F354660
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 173 | 242 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10000289|Ga0157370_1000028945 |
| Length | 110 |
| Sequence | MKLRDETDLLFKALADPTRRQLLDQLHSHDGRTLSQLCKQLEMTRQGVTQHLLLLETANLVVTMWQGREKLHYLNPVPLQEIYERWIAKFEKSRLKAMSDLKKRLENPDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 90 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 94 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 102 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 105 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 106 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 107 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 108 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 109 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 151 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 157 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 158 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 159 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 171 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 172 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 0 |
| Rhizoplane | 15.7 |
| Rhizosphere | 77.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10288956 | 3300005327 | Bacteria | 1397 |
| 2 | Ga0070670_100121991 | 3300005331 | Bacteria | 2248 |
| 3 | Ga0070682_100000026 | 3300005337 | Bacteria | 191388 |
| 4 | Ga0068868_100099440 | 3300005338 | Bacteria | 2353 |
| 5 | Ga0070689_100160109 | 3300005340 | Bacteria | 1819 |
| 6 | Ga0070661_100000004 | 3300005344 | Bacteria | 243876 |
| 7 | Ga0070668_100722590 | 3300005347 | Bacteria | 880 |
| 8 | Ga0070668_101030042 | 3300005347 | Bacteria | 741 |
| 9 | Ga0070671_100064982 | 3300005355 | Bacteria | 3039 |
| 10 | Ga0070671_101298898 | 3300005355 | Bacteria | 642 |
| 11 | Ga0070688_100008881 | 3300005365 | Bacteria | 5470 |
| 12 | Ga0070713_100000005 | 3300005436 | Bacteria | 201526 |
| 13 | Ga0070708_100452030 | 3300005445 | Bacteria | 1212 |
| 14 | Ga0070685_10149456 | 3300005466 | Bacteria | 1479 |
| 15 | Ga0070707_100625858 | 3300005468 | Bacteria | 1039 |
| 16 | Ga0070698_100435735 | 3300005471 | Bacteria | 1246 |
| 17 | Ga0070679_101817497 | 3300005530 | Bacteria | 558 |
| 18 | Ga0070679_101818080 | 3300005530 | Bacteria | 558 |
| 19 | Ga0068853_100102061 | 3300005539 | Bacteria | 2538 |
| 20 | Ga0070672_100000049 | 3300005543 | Bacteria | 52233 |
| 21 | Ga0070665_100507198 | 3300005548 | Bacteria | 1218 |
| 22 | Ga0070665_102271345 | 3300005548 | Bacteria | 546 |
| 23 | Ga0070704_100469709 | 3300005549 | Bacteria | 1087 |
| 24 | Ga0068857_100261121 | 3300005577 | Bacteria | 1589 |
| 25 | Ga0068857_101146458 | 3300005577 | Bacteria | 752 |
| 26 | Ga0068854_100000062 | 3300005578 | Bacteria | 78159 |
| 27 | Ga0068856_100001736 | 3300005614 | Bacteria | 22788 |
| 28 | Ga0068856_100112062 | 3300005614 | Bacteria | 2726 |
| 29 | Ga0068852_100000022 | 3300005616 | Bacteria | 125196 |
| 30 | Ga0068859_102058984 | 3300005617 | Bacteria | 630 |
| 31 | Ga0068861_100053077 | 3300005719 | Bacteria | 3083 |
| 32 | Ga0068863_101439868 | 3300005841 | Bacteria | 697 |
| 33 | Ga0068860_100441357 | 3300005843 | Bacteria | 1293 |
| 34 | Ga0068862_101666210 | 3300005844 | Bacteria | 646 |
| 35 | Ga0081455_10863039 | 3300005937 | Bacteria | 565 |
| 36 | Ga0081540_1011559 | 3300005983 | Bacteria | 5896 |
| 37 | Ga0081539_10000808 | 3300005985 | Bacteria | 60799 |
| 38 | Ga0075365_10366830 | 3300006038 | Bacteria | 1015 |
| 39 | Ga0070715_10037298 | 3300006163 | Bacteria | 2011 |
| 40 | Ga0075362_10192624 | 3300006177 | Bacteria | 990 |
| 41 | Ga0075366_10102601 | 3300006195 | Bacteria | 1717 |
| 42 | Ga0075433_10419483 | 3300006852 | Bacteria | 1180 |
| 43 | Ga0075434_100035594 | 3300006871 | Bacteria | 4923 |
| 44 | Ga0075434_100216619 | 3300006871 | Bacteria | 1935 |
| 45 | Ga0075434_100794532 | 3300006871 | Bacteria | 963 |
| 46 | Ga0075434_102279263 | 3300006871 | Bacteria | 545 |
| 47 | Ga0097620_102059479 | 3300006931 | Bacteria | 630 |
| 48 | Ga0075435_100078722 | 3300007076 | Bacteria | 2704 |
| 49 | Ga0111539_11221249 | 3300009094 | Bacteria | 873 |
| 50 | Ga0111539_12874760 | 3300009094 | Bacteria | 557 |
| 51 | Ga0105245_10000023 | 3300009098 | Bacteria | 180844 |
| 52 | Ga0105245_10002542 | 3300009098 | Bacteria | 16442 |
