899 3300028800 Bacteria 20611
94 Ga0265340_10018275 3300031247 Bacteria 3617
95 Ga0373936_0051886 3300035113 Bacteria 1661
96 Ga0373943_0029407 3300035170 Bacteria 2596
97 Ga0373946_0026831 3300035171 Bacteria 2275
98 Ga0373947_0000125 3300035725 Bacteria 38878
99 Ga0373947_0018505 3300035725 Bacteria 4011
100 Ga0373925_0021653 3300037068 Bacteria 4685
101 Ga0395899_0017313 3300037312 Bacteria 5492
102 Ga0395899_0033057 3300037312 Bacteria 3886
103 Ga0395899_0050506 3300037312 Bacteria 3087
104 Ga0395900_0006475 3300037418 Bacteria 12211
105 Ga0395900_0014234 3300037418 Bacteria 8120
106 Ga0395900_0017359 3300037418 Bacteria 7347
107 Ga0395900_0037752 3300037418 Bacteria 4979
108 Ga0395900_0065078 3300037418 Bacteria 3745
109 Ga0395900_0112277 3300037418 Bacteria 2798
110 Ga0395900_0206162 3300037418 Bacteria 1987
111 Ga0395898_0002003 3300037466 Bacteria 25556
112 Ga0395898_0003650 3300037466 Bacteria 17118
113 Ga0395898_0008758 3300037466 Bacteria 10669
114 Ga0395898_0034097 3300037466 Bacteria 5076
115 Ga0395898_0051074 3300037466 Bacteria 4044
116 Ga0395898_0051757 3300037466 Bacteria 4015
117 Ga0395898_0107391 3300037466 Bacteria 2677
118 Ga0395898_0248919 3300037466 Bacteria 1695
119 Ga0395905_0012459 3300037471 Bacteria 8186
120 Ga0395905_0013783 3300037471 Bacteria 7738
121 Ga0395905_0017561 3300037471 Bacteria 6791
122 Ga0395905_0067059 3300037471 Bacteria 3361
123 Ga0395905_0104972 3300037471 Bacteria 2653
124 Ga0395905_0140303 3300037471 Bacteria 2274
125 Ga0395905_0184730 3300037471 Bacteria 1957
126 Ga0395901_0033051 3300038443 Bacteria 5338
127 Ga0395901_0056180 3300038443 Bacteria 4095
128 Ga0395901_0056598 3300038443 Bacteria 4079
129 Ga0395901_0073603 3300038443 Bacteria 3563
130 Ga0395901_0081567 3300038443 Bacteria 3378
131 Ga0395901_0089681 3300038443 Bacteria 3217
132 Ga0395901_0156780 3300038443 Bacteria 2391
133 Ga0395901_0157915 3300038443 Bacteria 2382
134 Ga0395901_0185139 3300038443 Bacteria 2184
135 Ga0395901_0409569 3300038443 Bacteria 1392
136 Ga0466963_0026630 3300044694 Bacteria 3699
137 Ga0466957_0127167 3300044842 Bacteria 1629
138 Ga0466960_0017431 3300044901 Bacteria 3130
139 Ga0466958_0017020 3300045836 Bacteria 4195
140 Ga0466967_0017923 3300045976 Bacteria 5642
141 Ga0466967_0160261 3300045976 Bacteria 2111
142 Ga0466967_0350373 3300045976 Bacteria 1429
143 Ga0495603_0094441 3300046455 Unclassified 1747
144 Ga0495629_0012824 3300046459 Bacteria 6064
145 Ga0495629_0056124 3300046459 Bacteria 2754
146 Ga0495641_0031025 3300046461 Bacteria 2557
147 Ga0495641_0031881 3300046461 Bacteria 2514
148 Ga0495641_0043408 3300046461 Unclassified 2079
149 Ga0495653_0021428 3300046463 Bacteria 5236
150 Ga0495653_0062596 3300046463 Bacteria 2810
151 Ga0495580_0011407 3300046472 Bacteria 6875
152 Ga0495582_0037029 3300046473 Bacteria 2684
153 Ga0495582_0068062 3300046473 Unclassified 1968
154 Ga0495664_0078260 3300046477 Bacteria 1981
155 Ga0495594_0139282 3300046499 Unclassified 1376
156 Ga0495618_0009884 3300046514 Bacteria 5772
157 Ga0495630_0021415 3300046517 Bacteria 4773
158 Ga0495666_0001941 3300046526 Bacteria 10194
159 Ga0495652_0087083 3300046529 Bacteria 2562
160 Ga0495665_0070836 3300046531 Bacteria 1837
161 Ga0495586_0106458 3300046535 Bacteria 1559
162 Ga0495634_0024567 3300046642 Bacteria 4226
163 Ga0495647_0000889 3300046681 Bacteria 8944
164 Ga0495613_0044903 3300046689 Bacteria 3268
165 Ga0495624_0003977 3300046690 Bacteria 10876
166 Ga0495581_0061579 3300047315 Bacteria 2169
167 Ga0495581_0071622 3300047315 Bacteria 2005
