F354566

General Info

Members Datasets Scaffolds Average Seq Length
242 195 484 206

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100283121|Ga0075430_1002831211
Length 239
Sequence MCRGQQGAPGALCQRNVITHRCVDTVGTKGCIMASPSLKVLALNCTLKTTRKGETSSTDVLLKQLMDALKQYGAEGEIVRVADLDIKPGVTSDEGDGDEWPKLLPRVLAADILVIGSPIWLGQPSSIAKRVMERLDAFLDEKDDKGRMPSYGKVAIAAIVGNEDGAHHVAAELIQALTEVGFTIPAGAATYWVGEAMGDVVYKDLKKTPETVAAWTPMLASNAAHLARLLKKEAYPGKS

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
180 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
186 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
187 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
188 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
189 2643221698 Ensifer sp. Root142 Isolate Unclassified
190 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
191 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
192 2919404418 Luteibacter sp. 3190 Isolate Unclassified
193 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
194 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
195 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.94
Nodule 1.24
Rhizoplane 4.96
Rhizosphere 64.05
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100283121 3300006846 Bacteria 1372
2 JGI25159J45721_1019930 3300002987 Bacteria 1307
3 JGI25151J46595_10062554 3300003187 Bacteria 1176
4 JGI25165J46597_1024596 3300003214 Bacteria 781
5 rootH2_10094902 3300003320 Bacteria 3655
6 rootL2_10024727 3300003322 Bacteria 5605
7 rootL2_10245323 3300003322 Bacteria 3043
8 rootH1_10058138 3300003323 Bacteria 6531
9 Ga0055526_1004609 3300003771 Bacteria 8218
10 Ga0055526_1007969 3300003771 Bacteria 5376
11 Ga0055524_1002446 3300003775 Bacteria 9559
12 Ga0055536_1014452 3300003781 Bacteria 2771
13 Ga0055534_1000365 3300003784 Bacteria 28375
14 Ga0055528_1000096 3300003790 Bacteria 70375
15 Ga0055540_1039665 3300003792 Bacteria 1025
16 Ga0055531_10060850 3300003794 Bacteria 923
17 Ga0065165_1045450 3300005262 Bacteria 1279
18 Ga0065165_1052720 3300005262 Bacteria 1148
19 Ga0070658_10192958 3300005327 Bacteria 1717
20 Ga0070680_100777252 3300005336 Bacteria 825
21 Ga0070668_100279183 3300005347 Bacteria 1394
22 Ga0070674_100106025 3300005356 Bacteria 2056
23 Ga0070714_100654091 3300005435 Unclassified 1012
24 Ga0070710_10765236 3300005437 Bacteria 687
25 Ga0070678_100622117 3300005456 Bacteria 966
26 Ga0070685_10417175 3300005466 Bacteria 933
27 Ga0070679_100039816 3300005530 Bacteria 4673
28 Ga0070679_100171702 3300005530 Bacteria 2141
29 Ga0070704_100017657 3300005549 Bacteria 4543
30 Ga0068852_100673192 3300005616 Bacteria 1043
31 Ga0081455_10078436 3300005937 Bacteria 2714
32 Ga0081538_10060754 3300005981 Bacteria 2170
33 Ga0075367_10250515 3300006178 Bacteria 1111
34 Ga0075369_10006478 3300006186 Bacteria 4428
35 Ga0075428_100002298 3300006844 Bacteria 20687
36 Ga0075430_100004650 3300006846 Bacteria 11543
37 Ga0075431_100006526 3300006847 Bacteria 11584
38 Ga0075431_100170703 3300006847 Unclassified 2235
39 Ga0075433_10043413 3300006852 Bacteria 3902
40 Ga0075434_100033773 3300006871 Bacteria 5050
41 Ga0075429_100005061 3300006880 Bacteria 11339
42 Ga0075429_100177506 3300006880 Bacteria 1866
43 Ga0068865_101070850 3300006881 Bacteria 709
