F354660

General Info

Members Datasets Scaffolds Average Seq Length
242 173 242 107

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10000289|Ga0157370_1000028945
Length 110
Sequence MKLRDETDLLFKALADPTRRQLLDQLHSHDGRTLSQLCKQLEMTRQGVTQHLLLLETANLVVTMWQGREKLHYLNPVPLQEIYERWIAKFEKSRLKAMSDLKKRLENPDA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 15.7
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10288956 3300005327 Bacteria 1397
2 Ga0070670_100121991 3300005331 Bacteria 2248
3 Ga0070682_100000026 3300005337 Bacteria 191388
4 Ga0068868_100099440 3300005338 Bacteria 2353
5 Ga0070689_100160109 3300005340 Bacteria 1819
6 Ga0070661_100000004 3300005344 Bacteria 243876
7 Ga0070668_100722590 3300005347 Bacteria 880
8 Ga0070668_101030042 3300005347 Bacteria 741
9 Ga0070671_100064982 3300005355 Bacteria 3039
10 Ga0070671_101298898 3300005355 Bacteria 642
11 Ga0070688_100008881 3300005365 Bacteria 5470
12 Ga0070713_100000005 3300005436 Bacteria 201526
13 Ga0070708_100452030 3300005445 Bacteria 1212
14 Ga0070685_10149456 3300005466 Bacteria 1479
15 Ga0070707_100625858 3300005468 Bacteria 1039
16 Ga0070698_100435735 3300005471 Bacteria 1246
17 Ga0070679_101817497 3300005530 Bacteria 558
18 Ga0070679_101818080 3300005530 Bacteria 558
19 Ga0068853_100102061 3300005539 Bacteria 2538
20 Ga0070672_100000049 3300005543 Bacteria 52233
21 Ga0070665_100507198 3300005548 Bacteria 1218
22 Ga0070665_102271345 3300005548 Bacteria 546
23 Ga0070704_100469709 3300005549 Bacteria 1087
24 Ga0068857_100261121 3300005577 Bacteria 1589
25 Ga0068857_101146458 3300005577 Bacteria 752
26 Ga0068854_100000062 3300005578 Bacteria 78159
27 Ga0068856_100001736 3300005614 Bacteria 22788
28 Ga0068856_100112062 3300005614 Bacteria 2726
29 Ga0068852_100000022 3300005616 Bacteria 125196
30 Ga0068859_102058984 3300005617 Bacteria 630
31 Ga0068861_100053077 3300005719 Bacteria 3083
32 Ga0068863_101439868 3300005841 Bacteria 697
33 Ga0068860_100441357 3300005843 Bacteria 1293
34 Ga0068862_101666210 3300005844 Bacteria 646
35 Ga0081455_10863039 3300005937 Bacteria 565
36 Ga0081540_1011559 3300005983 Bacteria 5896
37 Ga0081539_10000808 3300005985 Bacteria 60799
38 Ga0075365_10366830 3300006038 Bacteria 1015
39 Ga0070715_10037298 3300006163 Bacteria 2011
40 Ga0075362_10192624 3300006177 Bacteria 990
41 Ga0075366_10102601 3300006195 Bacteria 1717
42 Ga0075433_10419483 3300006852 Bacteria 1180
43 Ga0075434_100035594 3300006871 Bacteria 4923
44 Ga0075434_100216619 3300006871 Bacteria 1935
45 Ga0075434_100794532 3300006871 Bacteria 963
46 Ga0075434_102279263 3300006871 Bacteria 545
47 Ga0097620_102059479 3300006931 Bacteria 630
48 Ga0075435_100078722 3300007076 Bacteria 2704
49 Ga0111539_11221249 3300009094 Bacteria 873
50 Ga0111539_12874760 3300009094 Bacteria 557
51 Ga0105245_10000023 3300009098 Bacteria 180844
52 Ga0105245_10002542 3300009098 Bacteria 16442
53 Ga0105247_10486821 3300009101 Bacteria 896
54 Ga0114129_10801676 3300009147 Bacteria 1201
55 Ga0105243_10204046 3300009148 Bacteria 1736
56 Ga0105242_10173823 3300009176 Bacteria 1895
57 Ga0105242_10582326 3300009176 Bacteria 1078
58 Ga0105248_10092094 3300009177 Bacteria 3414
59 Ga0105248_10172145 3300009177 Bacteria 2440
60 Ga0105248_12676213 3300009177 Bacteria 569
61 Ga0105249_10554566 3300009553 Bacteria 1200
62 Ga0105249_11397930 3300009553 Bacteria 772
63 Ga0105249_11811649 3300009553 Bacteria 683
64 Ga0105249_12195716 3300009553 Bacteria 625
65 Ga0105249_13190750 3300009553 Unclassified 527
66 Ga0105239_10192464 3300010375 Bacteria 2283