| 53 | Ga0105247_10486821 | 3300009101 | Bacteria | 896 |
| 54 | Ga0114129_10801676 | 3300009147 | Bacteria | 1201 |
| 55 | Ga0105243_10204046 | 3300009148 | Bacteria | 1736 |
| 56 | Ga0105242_10173823 | 3300009176 | Bacteria | 1895 |
| 57 | Ga0105242_10582326 | 3300009176 | Bacteria | 1078 |
| 58 | Ga0105248_10092094 | 3300009177 | Bacteria | 3414 |
| 59 | Ga0105248_10172145 | 3300009177 | Bacteria | 2440 |
| 60 | Ga0105248_12676213 | 3300009177 | Bacteria | 569 |
| 61 | Ga0105249_10554566 | 3300009553 | Bacteria | 1200 |
| 62 | Ga0105249_11397930 | 3300009553 | Bacteria | 772 |
| 63 | Ga0105249_11811649 | 3300009553 | Bacteria | 683 |
| 64 | Ga0105249_12195716 | 3300009553 | Bacteria | 625 |
| 65 | Ga0105249_13190750 | 3300009553 | Unclassified | 527 |
| 66 | Ga0105239_10192464 | 3300010375 | Bacteria | 2283 |
| 67 | Ga0105246_10578211 | 3300011119 | Bacteria | 967 |
| 68 | Ga0157335_1016684 | 3300012492 | Bacteria | 658 |
| 69 | Ga0157371_10003324 | 3300013102 | Bacteria | 14691 |
| 70 | Ga0157370_10000289 | 3300013104 | Bacteria | 63849 |
| 71 | Ga0157374_10980014 | 3300013296 | Bacteria | 864 |
| 72 | Ga0157378_11072153 | 3300013297 | Bacteria | 842 |
| 73 | Ga0163162_10456522 | 3300013306 | Bacteria | 1409 |
| 74 | Ga0157372_10001763 | 3300013307 | Bacteria | 23465 |
| 75 | Ga0157372_12632965 | 3300013307 | Bacteria | 577 |
| 76 | Ga0157375_10004083 | 3300013308 | Bacteria | 12657 |
| 77 | Ga0157375_10889886 | 3300013308 | Bacteria | 1035 |
| 78 | Ga0163163_11434855 | 3300014325 | Bacteria | 752 |
| 79 | Ga0163163_11585401 | 3300014325 | Bacteria | 716 |
| 80 | Ga0157380_11411378 | 3300014326 | Bacteria | 747 |
| 81 | Ga0182008_10092738 | 3300014497 | Bacteria | 1490 |
| 82 | Ga0157379_10151619 | 3300014968 | Bacteria | 2091 |
| 83 | Ga0157379_11588985 | 3300014968 | Bacteria | 638 |
| 84 | Ga0207685_10028817 | 3300025905 | Bacteria | 1959 |
| 85 | Ga0207705_10312757 | 3300025909 | Bacteria | 1206 |
| 86 | Ga0207693_11406861 | 3300025915 | Bacteria | 518 |
| 87 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 88 | Ga0207646_11015993 | 3300025922 | Bacteria | 732 |
| 89 | Ga0207650_10261425 | 3300025925 | Bacteria | 1404 |
| 90 | Ga0207659_10294609 | 3300025926 | Bacteria | 1330 |
| 91 | Ga0207659_11089369 | 3300025926 | Bacteria | 687 |
| 92 | Ga0207687_10000015 | 3300025927 | Bacteria | 261701 |
| 93 | Ga0207687_10002068 | 3300025927 | Bacteria | 13737 |
| 94 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 95 | Ga0207644_10981199 | 3300025931 | Bacteria | 709 |
| 96 | Ga0207690_10025608 | 3300025932 | Bacteria | 3707 |
| 97 | Ga0207709_10245672 | 3300025935 | Bacteria | 1304 |
| 98 | Ga0207670_10132845 | 3300025936 | Bacteria | 1826 |
| 99 | Ga0207691_10000002 | 3300025940 | Bacteria | 189785 |
| 100 | Ga0207711_10135945 | 3300025941 | Bacteria | 2208 |
| 101 | Ga0207711_11331199 | 3300025941 | Bacteria | 660 |
| 102 | Ga0207711_11480467 | 3300025941 | Bacteria | 622 |
| 103 | Ga0207640_10000074 | 3300025981 | Bacteria | 78164 |
| 104 | Ga0207677_10003597 | 3300026023 | Bacteria | 8214 |
| 105 | Ga0207703_10444904 | 3300026035 | Bacteria | 1209 |
| 106 | Ga0207678_10679253 | 3300026067 | Bacteria | 906 |
| 107 | Ga0207702_10000337 | 3300026078 | Bacteria | 53931 |
| 108 | Ga0207702_10622358 | 3300026078 | Bacteria | 1060 |
| 109 | Ga0207641_11408535 | 3300026088 | Bacteria | 698 |
| 110 | Ga0207674_10273375 | 3300026116 | Bacteria | 1637 |
| 111 | Ga0207674_10441977 | 3300026116 | Bacteria | 1257 |
| 112 | Ga0207675_100077592 | 3300026118 | Bacteria | 3112 |
| 113 | Ga0207698_10000043 | 3300026142 | Bacteria | 96553 |
| 114 | Ga0207428_10670149 | 3300027907 | Bacteria | 743 |
| 115 | Ga0268265_11459539 | 3300028380 | Bacteria | 687 |
| 116 | Ga0268264_10263010 | 3300028381 | Bacteria | 1608 |
| 117 | Ga0265326_10026867 | 3300028558 | Bacteria | 1641 |
| 118 | Ga0265334_10010943 | 3300028573 | Bacteria | 3827 |
| 119 | Ga0265338_10011382 | 3300028800 | Bacteria | 10286 |
| 120 | Ga0265338_10098758 | 3300028800 | Bacteria | 2387 |
| 121 | Ga0265332_10344787 | 3300031238 | Bacteria | 615 |
| 122 | Ga0265325_10080698 | 3300031241 | Bacteria | 1617 |
| 123 | Ga0265340_10050027 | 3300031247 | Bacteria | 2028 |
| 124 | Ga0265339_10066688 | 3300031249 | Bacteria | 1927 |
| 125 | Ga0265331_10227303 | 3300031250 | Bacteria | 838 |
| 126 | Ga0265313_10220363 | 3300031595 | Bacteria | 783 |