44 Ga0075435_100254538 3300007076 Bacteria 1495
45 Ga0099795_10023264 3300007788 Bacteria 2054
46 Ga0114129_10006716 3300009147 Bacteria 16336
47 Ga0114129_10220236 3300009147 Bacteria 2561
48 Ga0105243_10229278 3300009148 Bacteria 1647
49 Ga0099796_10014632 3300010159 Bacteria 2271
50 Ga0157378_11330471 3300013297 Bacteria 760
51 Ga0157380_10547758 3300014326 Bacteria 1134
52 Ga0182005_1030381 3300015265 Bacteria 1472
53 Ga0183369_1003 3300015685 Bacteria 726443
54 Ga0213876_10306890 3300021384 Bacteria 843
55 Ga0209129_1002061 3300025258 Bacteria 10363
56 Ga0209233_1015261 3300025261 Bacteria 2145
57 Ga0209673_1000252 3300025273 Bacteria 101552
58 Ga0209673_1000594 3300025273 Bacteria 56419
59 Ga0209673_1036493 3300025273 Bacteria 1457
60 Ga0209130_1005844 3300025284 Bacteria 4149
61 Ga0209675_1000842 3300025291 Bacteria 20072
62 Ga0209676_1008770 3300025292 Bacteria 4456
63 Ga0209676_1032820 3300025292 Bacteria 1555
64 Ga0209025_1003140 3300025294 Bacteria 16149
65 Ga0209564_1000306 3300025295 Bacteria 96600
66 Ga0209564_1003649 3300025295 Bacteria 10201
67 Ga0209564_1065015 3300025295 Bacteria 792
68 Ga0209050_1033222 3300025298 Bacteria 1568
69 Ga0209050_1043417 3300025298 Bacteria 1215
70 Ga0209256_1000246 3300025299 Bacteria 96612
71 Ga0209256_1000786 3300025299 Bacteria 40946
72 Ga0209051_1020647 3300025303 Bacteria 2828
73 Ga0209257_1006708 3300025304 Bacteria 7278
74 Ga0209257_1080946 3300025304 Bacteria 833
75 Ga0207705_10101754 3300025909 Bacteria 2114
76 Ga0207660_10188668 3300025917 Bacteria 1604
77 Ga0207652_10028688 3300025921 Bacteria 4646
78 Ga0207669_10100192 3300025937 Bacteria 1913
79 Ga0207704_10330097 3300025938 Bacteria 1180
80 Ga0207668_10261622 3300025972 Bacteria 1410
81 Ga0207683_10436798 3300026121 Bacteria 1206
82 Ga0268266_10226953 3300028379 Bacteria 1719
83 Ga0265316_10272516 3300031344 Bacteria 1238
84 Ga0265313_10225854 3300031595 Bacteria 770
85 Ga0307405_10000774 3300031731 Bacteria 12519
86 Ga0307413_10007832 3300031824 Bacteria 4996
87 Ga0373950_0003277 3300034818 Bacteria 2301
88 Ga0373944_0067395 3300035089 Bacteria 1159
89 Ga0373923_0000773 3300035111 Bacteria 8316
90 Ga0373936_0000999 3300035113 Bacteria 10085
91 Ga0373945_0009370 3300035116 Bacteria 3208
92 Ga0373945_0010747 3300035116 Bacteria 3017
93 Ga0373954_0001342 3300035118 Bacteria 9923
94 Ga0373957_0016263 3300035120 Bacteria 2573
95 Ga0373943_0015319 3300035170 Bacteria 3481
96 Ga0373943_0057108 3300035170 Bacteria 1938
97 Ga0373946_0015197 3300035171 Bacteria 2915
98 Ga0373946_0240805 3300035171 Bacteria 879
99 Ga0373955_0000837 3300035172 Bacteria 13184
100 Ga0373924_0023591 3300035410 Bacteria 2416
101 Ga0373935_0003048 3300035692 Bacteria 9655
102 Ga0373935_0032178 3300035692 Bacteria 3258
103 Ga0373927_0033392 3300035695 Bacteria 3350
104 Ga0373927_0034460 3300035695 Bacteria 3293
105 Ga0373933_0067839 3300035724 Bacteria 2165
106 Ga0373947_0000090 3300035725 Bacteria 45944
107 Ga0373947_0058969 3300035725 Bacteria 2326
108 Ga0373937_0000007 3300036401 Bacteria 183537
109 Ga0373925_0000011 3300037068 Bacteria 209840
110 Ga0373925_0035628 3300037068 Bacteria 3672
111 Ga0373925_0294981 3300037068 Bacteria 1308
112 Ga0436365_0508693 3300039437 Bacteria 2237
113 Ga0436363_1251163 3300039450 Bacteria 802