67 Ga0105246_10578211 3300011119 Bacteria 967
68 Ga0157335_1016684 3300012492 Bacteria 658
69 Ga0157371_10003324 3300013102 Bacteria 14691
70 Ga0157370_10000289 3300013104 Bacteria 63849
71 Ga0157374_10980014 3300013296 Bacteria 864
72 Ga0157378_11072153 3300013297 Bacteria 842
73 Ga0163162_10456522 3300013306 Bacteria 1409
74 Ga0157372_10001763 3300013307 Bacteria 23465
75 Ga0157372_12632965 3300013307 Bacteria 577
76 Ga0157375_10004083 3300013308 Bacteria 12657
77 Ga0157375_10889886 3300013308 Bacteria 1035
78 Ga0163163_11434855 3300014325 Bacteria 752
79 Ga0163163_11585401 3300014325 Bacteria 716
80 Ga0157380_11411378 3300014326 Bacteria 747
81 Ga0182008_10092738 3300014497 Bacteria 1490
82 Ga0157379_10151619 3300014968 Bacteria 2091
83 Ga0157379_11588985 3300014968 Bacteria 638
84 Ga0207685_10028817 3300025905 Bacteria 1959
85 Ga0207705_10312757 3300025909 Bacteria 1206
86 Ga0207693_11406861 3300025915 Bacteria 518
87 Ga0207649_10000003 3300025920 Bacteria 388908
88 Ga0207646_11015993 3300025922 Bacteria 732
89 Ga0207650_10261425 3300025925 Bacteria 1404
90 Ga0207659_10294609 3300025926 Bacteria 1330
91 Ga0207659_11089369 3300025926 Bacteria 687
92 Ga0207687_10000015 3300025927 Bacteria 261701
93 Ga0207687_10002068 3300025927 Bacteria 13737
94 Ga0207700_10000003 3300025928 Bacteria 500797
95 Ga0207644_10981199 3300025931 Bacteria 709
96 Ga0207690_10025608 3300025932 Bacteria 3707
97 Ga0207709_10245672 3300025935 Bacteria 1304
98 Ga0207670_10132845 3300025936 Bacteria 1826
99 Ga0207691_10000002 3300025940 Bacteria 189785
100 Ga0207711_10135945 3300025941 Bacteria 2208
101 Ga0207711_11331199 3300025941 Bacteria 660
102 Ga0207711_11480467 3300025941 Bacteria 622
103 Ga0207640_10000074 3300025981 Bacteria 78164
104 Ga0207677_10003597 3300026023 Bacteria 8214
105 Ga0207703_10444904 3300026035 Bacteria 1209
106 Ga0207678_10679253 3300026067 Bacteria 906
107 Ga0207702_10000337 3300026078 Bacteria 53931
108 Ga0207702_10622358 3300026078 Bacteria 1060
109 Ga0207641_11408535 3300026088 Bacteria 698
110 Ga0207674_10273375 3300026116 Bacteria 1637
111 Ga0207674_10441977 3300026116 Bacteria 1257
112 Ga0207675_100077592 3300026118 Bacteria 3112
113 Ga0207698_10000043 3300026142 Bacteria 96553
114 Ga0207428_10670149 3300027907 Bacteria 743
115 Ga0268265_11459539 3300028380 Bacteria 687
116 Ga0268264_10263010 3300028381 Bacteria 1608
117 Ga0265326_10026867 3300028558 Bacteria 1641
118 Ga0265334_10010943 3300028573 Bacteria 3827
119 Ga0265338_10011382 3300028800 Bacteria 10286
120 Ga0265338_10098758 3300028800 Bacteria 2387
121 Ga0265332_10344787 3300031238 Bacteria 615
122 Ga0265325_10080698 3300031241 Bacteria 1617
123 Ga0265340_10050027 3300031247 Bacteria 2028
124 Ga0265339_10066688 3300031249 Bacteria 1927
125 Ga0265331_10227303 3300031250 Bacteria 838
126 Ga0265313_10220363 3300031595 Bacteria 783
127 Ga0316575_10130054 3300031665 Bacteria 1033
128 Ga0265314_10239423 3300031711 Bacteria 1048
129 Ga0265314_10370954 3300031711 Bacteria 782
130 Ga0265342_10031464 3300031712 Bacteria 3280
131 Ga0373952_0103166 3300035092 Bacteria 755
132 Ga0373931_0511163 3300035691 Bacteria 776
133 Ga0373931_0961545 3300035691 Bacteria 576
134 Ga0436365_0587030 3300039437 Bacteria 1240
135 Ga0436360_0473700 3300039438 Bacteria 666
136 Ga0451804_0303561 3300041463 Bacteria 668
137 Ga0451843_0279297 3300041509 Bacteria 507
138 Ga0466963_0145465 3300044694 Bacteria 1644
139 Ga0466957_0094410 3300044842 Bacteria 1878
140 Ga0466957_0095562 3300044842 Bacteria 1866