| 127 | Ga0316575_10130054 | 3300031665 | Bacteria | 1033 |
| 128 | Ga0265314_10239423 | 3300031711 | Bacteria | 1048 |
| 129 | Ga0265314_10370954 | 3300031711 | Bacteria | 782 |
| 130 | Ga0265342_10031464 | 3300031712 | Bacteria | 3280 |
| 131 | Ga0373952_0103166 | 3300035092 | Bacteria | 755 |
| 132 | Ga0373931_0511163 | 3300035691 | Bacteria | 776 |
| 133 | Ga0373931_0961545 | 3300035691 | Bacteria | 576 |
| 134 | Ga0436365_0587030 | 3300039437 | Bacteria | 1240 |
| 135 | Ga0436360_0473700 | 3300039438 | Bacteria | 666 |
| 136 | Ga0451804_0303561 | 3300041463 | Bacteria | 668 |
| 137 | Ga0451843_0279297 | 3300041509 | Bacteria | 507 |
| 138 | Ga0466963_0145465 | 3300044694 | Bacteria | 1644 |
| 139 | Ga0466957_0094410 | 3300044842 | Bacteria | 1878 |
| 140 | Ga0466957_0095562 | 3300044842 | Bacteria | 1866 |
| 141 | Ga0466958_0031644 | 3300045836 | Bacteria | 3145 |
| 142 | Ga0466958_0174473 | 3300045836 | Bacteria | 1362 |
| 143 | Ga0466967_1220552 | 3300045976 | Bacteria | 749 |
| 144 | Ga0466967_1764776 | 3300045976 | Bacteria | 616 |
| 145 | Ga0495641_0127370 | 3300046461 | Bacteria | 1136 |
| 146 | Ga0495639_0112994 | 3300046475 | Bacteria | 1290 |
| 147 | Ga0495662_0078968 | 3300046476 | Bacteria | 1599 |
| 148 | Ga0495585_0574931 | 3300046492 | Bacteria | 531 |
| 149 | Ga0495594_0195419 | 3300046499 | Bacteria | 1153 |
| 150 | Ga0495608_0000035 | 3300046511 | Bacteria | 133011 |
| 151 | Ga0495616_0239688 | 3300046513 | Bacteria | 783 |
| 152 | Ga0495630_0000034 | 3300046517 | Bacteria | 126055 |
| 153 | Ga0495630_0037598 | 3300046517 | Bacteria | 3620 |
| 154 | Ga0495631_0115942 | 3300046518 | Bacteria | 1152 |
| 155 | Ga0495637_0130164 | 3300046520 | Bacteria | 962 |
| 156 | Ga0495640_0671824 | 3300046533 | Bacteria | 623 |
| 157 | Ga0495622_0000447 | 3300046557 | Bacteria | 26627 |
| 158 | Ga0495656_0058423 | 3300046615 | Bacteria | 1674 |
| 159 | Ga0495625_0000213 | 3300046660 | Bacteria | 91768 |
| 160 | Ga0495625_0013891 | 3300046660 | Bacteria | 6449 |
| 161 | Ga0495661_0235738 | 3300046665 | Bacteria | 941 |
| 162 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 163 | Ga0495647_0000079 | 3300046681 | Bacteria | 23665 |
| 164 | Ga0495658_0996356 | 3300046683 | Bacteria | 535 |
| 165 | Ga0495613_0000027 | 3300046689 | Bacteria | 146674 |
| 166 | Ga0495600_0097717 | 3300046809 | Bacteria | 1914 |
| 167 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 168 | Ga0495674_0251638 | 3300047319 | Bacteria | 1454 |
| 169 | Ga0495672_0244560 | 3300047320 | Bacteria | 874 |
| 170 | Ga0495676_0243128 | 3300047321 | Bacteria | 1231 |
| 171 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 172 | Ga0495602_0000393 | 3300048088 | Bacteria | 40803 |
| 173 | Ga0496100_1315057 | 3300048903 | Bacteria | 570 |
| 174 | Ga0496101_0241203 | 3300048904 | Bacteria | 1407 |
| 175 | Ga0496102_0013695 | 3300048905 | Bacteria | 7031 |
| 176 | Ga0496102_0438812 | 3300048905 | Bacteria | 1225 |
| 177 | Ga0496103_0201724 | 3300048906 | Bacteria | 1279 |
| 178 | Ga0496103_0538484 | 3300048906 | Bacteria | 746 |
| 179 | Ga0496103_0696790 | 3300048906 | Bacteria | 644 |
| 180 | Ga0496104_0018264 | 3300048907 | Bacteria | 6398 |
| 181 | Ga0496104_0238758 | 3300048907 | Bacteria | 1729 |
| 182 | Ga0496105_0020139 | 3300048908 | Bacteria | 5387 |
| 183 | Ga0496106_0107125 | 3300048909 | Bacteria | 2173 |
| 184 | Ga0496106_0225277 | 3300048909 | Bacteria | 1496 |
| 185 | Ga0496106_0425639 | 3300048909 | Bacteria | 1067 |
| 186 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 187 | Ga0496108_0223945 | 3300048911 | Bacteria | 1634 |
| 188 | Ga0496108_0297148 | 3300048911 | Bacteria | 1406 |
| 189 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 190 | Ga0496109_0000066 | 3300048912 | Bacteria | 112004 |
| 191 | Ga0496109_0029056 | 3300048912 | Bacteria | 4949 |
| 192 | Ga0496109_0564827 | 3300048912 | Bacteria | 1073 |
| 193 | Ga0496109_0842440 | 3300048912 | Bacteria | 855 |
| 194 | Ga0496110_0000235 | 3300048913 | Bacteria | 35772 |
| 195 | Ga0496110_0036868 | 3300048913 | Bacteria | 4248 |
| 196 | Ga0496110_0550043 | 3300048913 | Bacteria | 1049 |
| 197 | Ga0496110_0789024 | 3300048913 | Bacteria | 854 |
| 198 | Ga0496110_1452851 | 3300048913 | Bacteria | 595 |
| 199 | Ga0496111_0000011 | 3300048914 | Bacteria | 88409 |