114 Ga0495592_0000067 3300046454 Bacteria 95019
115 Ga0495603_0013919 3300046455 Bacteria 4865
116 Ga0495629_0007242 3300046459 Bacteria 8170
117 Ga0495641_0050086 3300046461 Bacteria 1910
118 Ga0495651_0003012 3300046462 Bacteria 13010
119 Ga0495653_0000070 3300046463 Bacteria 88725
120 Ga0495582_0050452 3300046473 Bacteria 2293
121 Ga0495639_0131270 3300046475 Bacteria 1199
122 Ga0495662_0002368 3300046476 Bacteria 9502
123 Ga0495664_0000019 3300046477 Bacteria 153012
124 Ga0495584_0019223 3300046491 Bacteria 3470
125 Ga0495594_0201830 3300046499 Bacteria 1133
126 Ga0495608_0000026 3300046511 Bacteria 156234
127 Ga0495618_0000015 3300046514 Bacteria 152478
128 Ga0495628_0000006 3300046516 Bacteria 306606
129 Ga0495630_0001772 3300046517 Bacteria 15103
130 Ga0495663_0126988 3300046525 Bacteria 858
131 Ga0495666_0049865 3300046526 Bacteria 2013
132 Ga0495652_0000030 3300046529 Bacteria 152921
133 Ga0495640_0000013 3300046533 Bacteria 172438
134 Ga0495587_0000021 3300046536 Bacteria 152895
135 Ga0495621_0046114 3300046539 Bacteria 1546
136 Ga0495645_0000001 3300046543 Bacteria 657910
137 Ga0495633_0102585 3300046558 Bacteria 1328
138 Ga0495667_0000027 3300046559 Bacteria 152535
139 Ga0495656_0132538 3300046615 Bacteria 1187
140 Ga0495656_0362385 3300046615 Bacteria 753
141 Ga0495634_0000008 3300046642 Bacteria 163983
142 Ga0495635_0000028 3300046663 Bacteria 121669
143 Ga0495588_0070831 3300046674 Bacteria 1812
144 Ga0495657_0000144 3300046675 Bacteria 63756
145 Ga0495599_0000014 3300046678 Bacteria 177414
146 Ga0495623_0000006 3300046679 Bacteria 140385
147 Ga0495646_0000026 3300046680 Bacteria 100569
148 Ga0495647_0008460 3300046681 Bacteria 3461
149 Ga0495658_0026978 3300046683 Bacteria 3085
150 Ga0495658_0071859 3300046683 Bacteria 2011
151 Ga0495613_0039584 3300046689 Bacteria 3495
152 Ga0495624_0056270 3300046690 Bacteria 2475
153 Ga0495624_0120617 3300046690 Bacteria 1610
154 Ga0495600_0000005 3300046809 Bacteria 171675
155 Ga0495604_0000002 3300047317 Bacteria 530904
156 Ga0495674_0000004 3300047319 Bacteria 531855
157 Ga0495676_0025562 3300047321 Bacteria 5096
158 Ga0495676_0425722 3300047321 Bacteria 878
159 Ga0495680_0082269 3300047322 Bacteria 2430
160 Ga0495675_0000114 3300047444 Bacteria 57905
161 Ga0495684_0000004 3300047471 Bacteria 307093
162 Ga0495593_0001974 3300047673 Bacteria 12217
163 Ga0495602_0000001 3300048088 Bacteria 510904
164 Ga0496101_0225277 3300048904 Bacteria 1456
165 Ga0496104_0004694 3300048907 Bacteria 11900
166 Ga0496104_0008153 3300048907 Bacteria 9298
167 Ga0496105_0009998 3300048908 Bacteria 7443
168 Ga0496105_0016942 3300048908 Bacteria 5831
169 Ga0496105_0781398 3300048908 Bacteria 727
170 Ga0496106_0426024 3300048909 Bacteria 1066
171 Ga0496108_0103888 3300048911 Bacteria 2425
172 Ga0496109_0367232 3300048912 Bacteria 1359
173 Ga0496110_0072877 3300048913 Bacteria 3048
174 Ga0496114_0509792 3300048917 Bacteria 1064
175 Ga0496115_0276850 3300048918 Bacteria 1378
176 Ga0496116_0045508 3300048919 Bacteria 2970
177 Ga0496116_0066487 3300048919 Bacteria 2306
178 Ga0496117_0002133 3300048920 Bacteria 25858
179 Ga0496117_0011480 3300048920 Bacteria 7934
180 Ga0496119_0004381 3300048922 Bacteria 14086
181 Ga0496120_0099694 3300048923 Bacteria 1537
182 Ga0496121_0160008 3300048924 Bacteria 1648