141 Ga0466958_0031644 3300045836 Bacteria 3145
142 Ga0466958_0174473 3300045836 Bacteria 1362
143 Ga0466967_1220552 3300045976 Bacteria 749
144 Ga0466967_1764776 3300045976 Bacteria 616
145 Ga0495641_0127370 3300046461 Bacteria 1136
146 Ga0495639_0112994 3300046475 Bacteria 1290
147 Ga0495662_0078968 3300046476 Bacteria 1599
148 Ga0495585_0574931 3300046492 Bacteria 531
149 Ga0495594_0195419 3300046499 Bacteria 1153
150 Ga0495608_0000035 3300046511 Bacteria 133011
151 Ga0495616_0239688 3300046513 Bacteria 783
152 Ga0495630_0000034 3300046517 Bacteria 126055
153 Ga0495630_0037598 3300046517 Bacteria 3620
154 Ga0495631_0115942 3300046518 Bacteria 1152
155 Ga0495637_0130164 3300046520 Bacteria 962
156 Ga0495640_0671824 3300046533 Bacteria 623
157 Ga0495622_0000447 3300046557 Bacteria 26627
158 Ga0495656_0058423 3300046615 Bacteria 1674
159 Ga0495625_0000213 3300046660 Bacteria 91768
160 Ga0495625_0013891 3300046660 Bacteria 6449
161 Ga0495661_0235738 3300046665 Bacteria 941
162 Ga0495657_0000026 3300046675 Bacteria 133011
163 Ga0495647_0000079 3300046681 Bacteria 23665
164 Ga0495658_0996356 3300046683 Bacteria 535
165 Ga0495613_0000027 3300046689 Bacteria 146674
166 Ga0495600_0097717 3300046809 Bacteria 1914
167 Ga0495674_0000010 3300047319 Bacteria 285794
168 Ga0495674_0251638 3300047319 Bacteria 1454
169 Ga0495672_0244560 3300047320 Bacteria 874
170 Ga0495676_0243128 3300047321 Bacteria 1231
171 Ga0495675_0000015 3300047444 Bacteria 133004
172 Ga0495602_0000393 3300048088 Bacteria 40803
173 Ga0496100_1315057 3300048903 Bacteria 570
174 Ga0496101_0241203 3300048904 Bacteria 1407
175 Ga0496102_0013695 3300048905 Bacteria 7031
176 Ga0496102_0438812 3300048905 Bacteria 1225
177 Ga0496103_0201724 3300048906 Bacteria 1279
178 Ga0496103_0538484 3300048906 Bacteria 746
179 Ga0496103_0696790 3300048906 Bacteria 644
180 Ga0496104_0018264 3300048907 Bacteria 6398
181 Ga0496104_0238758 3300048907 Bacteria 1729
182 Ga0496105_0020139 3300048908 Bacteria 5387
183 Ga0496106_0107125 3300048909 Bacteria 2173
184 Ga0496106_0225277 3300048909 Bacteria 1496
185 Ga0496106_0425639 3300048909 Bacteria 1067
186 Ga0496108_0000005 3300048911 Bacteria 535059
187 Ga0496108_0223945 3300048911 Bacteria 1634
188 Ga0496108_0297148 3300048911 Bacteria 1406
189 Ga0496109_0000002 3300048912 Bacteria 443393
190 Ga0496109_0000066 3300048912 Bacteria 112004
191 Ga0496109_0029056 3300048912 Bacteria 4949
192 Ga0496109_0564827 3300048912 Bacteria 1073
193 Ga0496109_0842440 3300048912 Bacteria 855
194 Ga0496110_0000235 3300048913 Bacteria 35772
195 Ga0496110_0036868 3300048913 Bacteria 4248
196 Ga0496110_0550043 3300048913 Bacteria 1049
197 Ga0496110_0789024 3300048913 Bacteria 854
198 Ga0496110_1452851 3300048913 Bacteria 595
199 Ga0496111_0000011 3300048914 Bacteria 88409
200 Ga0496111_0006051 3300048914 Bacteria 7817
201 Ga0496111_0018457 3300048914 Bacteria 4834
202 Ga0496112_0361676 3300048915 Bacteria 1393
203 Ga0496112_0467866 3300048915 Bacteria 1198
204 Ga0496113_0061363 3300048916 Bacteria 2837
205 Ga0496113_0141830 3300048916 Bacteria 1891
206 Ga0496114_0071641 3300048917 Bacteria 2913
207 Ga0496114_0122362 3300048917 Bacteria 2239
208 Ga0496115_0000031 3300048918 Bacteria 138258
209 Ga0496115_1039450 3300048918 Bacteria 624
210 Ga0496118_0354317 3300048921 Bacteria 781
211 Ga0496126_0263121 3300048929 Bacteria 1433
212 Ga0496126_0810386 3300048929 Bacteria 717
213 Ga0501077_0172802 3300049593 Bacteria 1373
214 Ga0501083_0561842 3300049744 Bacteria 742
215 Ga0501035_1460058 3300049822 Bacteria 523