168 Ga0495676_0006762 3300047321 Bacteria 10542
169 Ga0495680_0055080 3300047322 Bacteria 3085
170 Ga0495614_0001809 3300048089 Bacteria 9365
171 Ga0496101_0038209 3300048904 Bacteria 3408
172 Ga0496102_0025903 3300048905 Bacteria 5225
173 Ga0496102_0049787 3300048905 Bacteria 3812
174 Ga0496102_0157869 3300048905 Bacteria 2133
175 Ga0496104_0083340 3300048907 Bacteria 3050
176 Ga0496104_0412078 3300048907 Bacteria 1263
177 Ga0496105_0028547 3300048908 Bacteria 4562
178 Ga0496106_0009747 3300048909 Bacteria 7094
179 Ga0496106_0050159 3300048909 Bacteria 3145
180 Ga0496106_0136889 3300048909 Bacteria 1924
181 Ga0496107_0067222 3300048910 Bacteria 2600
182 Ga0496108_0001551 3300048911 Bacteria 18179
183 Ga0496109_0002068 3300048912 Bacteria 16663
184 Ga0496109_0029286 3300048912 Bacteria 4931
185 Ga0496109_0040732 3300048912 Bacteria 4207
186 Ga0496109_0452725 3300048912 Bacteria 1212
187 Ga0496110_0002996 3300048913 Bacteria 12811
188 Ga0496110_0009189 3300048913 Bacteria 7986
189 Ga0496110_0051241 3300048913 Bacteria 3627
190 Ga0496111_0006935 3300048914 Bacteria 7393
191 Ga0496111_0008823 3300048914 Bacteria 6698
192 Ga0496112_0060055 3300048915 Bacteria 3746
193 Ga0496112_0161669 3300048915 Bacteria 2206
194 Ga0496113_0022856 3300048916 Bacteria 4429
195 Ga0496113_0091673 3300048916 Bacteria 2343
196 Ga0501034_0009009 3300049571 Bacteria 10482
197 Ga0501036_0095097 3300049572 Bacteria 2519
198 Ga0501041_0080421 3300049577 Bacteria 2007
199 Ga0501041_0128087 3300049577 Unclassified 1581
200 Ga0501047_0163388 3300049581 Bacteria 2098
201 Ga0501048_0062761 3300049582 Archaea 2629
202 Ga0501067_0006142 3300049583 Bacteria 6659
203 Ga0501068_0014890 3300049584 Bacteria 4455
204 Ga0501069_0003892 3300049585 Bacteria 7695
205 Ga0501070_0078896 3300049586 Bacteria 2724
206 Ga0501070_0320223 3300049586 Bacteria 1261
207 Ga0501071_0176231 3300049587 Unclassified 1601
208 Ga0501072_0009313 3300049588 Bacteria 7465
209 Ga0501072_0048927 3300049588 Bacteria 3328
210 Ga0501073_0159682 3300049589 Bacteria 1562
211 Ga0501074_0022975 3300049590 Bacteria 4536
212 Ga0501076_0005147 3300049592 Bacteria 9358
213 Ga0501077_0056194 3300049593 Archaea 2498
214 Ga0501079_0036707 3300049741 Bacteria 3775
215 Ga0501079_0227661 3300049741 Unclassified 1456
216 Ga0501080_0019867 3300049742 Bacteria 6220
217 Ga0501080_0086236 3300049742 Archaea 2917
218 Ga0501080_0136139 3300049742 Bacteria 2273
219 Ga0501081_0067709 3300049743 Archaea 2485
220 Ga0501081_0280305 3300049743 Bacteria 1220
221 Ga0501083_0002929 3300049744 Bacteria 11819
222 Ga0501045_0075628 3300049824 Archaea 2480
223 nmdc:mga0yw44_14132_c1 3300050492 Bacteria 4227
224 nmdc:mga05p37_10897_c1 3300050507 Bacteria 10795
225 nmdc:mga05p37_14378_c1 3300050507 Bacteria 9504
226 nmdc:mga05p37_224006_c1 3300050507 Bacteria 2268
227 nmdc:mga09592_155209_c1 3300050508 Bacteria 1976
228 nmdc:mga09592_162346_c1 3300050508 Bacteria 1930
229 nmdc:mga0qj67_20409_c1 3300050509 Bacteria 5072
230 nmdc:mga0qj67_326276_c1 3300050509 Bacteria 1242
231 nmdc:mga06r32_201120_c1 3300050510 Bacteria 1980
232 nmdc:mga08y16_110836_c1 3300050511 Bacteria 2858
233 nmdc:mga08y16_38001_c1 3300050511 Bacteria 5054
234 nmdc:mga08y16_83449_c1 3300050511 Bacteria 3330
235 nmdc:mga0rr50_101637_c1 3300050513 Bacteria 2260
236 nmdc:mga08x19_58254_c1 3300050514 Bacteria 2498
237 Ga0495612_0003141 3300053078 Bacteria 6842
238 Ga0495595_0084079 3300053084 Bacteria 1520
239 Ga0501084_0093960 3300054114 Bacteria 2518
240 Ga0501084_0223360 3300054114 Unclassified 1589