183 Ga0496122_0098440 3300048925 Bacteria 1964
184 Ga0496122_0149561 3300048925 Bacteria 1444
185 Ga0496123_0083411 3300048926 Bacteria 1932
186 Ga0496124_0002512 3300048927 Bacteria 23867
187 Ga0496124_0182054 3300048927 Bacteria 1616
188 Ga0496125_0157446 3300048928 Unclassified 1549
189 Ga0496126_0009897 3300048929 Bacteria 10075
190 Ga0496126_0172974 3300048929 Bacteria 1839
191 Ga0496126_0403886 3300048929 Bacteria 1107
192 Ga0501033_0176060 3300049570 Bacteria 1535
193 Ga0501034_0061634 3300049571 Bacteria 3766
194 Ga0501038_0422590 3300049574 Bacteria 1028
195 Ga0501043_0048435 3300049579 Bacteria 3341
196 Ga0501047_0088577 3300049581 Bacteria 2972
197 Ga0501047_0337505 3300049581 Bacteria 1345
198 Ga0501070_0322497 3300049586 Bacteria 1256
199 Ga0501072_0006733 3300049588 Bacteria 8734
200 Ga0501075_0479845 3300049591 Bacteria 948
201 Ga0501035_0075549 3300049822 Bacteria 2980
202 Ga0501035_0167088 3300049822 Bacteria 1902
203 Ga0501035_0581610 3300049822 Bacteria 914
204 Ga0501035_0648324 3300049822 Bacteria 856
205 Ga0501044_0019547 3300049823 Bacteria 7243
206 Ga0501044_0141423 3300049823 Bacteria 2395
207 Ga0501044_0641359 3300049823 Bacteria 952
208 nmdc:mga00v17_232859_c1 3300050491 Bacteria 1194
209 nmdc:mga05p37_139096_c1 3300050507 Bacteria 1946
210 nmdc:mga05p37_9090_c1 3300050507 Bacteria 11744
211 nmdc:mga09592_43163_c1 3300050508 Bacteria 3795
212 nmdc:mga0qj67_480701_c1 3300050509 Bacteria 999
213 nmdc:mga0qj67_6185_c1 3300050509 Bacteria 8782
214 nmdc:mga06r32_121734_c1 3300050510 Unclassified 2574
215 nmdc:mga06r32_13789_c1 3300050510 Bacteria 7331
216 nmdc:mga0n895_80115_c1 3300050512 Bacteria 3253
217 nmdc:mga0rr50_203399_c1 3300050513 Bacteria 1628
218 nmdc:mga0a205_251977_c1 3300050515 Bacteria 1645
219 nmdc:mga0sz30_22533_c1 3300050516 Bacteria 2557
220 Ga0495601_0000023 3300053077 Bacteria 140141
221 Ga0495612_0000005 3300053078 Bacteria 286943
222 Ga0495655_0070666 3300053083 Bacteria 975
223 Ga0495595_0000013 3300053084 Bacteria 160811
224 Ga0495619_0000003 3300053085 Bacteria 515784
225 Ga0500593_004429 3300053117 Bacteria 5436
226 Ga0500577_0092911 3300053142 Bacteria 1222
227 Ga0500616_0032397 3300053153 Bacteria 2858
228 Ga0500636_0002393 3300053177 Bacteria 10380
229 Ga0501084_0067377 3300054114 Bacteria 2996
230 Ga0501082_0135972 3300060353 Bacteria 2133
231 Ga0501082_0176561 3300060353 Bacteria 1857
232 2524538877 2524023228 Bacteria 10118060
233 2535518403 2534681796 Bacteria 7146037
234 2595452556 2593339239 Bacteria 4124669
235 2643757734 2643221547 Bacteria 4740017
236 2644541062 2643221698 Bacteria 7756764
237 2758638667 2758568016 Bacteria 5645291
238 2842721611 2842718218 Bacteria 4560148
239 2919405819 2919404418 Bacteria 4232372
240 2929143973 2929138655 Bacteria 5810547
241 3005478001 3005474847 Bacteria 9259049
242 8005549314 8005542996 Bacteria 7077758
243 Ga0075430_100283121
244 JGI25159J45721_1019930
245 JGI25151J46595_10062554
246 JGI25165J46597_1024596
247 rootH2_10094902
248 rootL2_10024727
249 rootL2_10245323
250 rootH1_10058138
251 Ga0055526_1004609
252 Ga0055526_1007969
253 Ga0055524_1002446
254 Ga0055536_1014452
255 Ga0055534_1000365
256 Ga0055528_1000096
257 Ga0055540_1039665
258 Ga0055531_10060850
259 Ga0065165_1045450