| 200 | Ga0496111_0006051 | 3300048914 | Bacteria | 7817 |
| 201 | Ga0496111_0018457 | 3300048914 | Bacteria | 4834 |
| 202 | Ga0496112_0361676 | 3300048915 | Bacteria | 1393 |
| 203 | Ga0496112_0467866 | 3300048915 | Bacteria | 1198 |
| 204 | Ga0496113_0061363 | 3300048916 | Bacteria | 2837 |
| 205 | Ga0496113_0141830 | 3300048916 | Bacteria | 1891 |
| 206 | Ga0496114_0071641 | 3300048917 | Bacteria | 2913 |
| 207 | Ga0496114_0122362 | 3300048917 | Bacteria | 2239 |
| 208 | Ga0496115_0000031 | 3300048918 | Bacteria | 138258 |
| 209 | Ga0496115_1039450 | 3300048918 | Bacteria | 624 |
| 210 | Ga0496118_0354317 | 3300048921 | Bacteria | 781 |
| 211 | Ga0496126_0263121 | 3300048929 | Bacteria | 1433 |
| 212 | Ga0496126_0810386 | 3300048929 | Bacteria | 717 |
| 213 | Ga0501077_0172802 | 3300049593 | Bacteria | 1373 |
| 214 | Ga0501083_0561842 | 3300049744 | Bacteria | 742 |
| 215 | Ga0501035_1460058 | 3300049822 | Bacteria | 523 |
| 216 | nmdc:mga03n38_946311_c1 | 3300050490 | Bacteria | 508 |
| 217 | nmdc:mga0yw44_176919_c1 | 3300050492 | Bacteria | 1403 |
| 218 | nmdc:mga0yw44_401660_c1 | 3300050492 | Bacteria | 927 |
| 219 | nmdc:mga0k408_326865_c1 | 3300050493 | Bacteria | 915 |
| 220 | nmdc:mga06z11_787985_c1 | 3300050494 | Bacteria | 579 |
| 221 | nmdc:mga08y16_338932_c1 | 3300050511 | Bacteria | 1546 |
| 222 | nmdc:mga0n895_1573500_c1 | 3300050512 | Bacteria | 622 |
| 223 | nmdc:mga0n895_391283_c2 | 3300050512 | Bacteria | 827 |
| 224 | nmdc:mga0n895_51264_c1 | 3300050512 | Bacteria | 4048 |
| 225 | nmdc:mga0rr50_111610_c1 | 3300050513 | Bacteria | 2164 |
| 226 | nmdc:mga08x19_652895_c1 | 3300050514 | Bacteria | 746 |
| 227 | nmdc:mga0a205_305307_c1 | 3300050515 | Bacteria | 1464 |
| 228 | nmdc:mga0a205_430873_c1 | 3300050515 | Bacteria | 1180 |
| 229 | nmdc:mga0sz30_283180_c1 | 3300050516 | Bacteria | 739 |
| 230 | Ga0495601_0000017 | 3300053077 | Bacteria | 204209 |
| 231 | Ga0495655_0018049 | 3300053083 | Bacteria | 1545 |
| 232 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 233 | Ga0495595_0001757 | 3300053084 | Bacteria | 8468 |
| 234 | Ga0495619_0000054 | 3300053085 | Bacteria | 97928 |
| 235 | Ga0495619_0000101 | 3300053085 | Bacteria | 64377 |
| 236 | Ga0500641_0163758 | 3300053096 | Bacteria | 958 |
| 237 | Ga0500611_091654 | 3300053727 | Bacteria | 774 |
| 238 | Ga0501084_0188173 | 3300054114 | Bacteria | 1742 |
| 239 | Ga0501084_0340679 | 3300054114 | Bacteria | 1266 |
| 240 | Ga0501084_1114823 | 3300054114 | Bacteria | 662 |
| 241 | Ga0501082_0401864 | 3300060353 | Bacteria | 1196 |
| 242 | Ga0501082_0774602 | 3300060353 | Bacteria | 839 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0145465 | Ga0466963_0145465_805_1131 | 101 |
| 2 | 3300044842 | Ga0466957_0094410 | Ga0466957_0094410_721_1047 | 101 |
| 3 | 3300045836 | Ga0466958_0174473 | Ga0466958_0174473_515_841 | 101 |
| 4 | 3300045976 | Ga0466967_1220552 | Ga0466967_1220552_235_561 | 101 |
| 5 | 3300014497 | Ga0182008_10092738 | Ga0182008_100927382 | 102 |
| 6 | 3300050492 | nmdc:mga0yw44_176919_c1 | nmdc:mga0yw44_176919_c1_234_572 | 102 |
| 7 | 3300005530 | Ga0070679_101817497 | Ga0070679_1018174972 | 103 |
| 8 | 3300005548 | Ga0070665_100507198 | Ga0070665_1005071982 | 103 |
| 9 | 3300005983 | Ga0081540_1011559 | Ga0081540_10115596 | 103 |
| 10 | 3300009176 | Ga0105242_10582326 | Ga0105242_105823261 | 103 |
| 11 | 3300014326 | Ga0157380_11411378 | Ga0157380_114113782 | 103 |
| 12 | 3300046511 | Ga0495608_0000035 | Ga0495608_0000035_110561_110884 | 103 |
| 13 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_22128_22451 | 103 |
| 14 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_22121_22444 | 103 |
| 15 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_22128_22451 | 103 |
| 16 | 3300053085 | Ga0495619_0000101 | Ga0495619_0000101_22128_22451 | 103 |
| 17 | 3300005347 | Ga0070668_100722590 | Ga0070668_1007225902 | 104 |
| 18 | 3300005355 | Ga0070671_100064982 | Ga0070671_1000649824 | 104 |
| 19 | 3300005578 | Ga0068854_100000062 | Ga0068854_10000006270 | 104 |
| 20 | 3300005617 | Ga0068859_102058984 | Ga0068859_1020589842 | 104 |
| 21 | 3300005719 | Ga0068861_100053077 | Ga0068861_1000530773 | 104 |
| 22 | 3300005841 | Ga0068863_101439868 | Ga0068863_1014398682 | 104 |
| 23 | 3300005843 | Ga0068860_100441357 | Ga0068860_1004413572 | 104 |
| 24 | 3300006038 | Ga0075365_10366830 | Ga0075365_103668301 | 104 |