241 Ga0501082_0307456 3300060353 Unclassified 1380
242 Ga0530510_0344260 3300061734 Unclassified 1119
243 Ga0075428_100004036
244 Ga0070666_10118869
245 Ga0070680_100144179
246 Ga0070682_100074750
247 Ga0070660_100025684
248 Ga0070687_100046501
249 Ga0070668_100229213
250 Ga0070675_100063854
251 Ga0070674_100294894
252 Ga0070688_100025852
253 Ga0070667_100025132
254 Ga0070714_100001136
255 Ga0070701_10049983
256 Ga0070711_100064655
257 Ga0070708_100097633
258 Ga0070708_100262762
259 Ga0070663_100029461
260 Ga0070685_10026655
261 Ga0070706_100019552
262 Ga0070707_100042853
263 Ga0070698_100021312
264 Ga0070698_100065859
265 Ga0070699_100032650
266 Ga0070699_100312691
267 Ga0070679_100052651
268 Ga0070679_100100278
269 Ga0070679_100461481
270 Ga0070684_100094879
271 Ga0070684_100211681
272 Ga0070672_100166078
273 Ga0070665_100204766
274 Ga0068854_100225466
275 Ga0068856_100032170
276 Ga0068852_100263538
277 Ga0068864_100272702
278 Ga0068866_10005598
279 Ga0068860_100031478
280 Ga0075365_10059960
281 Ga0075432_10008353
282 Ga0070712_100156349
283 Ga0075428_100026058
284 Ga0075430_100021503
285 Ga0075431_100211873
286 Ga0075429_100249385
287 Ga0075436_100021756
288 Ga0075435_100324214
289 Ga0099795_10061830
290 Ga0111539_10043572
291 Ga0111539_10135400
292 Ga0111539_10256224
293 Ga0111539_10564969
294 Ga0105245_10008055
295 Ga0105245_10128550
296 Ga0114129_10014133
297 Ga0114129_10018664
298 Ga0114129_10110080
299 Ga0105243_10451960
300 Ga0105242_10097170
301 Ga0105248_10048506
302 Ga0105248_10295382
303 Ga0105249_10191805
304 Ga0157369_10468160
305 Ga0157374_10177384
306 Ga0157375_10131164
307 Ga0157379_10243155
308 Ga0207688_10006345
309 Ga0207680_10100407
310 Ga0207647_10118704
311 Ga0207693_10001729
312 Ga0207663_10057177
313 Ga0207657_10064115
314 Ga0207652_10029375
315 Ga0207652_10298316
316 Ga0207652_10444057
317 Ga0207646_10033998
318 Ga0207646_10119827
319 Ga0207659_10047280
320 Ga0207687_10019201
321 Ga0207687_10062730
322 Ga0207664_10024421
323 Ga0207706_10201581
324 Ga0207686_10025706
325 Ga0207691_10010426
326 Ga0207711_10099684
327 Ga0207689_10106418
328 Ga0207639_10156833
329 Ga0207678_10040193
330 Ga0207708_10210278
331 Ga0207702_10136401
332 Ga0207648_10001442
333 Ga0207648_10020753
334 Ga0207428_10001025
335 Ga0265338_10003899
336 Ga0265340_10018275
337 Ga0373936_0051886
338 Ga0373943_0029407
339 Ga0373946_0026831
340 Ga0373947_0000125
341 Ga0373947_0018505
342 Ga0373925_0021653
343 Ga0395899_0017313
344 Ga0395899_0033057
345 Ga0395899_0050506
346 Ga0395900_0006475
347 Ga0395900_0014234
348 Ga0395900_0017359
349 Ga0395900_0037752
350 Ga0395900_0065078
351 Ga0395900_0112277
352 Ga0395900_0206162
353 Ga0395898_0002003
354 Ga0395898_0003650
355 Ga0395898_0008758
356 Ga0395898_0034097
357 Ga0395898_0051074
358 Ga0395898_0051757
359 Ga0395898_0107391
360 Ga0395898_0248919
361 Ga0395905_0012459
362 Ga0395905_0013783
363 Ga0395905_0017561
364 Ga0395905_0067059
365 Ga0395905_0104972
366 Ga0395905_0140303
367 Ga0395905_0184730
368 Ga0395901_0033051
369 Ga0395901_0056180
370 Ga0395901_0056598
371 Ga0395901_0073603
372 Ga0395901_0081567
373 Ga0395901_0089681
374 Ga0395901_0156780
375 Ga0395901_0157915
376 Ga0395901_0185139
377 Ga0395901_0409569
378 Ga0466963_0026630
379 Ga0466957_0127167
380 Ga0466960_0017431
381 Ga0466958_0017020
382 Ga0466967_0017923
383 Ga0466967_0160261
384 Ga0466967_0350373
385 Ga0495603_0094441
386 Ga0495629_0012824
387 Ga0495629_0056124
388 Ga0495641_0031025
389 Ga0495641_0031881
390 Ga0495641_0043408
391 Ga0495653_0021428
392 Ga0495653_0062596
393 Ga0495580_0011407