260 Ga0065165_1052720
261 Ga0070658_10192958
262 Ga0070680_100777252
263 Ga0070668_100279183
264 Ga0070674_100106025
265 Ga0070714_100654091
266 Ga0070710_10765236
267 Ga0070678_100622117
268 Ga0070685_10417175
269 Ga0070679_100039816
270 Ga0070679_100171702
271 Ga0070704_100017657
272 Ga0068852_100673192
273 Ga0081455_10078436
274 Ga0081538_10060754
275 Ga0075367_10250515
276 Ga0075369_10006478
277 Ga0075428_100002298
278 Ga0075430_100004650
279 Ga0075431_100006526
280 Ga0075431_100170703
281 Ga0075433_10043413
282 Ga0075434_100033773
283 Ga0075429_100005061
284 Ga0075429_100177506
285 Ga0068865_101070850
286 Ga0075435_100254538
287 Ga0099795_10023264
288 Ga0114129_10006716
289 Ga0114129_10220236
290 Ga0105243_10229278
291 Ga0099796_10014632
292 Ga0157378_11330471
293 Ga0157380_10547758
294 Ga0182005_1030381
295 Ga0183369_1003
296 Ga0213876_10306890
297 Ga0209129_1002061
298 Ga0209233_1015261
299 Ga0209673_1000252
300 Ga0209673_1000594
301 Ga0209673_1036493
302 Ga0209130_1005844
303 Ga0209675_1000842
304 Ga0209676_1008770
305 Ga0209676_1032820
306 Ga0209025_1003140
307 Ga0209564_1000306
308 Ga0209564_1003649
309 Ga0209564_1065015
310 Ga0209050_1033222
311 Ga0209050_1043417
312 Ga0209256_1000246
313 Ga0209256_1000786
314 Ga0209051_1020647
315 Ga0209257_1006708
316 Ga0209257_1080946
317 Ga0207705_10101754
318 Ga0207660_10188668
319 Ga0207652_10028688
320 Ga0207669_10100192
321 Ga0207704_10330097
322 Ga0207668_10261622
323 Ga0207683_10436798
324 Ga0268266_10226953
325 Ga0265316_10272516
326 Ga0265313_10225854
327 Ga0307405_10000774
328 Ga0307413_10007832
329 Ga0373950_0003277
330 Ga0373944_0067395
331 Ga0373923_0000773
332 Ga0373936_0000999
333 Ga0373945_0009370
334 Ga0373945_0010747
335 Ga0373954_0001342
336 Ga0373957_0016263
337 Ga0373943_0015319
338 Ga0373943_0057108
339 Ga0373946_0015197
340 Ga0373946_0240805
341 Ga0373955_0000837
342 Ga0373924_0023591
343 Ga0373935_0003048
344 Ga0373935_0032178
345 Ga0373927_0033392
346 Ga0373927_0034460
347 Ga0373933_0067839
348 Ga0373947_0000090
349 Ga0373947_0058969
350 Ga0373937_0000007
351 Ga0373925_0000011
352 Ga0373925_0035628
353 Ga0373925_0294981
354 Ga0436365_0508693
355 Ga0436363_1251163
356 Ga0495592_0000067
357 Ga0495603_0013919
358 Ga0495629_0007242
359 Ga0495641_0050086
360 Ga0495651_0003012
361 Ga0495653_0000070
362 Ga0495582_0050452
363 Ga0495639_0131270
364 Ga0495662_0002368
365 Ga0495664_0000019
366 Ga0495584_0019223
367 Ga0495594_0201830
368 Ga0495608_0000026
369 Ga0495618_0000015
370 Ga0495628_0000006
371 Ga0495630_0001772
372 Ga0495663_0126988
373 Ga0495666_0049865
374 Ga0495652_0000030
375 Ga0495640_0000013
376 Ga0495587_0000021
377 Ga0495621_0046114
378 Ga0495645_0000001
379 Ga0495633_0102585
380 Ga0495667_0000027
381 Ga0495656_0132538
382 Ga0495656_0362385
383 Ga0495634_0000008
384 Ga0495635_0000028
385 Ga0495588_0070831
386 Ga0495657_0000144
387 Ga0495599_0000014
388 Ga0495623_0000006
389 Ga0495646_0000026
390 Ga0495647_0008460
391 Ga0495658_0026978
392 Ga0495658_0071859
393 Ga0495613_0039584
394 Ga0495624_0056270
395 Ga0495624_0120617
396 Ga0495600_0000005
397 Ga0495604_0000002
398 Ga0495674_0000004
399 Ga0495676_0025562
400 Ga0495676_0425722
401 Ga0495680_0082269
402 Ga0495675_0000114
403 Ga0495684_0000004
404 Ga0495593_0001974