| 25 | 3300006177 | Ga0075362_10192624 | Ga0075362_101926243 | 104 |
| 26 | 3300006195 | Ga0075366_10102601 | Ga0075366_101026013 | 104 |
| 27 | 3300006852 | Ga0075433_10419483 | Ga0075433_104194832 | 104 |
| 28 | 3300006871 | Ga0075434_100216619 | Ga0075434_1002166193 | 104 |
| 29 | 3300006931 | Ga0097620_102059479 | Ga0097620_1020594792 | 104 |
| 30 | 3300007076 | Ga0075435_100078722 | Ga0075435_1000787223 | 104 |
| 31 | 3300009094 | Ga0111539_11221249 | Ga0111539_112212493 | 104 |
| 32 | 3300009553 | Ga0105249_12195716 | Ga0105249_121957162 | 104 |
| 33 | 3300009553 | Ga0105249_13190750 | Ga0105249_131907501 | 104 |
| 34 | 3300013104 | Ga0157370_10000289 | Ga0157370_1000028945 | 104 |
| 35 | 3300013308 | Ga0157375_10004083 | Ga0157375_100040837 | 104 |
| 36 | 3300014325 | Ga0163163_11585401 | Ga0163163_115854011 | 104 |
| 37 | 3300014968 | Ga0157379_10151619 | Ga0157379_101516193 | 104 |
| 38 | 3300025941 | Ga0207711_11480467 | Ga0207711_114804671 | 104 |
| 39 | 3300025981 | Ga0207640_10000074 | Ga0207640_1000007469 | 104 |
| 40 | 3300026035 | Ga0207703_10444904 | Ga0207703_104449041 | 104 |
| 41 | 3300026067 | Ga0207678_10679253 | Ga0207678_106792532 | 104 |
| 42 | 3300026088 | Ga0207641_11408535 | Ga0207641_114085352 | 104 |
| 43 | 3300026118 | Ga0207675_100077592 | Ga0207675_1000775923 | 104 |
| 44 | 3300027907 | Ga0207428_10670149 | Ga0207428_106701492 | 104 |
| 45 | 3300028380 | Ga0268265_11459539 | Ga0268265_114595391 | 104 |
| 46 | 3300028381 | Ga0268264_10263010 | Ga0268264_102630102 | 104 |
| 47 | 3300031238 | Ga0265332_10344787 | Ga0265332_103447871 | 104 |
| 48 | 3300031241 | Ga0265325_10080698 | Ga0265325_100806981 | 104 |
| 49 | 3300031247 | Ga0265340_10050027 | Ga0265340_100500273 | 104 |
| 50 | 3300031249 | Ga0265339_10066688 | Ga0265339_100666884 | 104 |
| 51 | 3300031595 | Ga0265313_10220363 | Ga0265313_102203632 | 104 |
| 52 | 3300031665 | Ga0316575_10130054 | Ga0316575_101300542 | 104 |
| 53 | 3300031711 | Ga0265314_10239423 | Ga0265314_102394232 | 104 |
| 54 | 3300031711 | Ga0265314_10370954 | Ga0265314_103709542 | 104 |
| 55 | 3300031712 | Ga0265342_10031464 | Ga0265342_100314644 | 104 |
| 56 | 3300035691 | Ga0373931_0511163 | Ga0373931_0511163_205_525 | 104 |
| 57 | 3300041463 | Ga0451804_0303561 | Ga0451804_0303561_69_383 | 104 |
| 58 | 3300041509 | Ga0451843_0279297 | Ga0451843_0279297_163_477 | 104 |
| 59 | 3300046475 | Ga0495639_0112994 | Ga0495639_0112994_462_776 | 104 |
| 60 | 3300046476 | Ga0495662_0078968 | Ga0495662_0078968_1185_1499 | 104 |
| 61 | 3300046513 | Ga0495616_0239688 | Ga0495616_0239688_37_357 | 104 |
| 62 | 3300046517 | Ga0495630_0037598 | Ga0495630_0037598_3262_3588 | 104 |
| 63 | 3300046520 | Ga0495637_0130164 | Ga0495637_0130164_372_692 | 104 |
| 64 | 3300046533 | Ga0495640_0671824 | Ga0495640_0671824_152_466 | 104 |
| 65 | 3300046557 | Ga0495622_0000447 | Ga0495622_0000447_15597_15911 | 104 |
| 66 | 3300046660 | Ga0495625_0000213 | Ga0495625_0000213_17233_17547 | 104 |
| 67 | 3300046660 | Ga0495625_0013891 | Ga0495625_0013891_3646_3966 | 104 |
| 68 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_244917_245231 | 104 |
| 69 | 3300047319 | Ga0495674_0251638 | Ga0495674_0251638_613_939 | 104 |
| 70 | 3300048905 | Ga0496102_0438812 | Ga0496102_0438812_637_951 | 104 |
| 71 | 3300048906 | Ga0496103_0538484 | Ga0496103_0538484_325_639 | 104 |
| 72 | 3300048912 | Ga0496109_0842440 | Ga0496109_0842440_368_682 | 104 |
| 73 | 3300048913 | Ga0496110_0789024 | Ga0496110_0789024_145_465 | 104 |
| 74 | 3300048918 | Ga0496115_1039450 | Ga0496115_1039450_288_605 | 104 |
| 75 | 3300048921 | Ga0496118_0354317 | Ga0496118_0354317_422_736 | 104 |
| 76 | 3300048929 | Ga0496126_0263121 | Ga0496126_0263121_1089_1406 | 104 |
| 77 | 3300048929 | Ga0496126_0810386 | Ga0496126_0810386_124_441 | 104 |
| 78 | 3300049822 | Ga0501035_1460058 | Ga0501035_1460058_146_460 | 104 |
| 79 | 3300050490 | nmdc:mga03n38_946311_c1 | nmdc:mga03n38_946311_c1_141_461 | 104 |
| 80 | 3300050492 | nmdc:mga0yw44_401660_c1 | nmdc:mga0yw44_401660_c1_152_472 | 104 |
| 81 | 3300050493 | nmdc:mga0k408_326865_c1 | nmdc:mga0k408_326865_c1_241_561 | 104 |
| 82 | 3300050511 | nmdc:mga08y16_338932_c1 | nmdc:mga08y16_338932_c1_394_708 | 104 |
| 83 | 3300050512 | nmdc:mga0n895_1573500_c1 | nmdc:mga0n895_1573500_c1_287_610 | 104 |