394 Ga0495582_0037029
395 Ga0495582_0068062
396 Ga0495664_0078260
397 Ga0495594_0139282
398 Ga0495618_0009884
399 Ga0495630_0021415
400 Ga0495666_0001941
401 Ga0495652_0087083
402 Ga0495665_0070836
403 Ga0495586_0106458
404 Ga0495634_0024567
405 Ga0495647_0000889
406 Ga0495613_0044903
407 Ga0495624_0003977
408 Ga0495581_0061579
409 Ga0495581_0071622
410 Ga0495676_0006762
411 Ga0495680_0055080
412 Ga0495614_0001809
413 Ga0496101_0038209
414 Ga0496102_0025903
415 Ga0496102_0049787
416 Ga0496102_0157869
417 Ga0496104_0083340
418 Ga0496104_0412078
419 Ga0496105_0028547
420 Ga0496106_0009747
421 Ga0496106_0050159
422 Ga0496106_0136889
423 Ga0496107_0067222
424 Ga0496108_0001551
425 Ga0496109_0002068
426 Ga0496109_0029286
427 Ga0496109_0040732
428 Ga0496109_0452725
429 Ga0496110_0002996
430 Ga0496110_0009189
431 Ga0496110_0051241
432 Ga0496111_0006935
433 Ga0496111_0008823
434 Ga0496112_0060055
435 Ga0496112_0161669
436 Ga0496113_0022856
437 Ga0496113_0091673
438 Ga0501034_0009009
439 Ga0501036_0095097
440 Ga0501041_0080421
441 Ga0501041_0128087
442 Ga0501047_0163388
443 Ga0501048_0062761
444 Ga0501067_0006142
445 Ga0501068_0014890
446 Ga0501069_0003892
447 Ga0501070_0078896
448 Ga0501070_0320223
449 Ga0501071_0176231
450 Ga0501072_0009313
451 Ga0501072_0048927
452 Ga0501073_0159682
453 Ga0501074_0022975
454 Ga0501076_0005147
455 Ga0501077_0056194
456 Ga0501079_0036707
457 Ga0501079_0227661
458 Ga0501080_0019867
459 Ga0501080_0086236
460 Ga0501080_0136139
461 Ga0501081_0067709
462 Ga0501081_0280305
463 Ga0501083_0002929
464 Ga0501045_0075628
465 nmdc:mga0yw44_14132_c1
466 nmdc:mga05p37_10897_c1
467 nmdc:mga05p37_14378_c1
468 nmdc:mga05p37_224006_c1
469 nmdc:mga09592_155209_c1
470 nmdc:mga09592_162346_c1
471 nmdc:mga0qj67_20409_c1
472 nmdc:mga0qj67_326276_c1
473 nmdc:mga06r32_201120_c1
474 nmdc:mga08y16_110836_c1
475 nmdc:mga08y16_38001_c1
476 nmdc:mga08y16_83449_c1
477 nmdc:mga0rr50_101637_c1
478 nmdc:mga08x19_58254_c1
479 Ga0495612_0003141
480 Ga0495595_0084079
481 Ga0501084_0093960
482 Ga0501084_0223360
483 Ga0501082_0307456
484 Ga0530510_0344260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

3

313

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.9424 2 314
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9273 1 316
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.9132 1 317
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.906 2 314
1u7n-assembly1.cif.gz_A crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.9051 2 316
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9239 1 324 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8999 1 324 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8769 4 314 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.866 4 314 3.40.718.10
3u9eA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.7052 2 304 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A538JMJ6-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9806 96 316 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-R7BNA3-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9743 56 318 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A7W0ZAG4-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9743 1 204 GO:0005737
GO:0006633
GO:0008654
GO:0016747
AF-A0A661UK14-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9733 48 318 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A538KB95-F1-model_v4 Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) 0.9731 9 330 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Map