405 Ga0495602_0000001
406 Ga0496101_0225277
407 Ga0496104_0004694
408 Ga0496104_0008153
409 Ga0496105_0009998
410 Ga0496105_0016942
411 Ga0496105_0781398
412 Ga0496106_0426024
413 Ga0496108_0103888
414 Ga0496109_0367232
415 Ga0496110_0072877
416 Ga0496114_0509792
417 Ga0496115_0276850
418 Ga0496116_0045508
419 Ga0496116_0066487
420 Ga0496117_0002133
421 Ga0496117_0011480
422 Ga0496119_0004381
423 Ga0496120_0099694
424 Ga0496121_0160008
425 Ga0496122_0098440
426 Ga0496122_0149561
427 Ga0496123_0083411
428 Ga0496124_0002512
429 Ga0496124_0182054
430 Ga0496125_0157446
431 Ga0496126_0009897
432 Ga0496126_0172974
433 Ga0496126_0403886
434 Ga0501033_0176060
435 Ga0501034_0061634
436 Ga0501038_0422590
437 Ga0501043_0048435
438 Ga0501047_0088577
439 Ga0501047_0337505
440 Ga0501070_0322497
441 Ga0501072_0006733
442 Ga0501075_0479845
443 Ga0501035_0075549
444 Ga0501035_0167088
445 Ga0501035_0581610
446 Ga0501035_0648324
447 Ga0501044_0019547
448 Ga0501044_0141423
449 Ga0501044_0641359
450 nmdc:mga00v17_232859_c1
451 nmdc:mga05p37_139096_c1
452 nmdc:mga05p37_9090_c1
453 nmdc:mga09592_43163_c1
454 nmdc:mga0qj67_480701_c1
455 nmdc:mga0qj67_6185_c1
456 nmdc:mga06r32_121734_c1
457 nmdc:mga06r32_13789_c1
458 nmdc:mga0n895_80115_c1
459 nmdc:mga0rr50_203399_c1
460 nmdc:mga0a205_251977_c1
461 nmdc:mga0sz30_22533_c1
462 Ga0495601_0000023
463 Ga0495612_0000005
464 Ga0495655_0070666
465 Ga0495595_0000013
466 Ga0495619_0000003
467 Ga0500593_004429
468 Ga0500577_0092911
469 Ga0500616_0032397
470 Ga0500636_0002393
471 Ga0501084_0067377
472 Ga0501082_0135972
473 Ga0501082_0176561
474 2524538877
475 2535518403
476 2595452556
477 2643757734
478 2644541062
479 2758638667
480 2842721611
481 2919405819
482 2929143973
483 3005478001
484 8005549314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

38

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mji-assembly1.cif.gz_A crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) 0.8924 1 200
5mji-assembly1.cif.gz_A crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) 0.8674 1 200
1rli-assembly1.cif.gz_B the structure of trp repressor binding protein from bacillus subtilis 0.8178 4 184
6dqo-assembly1.cif.gz_A-2 crystal structure of ssue fmn reductase y118a mutant in fmn bound form. 0.8053 2 192
6dqo-assembly1.cif.gz_A-2 crystal structure of ssue fmn reductase y118a mutant in fmn bound form. 0.7968 2 192
ID Description Score Start End Superfamily
af_I6Y946_20_176_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9374 5 159 3.40.50.360
af_I6Y946_20_176_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.92 5 159 3.40.50.360
1e5dB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.826 3 190 3.40.50.360
1rliB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8178 4 184 3.40.50.360
5ljiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8173 3 190 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A7W5TYZ6-F1-model_v4 deleted 0.9843 1 205
AF-A0A256G8S5-F1-model_v4 NADPH-dependent FMN reductase family protein 0.9821 2 202 GO:0016491
AF-A0A1T4SGK9-F1-model_v4 Multimeric flavodoxin WrbA 0.9807 2 202 GO:0016491
AF-A0A1Q4BHD3-F1-model_v4 NADPH-dependent oxidoreductase 0.9792 2 205 GO:0016491
AF-A0A1H8KQE9-F1-model_v4 NADPH-dependent FMN reductase 0.9781 2 104 GO:0016491

Map