| 84 | 3300050512 | nmdc:mga0n895_51264_c1 | nmdc:mga0n895_51264_c1_732_1046 | 104 |
| 85 | 3300050513 | nmdc:mga0rr50_111610_c1 | nmdc:mga0rr50_111610_c1_1164_1478 | 104 |
| 86 | 3300050515 | nmdc:mga0a205_430873_c1 | nmdc:mga0a205_430873_c1_281_595 | 104 |
| 87 | 3300050516 | nmdc:mga0sz30_283180_c1 | nmdc:mga0sz30_283180_c1_381_701 | 104 |
| 88 | 3300053096 | Ga0500641_0163758 | Ga0500641_0163758_17_331 | 104 |
| 89 | 3300053727 | Ga0500611_091654 | Ga0500611_091654_349_669 | 104 |
| 90 | 3300005331 | Ga0070670_100121991 | Ga0070670_1001219913 | 105 |
| 91 | 3300005340 | Ga0070689_100160109 | Ga0070689_1001601094 | 105 |
| 92 | 3300005347 | Ga0070668_101030042 | Ga0070668_1010300421 | 105 |
| 93 | 3300005355 | Ga0070671_101298898 | Ga0070671_1012988981 | 105 |
| 94 | 3300005365 | Ga0070688_100008881 | Ga0070688_1000088815 | 105 |
| 95 | 3300005445 | Ga0070708_100452030 | Ga0070708_1004520302 | 105 |
| 96 | 3300005466 | Ga0070685_10149456 | Ga0070685_101494562 | 105 |
| 97 | 3300005468 | Ga0070707_100625858 | Ga0070707_1006258582 | 105 |
| 98 | 3300005471 | Ga0070698_100435735 | Ga0070698_1004357352 | 105 |
| 99 | 3300005530 | Ga0070679_101818080 | Ga0070679_1018180802 | 105 |
| 100 | 3300005539 | Ga0068853_100102061 | Ga0068853_1001020614 | 105 |
| 101 | 3300005543 | Ga0070672_100000049 | Ga0070672_10000004953 | 105 |
| 102 | 3300005548 | Ga0070665_102271345 | Ga0070665_1022713451 | 105 |
| 103 | 3300005549 | Ga0070704_100469709 | Ga0070704_1004697092 | 105 |
| 104 | 3300005577 | Ga0068857_101146458 | Ga0068857_1011464582 | 105 |
| 105 | 3300005614 | Ga0068856_100001736 | Ga0068856_10000173612 | 105 |
| 106 | 3300005614 | Ga0068856_100112062 | Ga0068856_1001120624 | 105 |
| 107 | 3300005616 | Ga0068852_100000022 | Ga0068852_10000002257 | 105 |
| 108 | 3300005844 | Ga0068862_101666210 | Ga0068862_1016662102 | 105 |
| 109 | 3300005985 | Ga0081539_10000808 | Ga0081539_1000080857 | 105 |
| 110 | 3300006871 | Ga0075434_100035594 | Ga0075434_1000355945 | 105 |
| 111 | 3300006871 | Ga0075434_100794532 | Ga0075434_1007945322 | 105 |
| 112 | 3300006871 | Ga0075434_102279263 | Ga0075434_1022792632 | 105 |
| 113 | 3300009094 | Ga0111539_12874760 | Ga0111539_128747602 | 105 |
| 114 | 3300009098 | Ga0105245_10000023 | Ga0105245_1000002385 | 105 |
| 115 | 3300009101 | Ga0105247_10486821 | Ga0105247_104868212 | 105 |
| 116 | 3300009147 | Ga0114129_10801676 | Ga0114129_108016762 | 105 |
| 117 | 3300009148 | Ga0105243_10204046 | Ga0105243_102040462 | 105 |
| 118 | 3300009176 | Ga0105242_10173823 | Ga0105242_101738234 | 105 |
| 119 | 3300009177 | Ga0105248_10092094 | Ga0105248_100920943 | 105 |
| 120 | 3300009177 | Ga0105248_12676213 | Ga0105248_126762132 | 105 |
| 121 | 3300009553 | Ga0105249_10554566 | Ga0105249_105545662 | 105 |
| 122 | 3300009553 | Ga0105249_11397930 | Ga0105249_113979302 | 105 |
| 123 | 3300009553 | Ga0105249_11811649 | Ga0105249_118116492 | 105 |
| 124 | 3300010375 | Ga0105239_10192464 | Ga0105239_101924643 | 105 |
| 125 | 3300011119 | Ga0105246_10578211 | Ga0105246_105782112 | 105 |
| 126 | 3300012492 | Ga0157335_1016684 | Ga0157335_10166842 | 105 |
| 127 | 3300013102 | Ga0157371_10003324 | Ga0157371_100033249 | 105 |
| 128 | 3300013296 | Ga0157374_10980014 | Ga0157374_109800142 | 105 |
| 129 | 3300013297 | Ga0157378_11072153 | Ga0157378_110721532 | 105 |
| 130 | 3300013306 | Ga0163162_10456522 | Ga0163162_104565222 | 105 |
| 131 | 3300013307 | Ga0157372_12632965 | Ga0157372_126329652 | 105 |
| 132 | 3300014325 | Ga0163163_11434855 | Ga0163163_114348552 | 105 |
| 133 | 3300014968 | Ga0157379_11588985 | Ga0157379_115889851 | 105 |
| 134 | 3300025922 | Ga0207646_11015993 | Ga0207646_110159932 | 105 |
| 135 | 3300025925 | Ga0207650_10261425 | Ga0207650_102614251 | 105 |
| 136 | 3300025926 | Ga0207659_10294609 | Ga0207659_102946092 | 105 |
| 137 | 3300025926 | Ga0207659_11089369 | Ga0207659_110893692 | 105 |
| 138 | 3300025927 | Ga0207687_10000015 | Ga0207687_1000001597 | 105 |
| 139 | 3300025931 | Ga0207644_10981199 | Ga0207644_109811992 | 105 |
| 140 | 3300025935 | Ga0207709_10245672 | Ga0207709_102456722 | 105 |
| 141 | 3300025936 | Ga0207670_10132845 | Ga0207670_101328451 | 105 |
| 142 | 3300025940 | Ga0207691_10000002 | Ga0207691_1000000265 | 105 |
| 143 | 3300025941 | Ga0207711_11331199 | Ga0207711_113311991 | 105 |
| 144 | 3300026078 | Ga0207702_10000337 | Ga0207702_1000033725 | 105 |