216 nmdc:mga03n38_946311_c1 3300050490 Bacteria 508
217 nmdc:mga0yw44_176919_c1 3300050492 Bacteria 1403
218 nmdc:mga0yw44_401660_c1 3300050492 Bacteria 927
219 nmdc:mga0k408_326865_c1 3300050493 Bacteria 915
220 nmdc:mga06z11_787985_c1 3300050494 Bacteria 579
221 nmdc:mga08y16_338932_c1 3300050511 Bacteria 1546
222 nmdc:mga0n895_1573500_c1 3300050512 Bacteria 622
223 nmdc:mga0n895_391283_c2 3300050512 Bacteria 827
224 nmdc:mga0n895_51264_c1 3300050512 Bacteria 4048
225 nmdc:mga0rr50_111610_c1 3300050513 Bacteria 2164
226 nmdc:mga08x19_652895_c1 3300050514 Bacteria 746
227 nmdc:mga0a205_305307_c1 3300050515 Bacteria 1464
228 nmdc:mga0a205_430873_c1 3300050515 Bacteria 1180
229 nmdc:mga0sz30_283180_c1 3300050516 Bacteria 739
230 Ga0495601_0000017 3300053077 Bacteria 204209
231 Ga0495655_0018049 3300053083 Bacteria 1545
232 Ga0495595_0000017 3300053084 Bacteria 133011
233 Ga0495595_0001757 3300053084 Bacteria 8468
234 Ga0495619_0000054 3300053085 Bacteria 97928
235 Ga0495619_0000101 3300053085 Bacteria 64377
236 Ga0500641_0163758 3300053096 Bacteria 958
237 Ga0500611_091654 3300053727 Bacteria 774
238 Ga0501084_0188173 3300054114 Bacteria 1742
239 Ga0501084_0340679 3300054114 Bacteria 1266
240 Ga0501084_1114823 3300054114 Bacteria 662
241 Ga0501082_0401864 3300060353 Bacteria 1196
242 Ga0501082_0774602 3300060353 Bacteria 839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0145465 Ga0466963_0145465_805_1131 101
2 3300044842 Ga0466957_0094410 Ga0466957_0094410_721_1047 101
3 3300045836 Ga0466958_0174473 Ga0466958_0174473_515_841 101
4 3300045976 Ga0466967_1220552 Ga0466967_1220552_235_561 101
5 3300014497 Ga0182008_10092738 Ga0182008_100927382 102
6 3300050492 nmdc:mga0yw44_176919_c1 nmdc:mga0yw44_176919_c1_234_572 102
7 3300005530 Ga0070679_101817497 Ga0070679_1018174972 103
8 3300005548 Ga0070665_100507198 Ga0070665_1005071982 103
9 3300005983 Ga0081540_1011559 Ga0081540_10115596 103
10 3300009176 Ga0105242_10582326 Ga0105242_105823261 103
11 3300014326 Ga0157380_11411378 Ga0157380_114113782 103
12 3300046511 Ga0495608_0000035 Ga0495608_0000035_110561_110884 103
13 3300046675 Ga0495657_0000026 Ga0495657_0000026_22128_22451 103
14 3300047444 Ga0495675_0000015 Ga0495675_0000015_22121_22444 103
15 3300053084 Ga0495595_0000017 Ga0495595_0000017_22128_22451 103
16 3300053085 Ga0495619_0000101 Ga0495619_0000101_22128_22451 103
17 3300005347 Ga0070668_100722590 Ga0070668_1007225902 104
18 3300005355 Ga0070671_100064982 Ga0070671_1000649824 104
19 3300005578 Ga0068854_100000062 Ga0068854_10000006270 104
20 3300005617 Ga0068859_102058984 Ga0068859_1020589842 104
21 3300005719 Ga0068861_100053077 Ga0068861_1000530773 104
22 3300005841 Ga0068863_101439868 Ga0068863_1014398682 104
23 3300005843 Ga0068860_100441357 Ga0068860_1004413572 104
24 3300006038 Ga0075365_10366830 Ga0075365_103668301 104
25 3300006177 Ga0075362_10192624 Ga0075362_101926243 104
26 3300006195 Ga0075366_10102601 Ga0075366_101026013 104
27 3300006852 Ga0075433_10419483 Ga0075433_104194832 104
28 3300006871 Ga0075434_100216619 Ga0075434_1002166193 104
29 3300006931 Ga0097620_102059479 Ga0097620_1020594792 104
30 3300007076 Ga0075435_100078722 Ga0075435_1000787223 104
31 3300009094 Ga0111539_11221249 Ga0111539_112212493 104
32 3300009553 Ga0105249_12195716 Ga0105249_121957162 104
33 3300009553 Ga0105249_13190750 Ga0105249_131907501 104
34 3300013104 Ga0157370_10000289 Ga0157370_1000028945 104
35 3300013308 Ga0157375_10004083 Ga0157375_100040837 104
36 3300014325 Ga0163163_11585401 Ga0163163_115854011 104
37 3300014968 Ga0157379_10151619 Ga0157379_101516193 104
38 3300025941 Ga0207711_11480467 Ga0207711_114804671 104
39 3300025981 Ga0207640_10000074 Ga0207640_1000007469 104
40 3300026035 Ga0207703_10444904 Ga0207703_104449041 104
41 3300026067 Ga0207678_10679253 Ga0207678_106792532 104
42 3300026088 Ga0207641_11408535 Ga0207641_114085352 104
43 3300026118 Ga0207675_100077592 Ga0207675_1000775923 104
44 3300027907 Ga0207428_10670149 Ga0207428_106701492 104
45 3300028380 Ga0268265_11459539 Ga0268265_114595391 104
46 3300028381 Ga0268264_10263010 Ga0268264_102630102 104
47 3300031238 Ga0265332_10344787 Ga0265332_103447871 104
48 3300031241 Ga0265325_10080698 Ga0265325_100806981 104
49 3300031247 Ga0265340_10050027 Ga0265340_100500273 104
50 3300031249 Ga0265339_10066688 Ga0265339_100666884 104
51 3300031595 Ga0265313_10220363 Ga0265313_102203632 104
52 3300031665 Ga0316575_10130054 Ga0316575_101300542 104
53 3300031711 Ga0265314_10239423 Ga0265314_102394232 104
54 3300031711 Ga0265314_10370954 Ga0265314_103709542 104
55 3300031712 Ga0265342_10031464 Ga0265342_100314644 104
56 3300035691 Ga0373931_0511163 Ga0373931_0511163_205_525 104
57 3300041463 Ga0451804_0303561 Ga0451804_0303561_69_383 104
58 3300041509 Ga0451843_0279297 Ga0451843_0279297_163_477 104
59 3300046475 Ga0495639_0112994 Ga0495639_0112994_462_776 104
60 3300046476 Ga0495662_0078968 Ga0495662_0078968_1185_1499 104
61 3300046513 Ga0495616_0239688 Ga0495616_0239688_37_357 104
62 3300046517 Ga0495630_0037598 Ga0495630_0037598_3262_3588 104
63 3300046520 Ga0495637_0130164 Ga0495637_0130164_372_692 104
64 3300046533 Ga0495640_0671824 Ga0495640_0671824_152_466 104
65 3300046557 Ga0495622_0000447 Ga0495622_0000447_15597_15911 104
66 3300046660 Ga0495625_0000213 Ga0495625_0000213_17233_17547 104
67 3300046660 Ga0495625_0013891 Ga0495625_0013891_3646_3966 104
68 3300047319 Ga0495674_0000010 Ga0495674_0000010_244917_245231 104
69 3300047319 Ga0495674_0251638 Ga0495674_0251638_613_939 104
70 3300048905 Ga0496102_0438812 Ga0496102_0438812_637_951 104
71 3300048906 Ga0496103_0538484 Ga0496103_0538484_325_639 104
72 3300048912 Ga0496109_0842440 Ga0496109_0842440_368_682 104
73 3300048913 Ga0496110_0789024 Ga0496110_0789024_145_465 104
74 3300048918 Ga0496115_1039450 Ga0496115_1039450_288_605 104
75 3300048921 Ga0496118_0354317 Ga0496118_0354317_422_736 104
76 3300048929 Ga0496126_0263121 Ga0496126_0263121_1089_1406 104
77 3300048929 Ga0496126_0810386 Ga0496126_0810386_124_441 104
78 3300049822 Ga0501035_1460058 Ga0501035_1460058_146_460 104
79 3300050490 nmdc:mga03n38_946311_c1 nmdc:mga03n38_946311_c1_141_461 104
80 3300050492 nmdc:mga0yw44_401660_c1 nmdc:mga0yw44_401660_c1_152_472 104
81 3300050493 nmdc:mga0k408_326865_c1 nmdc:mga0k408_326865_c1_241_561 104
82 3300050511 nmdc:mga08y16_338932_c1 nmdc:mga08y16_338932_c1_394_708 104
83 3300050512 nmdc:mga0n895_1573500_c1 nmdc:mga0n895_1573500_c1_287_610 104
84 3300050512 nmdc:mga0n895_51264_c1 nmdc:mga0n895_51264_c1_732_1046 104
85 3300050513 nmdc:mga0rr50_111610_c1 nmdc:mga0rr50_111610_c1_1164_1478 104
86 3300050515 nmdc:mga0a205_430873_c1 nmdc:mga0a205_430873_c1_281_595 104
87 3300050516 nmdc:mga0sz30_283180_c1 nmdc:mga0sz30_283180_c1_381_701 104
88 3300053096 Ga0500641_0163758 Ga0500641_0163758_17_331 104
89 3300053727 Ga0500611_091654 Ga0500611_091654_349_669 104
90 3300005331 Ga0070670_100121991 Ga0070670_1001219913 105
91 3300005340 Ga0070689_100160109 Ga0070689_1001601094 105
92 3300005347 Ga0070668_101030042 Ga0070668_1010300421 105
93 3300005355 Ga0070671_101298898 Ga0070671_1012988981 105
94 3300005365 Ga0070688_100008881 Ga0070688_1000088815 105
95 3300005445 Ga0070708_100452030 Ga0070708_1004520302 105
96 3300005466 Ga0070685_10149456 Ga0070685_101494562 105
97 3300005468 Ga0070707_100625858 Ga0070707_1006258582 105
98 3300005471 Ga0070698_100435735 Ga0070698_1004357352 105
99 3300005530 Ga0070679_101818080 Ga0070679_1018180802 105
100 3300005539 Ga0068853_100102061 Ga0068853_1001020614 105
101 3300005543 Ga0070672_100000049 Ga0070672_10000004953 105
102 3300005548 Ga0070665_102271345 Ga0070665_1022713451 105
103 3300005549 Ga0070704_100469709 Ga0070704_1004697092 105
104 3300005577 Ga0068857_101146458 Ga0068857_1011464582 105
105 3300005614 Ga0068856_100001736 Ga0068856_10000173612 105
106 3300005614 Ga0068856_100112062 Ga0068856_1001120624 105
107 3300005616 Ga0068852_100000022 Ga0068852_10000002257 105
108 3300005844 Ga0068862_101666210 Ga0068862_1016662102 105
109 3300005985 Ga0081539_10000808 Ga0081539_1000080857 105
110 3300006871 Ga0075434_100035594 Ga0075434_1000355945 105
111 3300006871 Ga0075434_100794532 Ga0075434_1007945322 105
112 3300006871 Ga0075434_102279263 Ga0075434_1022792632 105
113 3300009094 Ga0111539_12874760 Ga0111539_128747602 105
114 3300009098 Ga0105245_10000023 Ga0105245_1000002385 105
115 3300009101 Ga0105247_10486821 Ga0105247_104868212 105
116 3300009147 Ga0114129_10801676 Ga0114129_108016762 105
117 3300009148 Ga0105243_10204046 Ga0105243_102040462 105
118 3300009176 Ga0105242_10173823 Ga0105242_101738234 105
119 3300009177 Ga0105248_10092094 Ga0105248_100920943 105
120 3300009177 Ga0105248_12676213 Ga0105248_126762132 105
121 3300009553 Ga0105249_10554566 Ga0105249_105545662 105
122 3300009553 Ga0105249_11397930 Ga0105249_113979302 105
123 3300009553 Ga0105249_11811649 Ga0105249_118116492 105
124 3300010375 Ga0105239_10192464 Ga0105239_101924643 105
125 3300011119 Ga0105246_10578211 Ga0105246_105782112 105
126 3300012492 Ga0157335_1016684 Ga0157335_10166842 105
127 3300013102 Ga0157371_10003324 Ga0157371_100033249 105
128 3300013296 Ga0157374_10980014 Ga0157374_109800142 105
129 3300013297 Ga0157378_11072153 Ga0157378_110721532 105
130 3300013306 Ga0163162_10456522 Ga0163162_104565222 105
131 3300013307 Ga0157372_12632965 Ga0157372_126329652 105
132 3300014325 Ga0163163_11434855 Ga0163163_114348552 105
133 3300014968 Ga0157379_11588985 Ga0157379_115889851 105
134 3300025922 Ga0207646_11015993 Ga0207646_110159932 105
135 3300025925 Ga0207650_10261425 Ga0207650_102614251 105
136 3300025926 Ga0207659_10294609 Ga0207659_102946092 105
137 3300025926 Ga0207659_11089369 Ga0207659_110893692 105
138 3300025927 Ga0207687_10000015 Ga0207687_1000001597 105
139 3300025931 Ga0207644_10981199 Ga0207644_109811992 105
140 3300025935 Ga0207709_10245672 Ga0207709_102456722 105
141 3300025936 Ga0207670_10132845 Ga0207670_101328451 105
142 3300025940 Ga0207691_10000002 Ga0207691_1000000265 105
143 3300025941 Ga0207711_11331199 Ga0207711_113311991 105
144 3300026078 Ga0207702_10000337 Ga0207702_1000033725 105
145 3300026078 Ga0207702_10622358 Ga0207702_106223581 105
146 3300026116 Ga0207674_10273375 Ga0207674_102733752 105
147 3300026142 Ga0207698_10000043 Ga0207698_1000004366 105
148 3300028558 Ga0265326_10026867 Ga0265326_100268672 105
149 3300028573 Ga0265334_10010943 Ga0265334_100109433 105
150 3300028800 Ga0265338_10011382 Ga0265338_100113824 105
151 3300028800 Ga0265338_10098758 Ga0265338_100987582 105
152 3300031250 Ga0265331_10227303 Ga0265331_102273032 105
153 3300035092 Ga0373952_0103166 Ga0373952_0103166_193_543 105
154 3300035691 Ga0373931_0961545 Ga0373931_0961545_111_443 105
155 3300039437 Ga0436365_0587030 Ga0436365_0587030_93_416 105
156 3300039438 Ga0436360_0473700 Ga0436360_0473700_210_533 105
157 3300044842 Ga0466957_0095562 Ga0466957_0095562_1036_1353 105
158 3300045836 Ga0466958_0031644 Ga0466958_0031644_2340_2660 105
159 3300045976 Ga0466967_1764776 Ga0466967_1764776_49_372 105
160 3300046492 Ga0495585_0574931 Ga0495585_0574931_97_414 105
161 3300046499 Ga0495594_0195419 Ga0495594_0195419_80_400 105
162 3300046518 Ga0495631_0115942 Ga0495631_0115942_365_682 105
163 3300046615 Ga0495656_0058423 Ga0495656_0058423_369_689 105
164 3300046665 Ga0495661_0235738 Ga0495661_0235738_117_434 105
165 3300046683 Ga0495658_0996356 Ga0495658_0996356_124_444 105
166 3300048903 Ga0496100_1315057 Ga0496100_1315057_168_500 105
167 3300048904 Ga0496101_0241203 Ga0496101_0241203_1017_1337 105
168 3300048905 Ga0496102_0013695 Ga0496102_0013695_2317_2649 105
169 3300048906 Ga0496103_0201724 Ga0496103_0201724_16_348 105
170 3300048906 Ga0496103_0696790 Ga0496103_0696790_103_429 105
171 3300048907 Ga0496104_0238758 Ga0496104_0238758_1189_1521 105
172 3300048908 Ga0496105_0020139 Ga0496105_0020139_5002_5322 105
173 3300048909 Ga0496106_0107125 Ga0496106_0107125_324_656 105
174 3300048909 Ga0496106_0225277 Ga0496106_0225277_894_1247 105
175 3300048909 Ga0496106_0425639 Ga0496106_0425639_378_701 105
176 3300048911 Ga0496108_0000005 Ga0496108_0000005_245865_246182 105
177 3300048911 Ga0496108_0223945 Ga0496108_0223945_1081_1398 105
178 3300048911 Ga0496108_0297148 Ga0496108_0297148_268_600 105
179 3300048912 Ga0496109_0000002 Ga0496109_0000002_288910_289227 105
180 3300048912 Ga0496109_0000066 Ga0496109_0000066_88456_88773 105
181 3300048912 Ga0496109_0029056 Ga0496109_0029056_1532_1864 105
182 3300048912 Ga0496109_0564827 Ga0496109_0564827_125_478 105
183 3300048913 Ga0496110_0036868 Ga0496110_0036868_883_1215 105
184 3300048913 Ga0496110_0550043 Ga0496110_0550043_98_451 105
185 3300048913 Ga0496110_1452851 Ga0496110_1452851_128_445 105
186 3300048914 Ga0496111_0006051 Ga0496111_0006051_129_482 105
187 3300048914 Ga0496111_0018457 Ga0496111_0018457_3312_3644 105
188 3300048915 Ga0496112_0361676 Ga0496112_0361676_547_879 105
189 3300048915 Ga0496112_0467866 Ga0496112_0467866_430_747 105
190 3300048916 Ga0496113_0061363 Ga0496113_0061363_1728_2045 105
191 3300048916 Ga0496113_0141830 Ga0496113_0141830_368_700 105
192 3300048917 Ga0496114_0071641 Ga0496114_0071641_1462_1794 105
193 3300048917 Ga0496114_0122362 Ga0496114_0122362_210_530 105
194 3300048918 Ga0496115_0000031 Ga0496115_0000031_77357_77674 105
195 3300049593 Ga0501077_0172802 Ga0501077_0172802_297_614 105
196 3300049744 Ga0501083_0561842 Ga0501083_0561842_137_454 105
197 3300050494 nmdc:mga06z11_787985_c1 nmdc:mga06z11_787985_c1_83_409 105
198 3300050512 nmdc:mga0n895_391283_c2 nmdc:mga0n895_391283_c2_129_449 105
199 3300050514 nmdc:mga08x19_652895_c1 nmdc:mga08x19_652895_c1_151_477 105
200 3300050515 nmdc:mga0a205_305307_c1 nmdc:mga0a205_305307_c1_219_545 105
201 3300054114 Ga0501084_0188173 Ga0501084_0188173_767_1084 105
202 3300054114 Ga0501084_0340679 Ga0501084_0340679_700_1017 105
203 3300054114 Ga0501084_1114823 Ga0501084_1114823_37_354 105
204 3300060353 Ga0501082_0401864 Ga0501082_0401864_826_1146 105
205 3300060353 Ga0501082_0774602 Ga0501082_0774602_444_761 105
206 3300005327 Ga0070658_10288956 Ga0070658_102889562 106
207 3300005337 Ga0070682_100000026 Ga0070682_10000002615 106
208 3300005338 Ga0068868_100099440 Ga0068868_1000994403 106
209 3300005344 Ga0070661_100000004 Ga0070661_100000004102 106
210 3300005436 Ga0070713_100000005 Ga0070713_100000005122 106
211 3300005577 Ga0068857_100261121 Ga0068857_1002611212 106
212 3300005937 Ga0081455_10863039 Ga0081455_108630391 106
213 3300006163 Ga0070715_10037298 Ga0070715_100372984 106
214 3300009098 Ga0105245_10002542 Ga0105245_1000254215 106
215 3300009177 Ga0105248_10172145 Ga0105248_101721452 106
216 3300013307 Ga0157372_10001763 Ga0157372_1000176317 106
217 3300013308 Ga0157375_10889886 Ga0157375_108898861 106
218 3300025905 Ga0207685_10028817 Ga0207685_100288174 106
219 3300025909 Ga0207705_10312757 Ga0207705_103127572 106
220 3300025915 Ga0207693_11406861 Ga0207693_114068611 106
221 3300025920 Ga0207649_10000003 Ga0207649_10000003157 106
222 3300025927 Ga0207687_10002068 Ga0207687_100020686 106
223 3300025928 Ga0207700_10000003 Ga0207700_10000003312 106
224 3300025932 Ga0207690_10025608 Ga0207690_100256089 106
225 3300025941 Ga0207711_10135945 Ga0207711_101359453 106
226 3300026023 Ga0207677_10003597 Ga0207677_1000359712 106
227 3300026116 Ga0207674_10441977 Ga0207674_104419772 106
228 3300046461 Ga0495641_0127370 Ga0495641_0127370_589_909 106
229 3300046517 Ga0495630_0000034 Ga0495630_0000034_66691_67011 106
230 3300046681 Ga0495647_0000079 Ga0495647_0000079_8418_8738 106
231 3300046689 Ga0495613_0000027 Ga0495613_0000027_5646_5975 106
232 3300046809 Ga0495600_0097717 Ga0495600_0097717_972_1301 106
233 3300047320 Ga0495672_0244560 Ga0495672_0244560_63_386 106
234 3300047321 Ga0495676_0243128 Ga0495676_0243128_178_498 106
235 3300048088 Ga0495602_0000393 Ga0495602_0000393_32390_32719 106
236 3300048907 Ga0496104_0018264 Ga0496104_0018264_332_661 106
237 3300048913 Ga0496110_0000235 Ga0496110_0000235_28449_28778 106
238 3300048914 Ga0496111_0000011 Ga0496111_0000011_43692_44021 106
239 3300053077 Ga0495601_0000017 Ga0495601_0000017_128020_128349 106
240 3300053083 Ga0495655_0018049 Ga0495655_0018049_537_857 106
241 3300053084 Ga0495595_0001757 Ga0495595_0001757_6856_7185 106
242 3300053085 Ga0495619_0000054 Ga0495619_0000054_42375_42707 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

14

63

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

16

63

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9669 12 68
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9501 2 77
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9499 12 69
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9358 13 69
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.935 12 62
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9783 10 67 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9669 12 68 1.10.10.10
af_Q58721_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9624 2 68 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9596 6 69 1.10.10.10
af_Q58184_329_408_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 10 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A659UVB0-F1-model_v4 ArsR family transcriptional regulator 0.9926 1 73 GO:0003700
AF-A0A2I0N826-F1-model_v4 HTH arsR-type domain-containing protein 0.989 2 69 GO:0003700
AF-A0A538GBV1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9879 1 81 GO:0003700
AF-A0A7W0YU31-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9827 3 78 GO:0003700
AF-I8ZWU1-F1-model_v4 Putative transcriptional regulator 0.9785 2 85 GO:0003700

Feature Viewer

pLDDT pTM Quality
84.99 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map