| 145 | 3300026078 | Ga0207702_10622358 | Ga0207702_106223581 | 105 |
| 146 | 3300026116 | Ga0207674_10273375 | Ga0207674_102733752 | 105 |
| 147 | 3300026142 | Ga0207698_10000043 | Ga0207698_1000004366 | 105 |
| 148 | 3300028558 | Ga0265326_10026867 | Ga0265326_100268672 | 105 |
| 149 | 3300028573 | Ga0265334_10010943 | Ga0265334_100109433 | 105 |
| 150 | 3300028800 | Ga0265338_10011382 | Ga0265338_100113824 | 105 |
| 151 | 3300028800 | Ga0265338_10098758 | Ga0265338_100987582 | 105 |
| 152 | 3300031250 | Ga0265331_10227303 | Ga0265331_102273032 | 105 |
| 153 | 3300035092 | Ga0373952_0103166 | Ga0373952_0103166_193_543 | 105 |
| 154 | 3300035691 | Ga0373931_0961545 | Ga0373931_0961545_111_443 | 105 |
| 155 | 3300039437 | Ga0436365_0587030 | Ga0436365_0587030_93_416 | 105 |
| 156 | 3300039438 | Ga0436360_0473700 | Ga0436360_0473700_210_533 | 105 |
| 157 | 3300044842 | Ga0466957_0095562 | Ga0466957_0095562_1036_1353 | 105 |
| 158 | 3300045836 | Ga0466958_0031644 | Ga0466958_0031644_2340_2660 | 105 |
| 159 | 3300045976 | Ga0466967_1764776 | Ga0466967_1764776_49_372 | 105 |
| 160 | 3300046492 | Ga0495585_0574931 | Ga0495585_0574931_97_414 | 105 |
| 161 | 3300046499 | Ga0495594_0195419 | Ga0495594_0195419_80_400 | 105 |
| 162 | 3300046518 | Ga0495631_0115942 | Ga0495631_0115942_365_682 | 105 |
| 163 | 3300046615 | Ga0495656_0058423 | Ga0495656_0058423_369_689 | 105 |
| 164 | 3300046665 | Ga0495661_0235738 | Ga0495661_0235738_117_434 | 105 |
| 165 | 3300046683 | Ga0495658_0996356 | Ga0495658_0996356_124_444 | 105 |
| 166 | 3300048903 | Ga0496100_1315057 | Ga0496100_1315057_168_500 | 105 |
| 167 | 3300048904 | Ga0496101_0241203 | Ga0496101_0241203_1017_1337 | 105 |
| 168 | 3300048905 | Ga0496102_0013695 | Ga0496102_0013695_2317_2649 | 105 |
| 169 | 3300048906 | Ga0496103_0201724 | Ga0496103_0201724_16_348 | 105 |
| 170 | 3300048906 | Ga0496103_0696790 | Ga0496103_0696790_103_429 | 105 |
| 171 | 3300048907 | Ga0496104_0238758 | Ga0496104_0238758_1189_1521 | 105 |
| 172 | 3300048908 | Ga0496105_0020139 | Ga0496105_0020139_5002_5322 | 105 |
| 173 | 3300048909 | Ga0496106_0107125 | Ga0496106_0107125_324_656 | 105 |
| 174 | 3300048909 | Ga0496106_0225277 | Ga0496106_0225277_894_1247 | 105 |
| 175 | 3300048909 | Ga0496106_0425639 | Ga0496106_0425639_378_701 | 105 |
| 176 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_245865_246182 | 105 |
| 177 | 3300048911 | Ga0496108_0223945 | Ga0496108_0223945_1081_1398 | 105 |
| 178 | 3300048911 | Ga0496108_0297148 | Ga0496108_0297148_268_600 | 105 |
| 179 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_288910_289227 | 105 |
| 180 | 3300048912 | Ga0496109_0000066 | Ga0496109_0000066_88456_88773 | 105 |
| 181 | 3300048912 | Ga0496109_0029056 | Ga0496109_0029056_1532_1864 | 105 |
| 182 | 3300048912 | Ga0496109_0564827 | Ga0496109_0564827_125_478 | 105 |
| 183 | 3300048913 | Ga0496110_0036868 | Ga0496110_0036868_883_1215 | 105 |
| 184 | 3300048913 | Ga0496110_0550043 | Ga0496110_0550043_98_451 | 105 |
| 185 | 3300048913 | Ga0496110_1452851 | Ga0496110_1452851_128_445 | 105 |
| 186 | 3300048914 | Ga0496111_0006051 | Ga0496111_0006051_129_482 | 105 |
| 187 | 3300048914 | Ga0496111_0018457 | Ga0496111_0018457_3312_3644 | 105 |
| 188 | 3300048915 | Ga0496112_0361676 | Ga0496112_0361676_547_879 | 105 |
| 189 | 3300048915 | Ga0496112_0467866 | Ga0496112_0467866_430_747 | 105 |
| 190 | 3300048916 | Ga0496113_0061363 | Ga0496113_0061363_1728_2045 | 105 |
| 191 | 3300048916 | Ga0496113_0141830 | Ga0496113_0141830_368_700 | 105 |
| 192 | 3300048917 | Ga0496114_0071641 | Ga0496114_0071641_1462_1794 | 105 |
| 193 | 3300048917 | Ga0496114_0122362 | Ga0496114_0122362_210_530 | 105 |
| 194 | 3300048918 | Ga0496115_0000031 | Ga0496115_0000031_77357_77674 | 105 |
| 195 | 3300049593 | Ga0501077_0172802 | Ga0501077_0172802_297_614 | 105 |
| 196 | 3300049744 | Ga0501083_0561842 | Ga0501083_0561842_137_454 | 105 |
| 197 | 3300050494 | nmdc:mga06z11_787985_c1 | nmdc:mga06z11_787985_c1_83_409 | 105 |
| 198 | 3300050512 | nmdc:mga0n895_391283_c2 | nmdc:mga0n895_391283_c2_129_449 | 105 |
| 199 | 3300050514 | nmdc:mga08x19_652895_c1 | nmdc:mga08x19_652895_c1_151_477 | 105 |
| 200 | 3300050515 | nmdc:mga0a205_305307_c1 | nmdc:mga0a205_305307_c1_219_545 | 105 |
| 201 | 3300054114 | Ga0501084_0188173 | Ga0501084_0188173_767_1084 | 105 |
| 202 | 3300054114 | Ga0501084_0340679 | Ga0501084_0340679_700_1017 | 105 |
| 203 | 3300054114 | Ga0501084_1114823 | Ga0501084_1114823_37_354 | 105 |
| 204 | 3300060353 | Ga0501082_0401864 | Ga0501082_0401864_826_1146 | 105 |
| 205 | 3300060353 | Ga0501082_0774602 | Ga0501082_0774602_444_761 | 105 |
| 206 | 3300005327 | Ga0070658_10288956 | Ga0070658_102889562 | 106 |
| 207 | 3300005337 | Ga0070682_100000026 | Ga0070682_10000002615 | 106 |
| 208 | 3300005338 | Ga0068868_100099440 | Ga0068868_1000994403 | 106 |
| 209 | 3300005344 | Ga0070661_100000004 | Ga0070661_100000004102 | 106 |
| 210 | 3300005436 | Ga0070713_100000005 | Ga0070713_100000005122 | 106 |
| 211 | 3300005577 | Ga0068857_100261121 | Ga0068857_1002611212 | 106 |
| 212 | 3300005937 | Ga0081455_10863039 | Ga0081455_108630391 | 106 |
| 213 | 3300006163 | Ga0070715_10037298 | Ga0070715_100372984 | 106 |
| 214 | 3300009098 | Ga0105245_10002542 | Ga0105245_1000254215 | 106 |
| 215 | 3300009177 | Ga0105248_10172145 | Ga0105248_101721452 | 106 |
| 216 | 3300013307 | Ga0157372_10001763 | Ga0157372_1000176317 | 106 |
| 217 | 3300013308 | Ga0157375_10889886 | Ga0157375_108898861 | 106 |
| 218 | 3300025905 | Ga0207685_10028817 | Ga0207685_100288174 | 106 |
| 219 | 3300025909 | Ga0207705_10312757 | Ga0207705_103127572 | 106 |
| 220 | 3300025915 | Ga0207693_11406861 | Ga0207693_114068611 | 106 |
| 221 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003157 | 106 |
| 222 | 3300025927 | Ga0207687_10002068 | Ga0207687_100020686 | 106 |
| 223 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003312 | 106 |
| 224 | 3300025932 | Ga0207690_10025608 | Ga0207690_100256089 | 106 |
| 225 | 3300025941 | Ga0207711_10135945 | Ga0207711_101359453 | 106 |
| 226 | 3300026023 | Ga0207677_10003597 | Ga0207677_1000359712 | 106 |
| 227 | 3300026116 | Ga0207674_10441977 | Ga0207674_104419772 | 106 |
| 228 | 3300046461 | Ga0495641_0127370 | Ga0495641_0127370_589_909 | 106 |
| 229 | 3300046517 | Ga0495630_0000034 | Ga0495630_0000034_66691_67011 | 106 |
| 230 | 3300046681 | Ga0495647_0000079 | Ga0495647_0000079_8418_8738 | 106 |
| 231 | 3300046689 | Ga0495613_0000027 | Ga0495613_0000027_5646_5975 | 106 |
| 232 | 3300046809 | Ga0495600_0097717 | Ga0495600_0097717_972_1301 | 106 |
| 233 | 3300047320 | Ga0495672_0244560 | Ga0495672_0244560_63_386 | 106 |
| 234 | 3300047321 | Ga0495676_0243128 | Ga0495676_0243128_178_498 | 106 |
| 235 | 3300048088 | Ga0495602_0000393 | Ga0495602_0000393_32390_32719 | 106 |
| 236 | 3300048907 | Ga0496104_0018264 | Ga0496104_0018264_332_661 | 106 |
| 237 | 3300048913 | Ga0496110_0000235 | Ga0496110_0000235_28449_28778 | 106 |
| 238 | 3300048914 | Ga0496111_0000011 | Ga0496111_0000011_43692_44021 | 106 |
| 239 | 3300053077 | Ga0495601_0000017 | Ga0495601_0000017_128020_128349 | 106 |
| 240 | 3300053083 | Ga0495655_0018049 | Ga0495655_0018049_537_857 | 106 |
| 241 | 3300053084 | Ga0495595_0001757 | Ga0495595_0001757_6856_7185 | 106 |
| 242 | 3300053085 | Ga0495619_0000054 | Ga0495619_0000054_42375_42707 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9669 | 12 | 68 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9501 | 2 | 77 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9499 | 12 | 69 |
| 7wqu-assembly1.cif.gz_B | feoc from klebsiella pneumoniae | 0.9358 | 13 | 69 |
| 5duk-assembly1.cif.gz_B | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.935 | 12 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9783 | 10 | 67 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9669 | 12 | 68 | 1.10.10.10 |
| af_Q58721_1_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9624 | 2 | 68 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9596 | 6 | 69 | 1.10.10.10 |
| af_Q58184_329_408_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.957 | 10 | 68 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659UVB0-F1-model_v4 | ArsR family transcriptional regulator | 0.9926 | 1 | 73 |
GO:0003700
|
| AF-A0A2I0N826-F1-model_v4 | HTH arsR-type domain-containing protein | 0.989 | 2 | 69 |
GO:0003700
|
| AF-A0A538GBV1-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9879 | 1 | 81 |
GO:0003700
|
| AF-A0A7W0YU31-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9827 | 3 | 78 |
GO:0003700
|
| AF-I8ZWU1-F1-model_v4 | Putative transcriptional regulator | 0.9785 | 2 | 85 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar