F354718

General Info

Members Datasets Scaffolds Average Seq Length
242 147 239 190

Family's Representative Sequence

Representative Sequence 3300025299|Ga0209256_1025823|Ga0209256_10258233
Length 206
Sequence MQINLAAANKKSDKAVELSDNVFSNYFNESLVHQVVTAYMAKARSGNHAQKNRAAVSGGGKKPWRQKGTGRARAGTTRSPIWRKGGVTFAAQPQDYSQKVNRKMYQGAMRSILSELLRQERLIVVDNFAVSAPKTKELLDKFKELNINNDVLVVTDSVDENLFLAARNLPKVDVVDVAAADPVSLIGFDKVLITLPAIKQFEEMLA

Samples

Sample ID Description Type Environment
1 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
86 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
99 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
100 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
101 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
102 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
103 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
104 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
105 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
106 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
109 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
110 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
111 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
114 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
135 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
147 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.71
Metatranscriptomes 14.05
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 0
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 16.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10060094 3300003323 Bacteria 5417
2 JGI26141J51220_1002702 3300003503 Bacteria 1082
3 Ga0007410J51695_1019754 3300003574 Bacteria 6630
4 Ga0070676_10007412 3300005328 Bacteria 5889
5 Ga0070670_100000015 3300005331 Bacteria 228819
6 Ga0068869_100042588 3300005334 Bacteria 3256
7 Ga0070680_100073142 3300005336 Bacteria 2818
8 Ga0070682_100087381 3300005337 Bacteria 2032
9 Ga0070675_100245605 3300005354 Bacteria 1565
10 Ga0070674_100013931 3300005356 Bacteria 4985
11 Ga0070667_100593195 3300005367 Bacteria 1020
12 Ga0070714_100013986 3300005435 Bacteria 6439
13 Ga0070714_100127768 3300005435 Bacteria 2268
14 Ga0070713_100379375 3300005436 Bacteria 1317
15 Ga0070711_100011694 3300005439 Bacteria 5457
16 Ga0070711_100274436 3300005439 Bacteria 1332
17 Ga0070700_100150466 3300005441 Bacteria 1591
18 Ga0070694_100272166 3300005444 Bacteria 1288
19 Ga0070678_100282957 3300005456 Bacteria 1403
20 Ga0070662_100015089 3300005457 Bacteria 5168
21 Ga0068867_100012134 3300005459 Bacteria 6086
22 Ga0068867_100462052 3300005459 Bacteria 1084
23 Ga0070672_100008185 3300005543 Bacteria 7145
24 Ga0070696_100058420 3300005546 Bacteria 2693
25 Ga0070696_100071798 3300005546 Bacteria 2436
26 Ga0070696_100392305 3300005546 Bacteria 1084
27 Ga0070704_100422042 3300005549 Bacteria 1142
28 Ga0068857_100072632 3300005577 Bacteria 3066
29 Ga0068854_100524380 3300005578 Bacteria 1001
30 Ga0068859_100139526 3300005617 Bacteria 2497
31 Ga0068866_10010214 3300005718 Bacteria 4016
32 Ga0068861_100022361 3300005719 Bacteria 4554
33 Ga0068861_100033032 3300005719 Bacteria 3814
34 Ga0068862_100020857 3300005844 Bacteria 5473
35 Ga0070712_100752786 3300006175 Bacteria 834
36 Ga0075366_10043538 3300006195 Bacteria 2659
37 Ga0075428_100014893 3300006844 Bacteria 8641
38 Ga0075428_100026846 3300006844 Bacteria 6376
39 Ga0075428_100123726 3300006844 Bacteria 2815
40 Ga0075430_100070749 3300006846 Bacteria 2926
41 Ga0075433_10093932 3300006852 Bacteria 2654
42 Ga0075429_100096373 3300006880 Bacteria 2581
43 Ga0068865_100004766 3300006881 Bacteria 8203
44 Ga0068865_100203924 3300006881 Bacteria 1537
45 Ga0097620_100139528 3300006931 Bacteria 2497
46 Ga0075435_100191575 3300007076 Bacteria 1731
47 Ga0111539_10068055 3300009094 Bacteria 4204
48 Ga0111539_10622483 3300009094 Bacteria 1257
49 Ga0111539_10844963 3300009094 Bacteria 1065
50 Ga0114129_10181072 3300009147 Bacteria 2867
51 Ga0105243_10120343 3300009148 Bacteria 2212
52 Ga0157380_10164453 3300014326 Bacteria 1932
53 Ga0157380_10415684 3300014326 Bacteria 1281
54 Ga0213876_10025974 3300021384 Bacteria 3089
55 Ga0209256_1025823 3300025299 Bacteria 1705
56 Ga0207682_10031777 3300025893 Bacteria 2120
57 Ga0207642_10104940 3300025899 Bacteria 1427
58 Ga0207699_10252218 3300025906 Bacteria 1216
59 Ga0207645_10010238 3300025907 Bacteria 6445
60 Ga0207693_10183835 3300025915 Bacteria 1645
61 Ga0207663_10127008 3300025916 Bacteria 1756
62 Ga0207660_10158516 3300025917 Bacteria 1744
63 Ga0207700_10224790 3300025928 Bacteria 1593
64 Ga0207664_10021065 3300025929 Bacteria 4840
65 Ga0207664_10051858 3300025929 Bacteria 3242
66 Ga0207664_10818998 3300025929 Bacteria 837
67 Ga0207706_10003877 3300025933 Bacteria 14227
68 Ga0207669_10031454 3300025937 Bacteria 2965
69 Ga0207691_10020921 3300025940 Bacteria 6182
70 Ga0207689_10120932 3300025942 Bacteria 2154
71 Ga0207708_10015186 3300026075 Bacteria 5772
72 Ga0207648_10000313 3300026089 Bacteria 53237
73 Ga0207648_10098266 3300026089 Bacteria 2563
74 Ga0207675_100012427 3300026118 Bacteria 7956
75 Ga0207675_100012828 3300026118 Bacteria 7828
76 Ga0207683_10130802 3300026121 Bacteria 2257
77 Ga0207683_10224402 3300026121 Bacteria 1712
78 Ga0209984_1010755 3300027424 Bacteria 1179
79 Ga0209970_1002321 3300027614 Bacteria 3248
80 Ga0210002_1000845 3300027617 Bacteria 4181
81 Ga0209983_1001121 3300027665 Bacteria 5913
82 Ga0209971_1000853 3300027682 Bacteria 7855
83 Ga0209966_1003250 3300027695 Bacteria 2732
84 Ga0209966_1003514 3300027695 Bacteria 2639
85 Ga0209974_10000548 3300027876 Bacteria 12544
86 Ga0207428_10034422 3300027907 Bacteria 4151
87 Ga0207428_10056726 3300027907 Bacteria 3111
88 Ga0207428_10179517 3300027907 Bacteria 1600
89 Ga0268265_10056930 3300028380 Bacteria 2977
90 Ga0265334_10000005 3300028573 Bacteria 242590
91 Ga0265318_10086108 3300028577 Bacteria 1158
92 Ga0265336_10010889 3300028666 Bacteria 3103
93 Ga0265338_10006324 3300028800 Bacteria 15135
94 Ga0265331_10038283 3300031250 Bacteria 2345
95 Ga0265327_10003993 3300031251 Bacteria 13449
96 Ga0265327_10046965 3300031251 Bacteria 2281
97 Ga0307408_100088152 3300031548 Bacteria 2336
98 Ga0265313_10000014 3300031595 Bacteria 156295
99 Ga0316576_10160654 3300031727 Bacteria 1695
100 Ga0316578_10015240 3300031728 Bacteria 4129
101 Ga0316578_10068019 3300031728 Bacteria 2106
102 Ga0316577_10007369 3300031733 Bacteria 5868
103 Ga0316577_10010745 3300031733 Bacteria 4947
104 Ga0316577_10202018 3300031733 Bacteria 1123
105 Ga0307413_10065924 3300031824 Bacteria 2257
106 Ga0307406_10015233 3300031901 Bacteria 4444
107 Ga0307406_10311494 3300031901 Bacteria 1214
108 Ga0307416_100355107 3300032002 Bacteria 1485
109 Ga0316585_10005145 3300032137 Bacteria 3682
110 Ga0316593_10000027 3300032168 Bacteria 15426
111 Ga0316593_10002148 3300032168 Bacteria 4599
112 Ga0316593_10003055 3300032168 Bacteria 4085
113 Ga0316593_10004139 3300032168 Bacteria 3687
114 Ga0316593_10005483 3300032168 Bacteria 3351
115 Ga0316593_10014042 3300032168 Bacteria 2382
116 Ga0316593_10019240 3300032168 Bacteria 2108
117 Ga0316593_10021714 3300032168 Bacteria 2009
118 Ga0316593_10026472 3300032168 Bacteria 1855
119 Ga0316593_10047315 3300032168 Bacteria 1446
120 Ga0316593_10074691 3300032168 Bacteria 1176
121 Ga0316593_10086368 3300032168 Bacteria 1100
122 Ga0316592_1000006 3300033524 Bacteria 14706
123 Ga0316592_1000008 3300033524 Bacteria 14268
124 Ga0316592_1010499 3300033524 Bacteria 1870
125 Ga0316586_1000040 3300033527 Bacteria 8841
126 Ga0316586_1016579 3300033527 Bacteria 1182
127 Ga0316588_1001236 3300033528 Bacteria 4108
128 Ga0316588_1002254 3300033528 Bacteria 3344
129 Ga0316587_1000021 3300033529 Bacteria 9386
130 Ga0316587_1002879 3300033529 Bacteria 2350
131 Ga0316587_1004289 3300033529 Bacteria 2066
132 Ga0316587_1017228 3300033529 Bacteria 1210
133 Ga0316596_1000016 3300033541 Bacteria 15149
134 Ga0316596_1001024 3300033541 Bacteria 5392
135 Ga0316596_1001141 3300033541 Bacteria 5193
136 Ga0316596_1002852 3300033541 Bacteria 3738
137 Ga0316596_1002958 3300033541 Bacteria 3687
138 Ga0316596_1008222 3300033541 Bacteria 2482
139 Ga0316596_1024647 3300033541 Bacteria 1545
140 Ga0373945_0287380 3300035116 Bacteria 702
141 Ga0373954_0078373 3300035118 Bacteria 1576
142 Ga0316574_0137715 3300035398 Bacteria 1572
143 Ga0316574_0151887 3300035398 Bacteria 1492
144 Ga0373927_0000001 3300035695 Bacteria 1082160
145 Ga0316582_0206705 3300036647 Bacteria 1340
146 Ga0316584_0002043 3300036712 Bacteria 12624
147 Ga0316584_0021671 3300036712 Bacteria 4674
148 Ga0316584_0128575 3300036712 Bacteria 1892
149 Ga0316584_0857121 3300036712 Bacteria 614
150 Ga0316581_0001208 3300037588 Bacteria 5686
151 Ga0400484_24395 3300038725 Bacteria 3066
152 Ga0400484_25426 3300038725 Bacteria 1914
153 Ga0400484_30405 3300038725 Bacteria 18960
154 Ga0400490_00437 3300038726 Bacteria 17578
155 Ga0400490_07361 3300038726 Bacteria 19331
156 Ga0400490_39901 3300038726 Bacteria 15663
157 Ga0400485_02770 3300038735 Bacteria 7937
158 Ga0400485_03111 3300038735 Bacteria 2616
159 Ga0400485_19181 3300038735 Bacteria 55141
160 Ga0400488_03437 3300038741 Bacteria 8596
161 Ga0400488_25285 3300038741 Bacteria 2477
162 Ga0400488_25665 3300038741 Bacteria 1183
163 Ga0400488_39380 3300038741 Bacteria 1223
164 Ga0400488_57964 3300038741 Bacteria 3039
165 Ga0400488_58342 3300038741 Bacteria 2007
166 Ga0400486_24759 3300038742 Bacteria 1650
167 Ga0400486_25543 3300038742 Bacteria 57720
168 Ga0400486_25694 3300038742 Bacteria 15655
169 Ga0400486_26796 3300038742 Bacteria 4631
170 Ga0400483_029392 3300039062 Bacteria 3206
171 Ga0400483_057945 3300039062 Bacteria 4128
172 Ga0400483_069247 3300039062 Bacteria 1821
173 Ga0400483_140144 3300039062 Bacteria 16717
174 Ga0400483_141649 3300039062 Bacteria 8613
175 Ga0400483_173686 3300039062 Bacteria 2576
176 Ga0400483_224990 3300039062 Bacteria 1482
177 Ga0400483_243923 3300039062 Bacteria 2592
178 Ga0400489_34148 3300039093 Bacteria 5617
179 Ga0400487_02246 3300039110 Bacteria 22294
180 Ga0400487_25190 3300039110 Bacteria 4609
181 Ga0400487_28799 3300039110 Bacteria 1410
182 Ga0400487_29008 3300039110 Bacteria 14273
183 Ga0400487_33622 3300039110 Bacteria 1579
184 Ga0400487_66163 3300039110 Bacteria 6500
185 Ga0436365_1680067 3300039437 Bacteria 3128
186 Ga0439451_046025 3300042009 Bacteria 874
187 Ga0450923_021157 3300042125 Bacteria 1266
188 Ga0450891_001604 3300042129 Bacteria 2329
189 Ga0450905_029005 3300042142 Bacteria 846
190 Ga0439435_0050897 3300042436 Bacteria 1185
191 Ga0439464_0045474 3300042439 Bacteria 1260
192 Ga0450893_0037086 3300042532 Unclassified 883
193 Ga0495630_0006403 3300046517 Bacteria 8376
194 Ga0501306_000035 3300049127 Bacteria 7508
195 Ga0501315_000686 3300049531 Bacteria 2491
196 Ga0501032_0430495 3300049569 Bacteria 846
197 Ga0501034_0075626 3300049571 Bacteria 3374
198 Ga0501036_0081358 3300049572 Bacteria 2737
199 Ga0501037_0321782 3300049573 Bacteria 1071
200 Ga0501040_0284222 3300049576 Bacteria 1182
201 Ga0501040_0392027 3300049576 Bacteria 997
202 Ga0501040_0479683 3300049576 Bacteria 896
203 Ga0501041_0117755 3300049577 Bacteria 1650
204 Ga0501042_0108368 3300049578 Bacteria 2000
205 Ga0501042_0125025 3300049578 Bacteria 1852
206 Ga0501042_0165490 3300049578 Bacteria 1596
207 Ga0501042_0166992 3300049578 Bacteria 1588
208 Ga0501046_0090108 3300049580 Bacteria 2360
209 Ga0501071_0021715 3300049587 Bacteria 4474
210 Ga0501071_0122185 3300049587 Bacteria 1931
211 Ga0501071_0331548 3300049587 Bacteria 1157
212 Ga0501072_0028264 3300049588 Bacteria 4378
213 Ga0501074_0099317 3300049590 Bacteria 2084
214 Ga0501075_0058424 3300049591 Bacteria 2905
215 Ga0501075_0361263 3300049591 Bacteria 1107
216 Ga0501076_0096937 3300049592 Bacteria 2376
217 Ga0501076_0175591 3300049592 Bacteria 1746
218 Ga0501079_0080331 3300049741 Bacteria 2522
219 Ga0501079_0318259 3300049741 Bacteria 1218
220 Ga0501081_0395853 3300049743 Bacteria 1022
221 Ga0501045_0536779 3300049824 Bacteria 868
222 Ga0501226_032628 3300049853 Bacteria 594
223 nmdc:mga03n38_745387_c1 3300050490 Bacteria 567
224 nmdc:mga0k408_11178_c2 3300050493 Bacteria 3273
225 nmdc:mga05p37_270114_c1 3300050507 Bacteria 2032
226 nmdc:mga09592_102822_c1 3300050508 Bacteria 2448
227 nmdc:mga09592_296174_c1 3300050508 Bacteria 1403
228 nmdc:mga06r32_24034_c1 3300050510 Bacteria 5650
229 nmdc:mga06r32_381841_c1 3300050510 Bacteria 1392
230 nmdc:mga08y16_15367_c1 3300050511 Bacteria 8050
231 nmdc:mga08y16_215981_c1 3300050511 Bacteria 1986
232 nmdc:mga08y16_54932_c1 3300050511 Bacteria 4162
233 nmdc:mga08y16_69402_c1 3300050511 Bacteria 3674
234 nmdc:mga0rr50_174995_c1 3300050513 Bacteria 1751
235 nmdc:mga0a205_71944_c1 3300050515 Bacteria 3340
236 Ga0500562_045216 3300053108 Bacteria 1173
237 Ga0587111_0009586 3300060346 Bacteria 1638
238 Ga0501082_0666378 3300060353 Bacteria 911
239 Ga0501082_0893036 3300060353 Bacteria 777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042009 Ga0439451_046025 Ga0439451_046025_28_528 143
2 3300005435 Ga0070714_100013986 Ga0070714_1000139864 163
3 3300005435 Ga0070714_100127768 Ga0070714_1001277682 163
4 3300005436 Ga0070713_100379375 Ga0070713_1003793753 163
5 3300005439 Ga0070711_100011694 Ga0070711_1000116944 163
6 3300005439 Ga0070711_100274436 Ga0070711_1002744363 163
7 3300025906 Ga0207699_10252218 Ga0207699_102522182 163
8 3300025916 Ga0207663_10127008 Ga0207663_101270083 163
9 3300025928 Ga0207700_10224790 Ga0207700_102247902 163
10 3300025929 Ga0207664_10021065 Ga0207664_100210654 163
11 3300025929 Ga0207664_10051858 Ga0207664_100518584 163
12 3300025929 Ga0207664_10818998 Ga0207664_108189981 163
13 3300035118 Ga0373954_0078373 Ga0373954_0078373_780_1391 163
14 3300028573 Ga0265334_10000005 Ga0265334_10000005216 164
15 3300031595 Ga0265313_10000014 Ga0265313_10000014150 164
16 3300046517 Ga0495630_0006403 Ga0495630_0006403_6427_7038 164
17 3300006175 Ga0070712_100752786 Ga0070712_1007527862 165
18 3300025915 Ga0207693_10183835 Ga0207693_101838352 165
19 3300035695 Ga0373927_0000001 Ga0373927_0000001_678938_679549 165
20 3300035116 Ga0373945_0287380 Ga0373945_0287380_179_682 166
21 3300042142 Ga0450905_029005 Ga0450905_029005_44_544 166
22 3300049853 Ga0501226_032628 Ga0501226_032628_13_513 166
23 3300050490 nmdc:mga03n38_745387_c1 nmdc:mga03n38_745387_c1_35_544 166
24 3300009094 Ga0111539_10844963 Ga0111539_108449632 167
25 3300005577 Ga0068857_100072632 Ga0068857_1000726323 168
26 3300005718 Ga0068866_10010214 Ga0068866_100102143 168
27 3300006844 Ga0075428_100026846 Ga0075428_1000268467 168
28 3300049578 Ga0501042_0108368 Ga0501042_0108368_165_785 168
29 3300049592 Ga0501076_0175591 Ga0501076_0175591_685_1305 168
30 3300050511 nmdc:mga08y16_54932_c1 nmdc:mga08y16_54932_c1_385_1011 168
31 3300003503 JGI26141J51220_1002702 JGI26141J51220_10027022 169
32 3300005328 Ga0070676_10007412 Ga0070676_100074123 169
33 3300005356 Ga0070674_100013931 Ga0070674_1000139314 169
34 3300005457 Ga0070662_100015089 Ga0070662_10001508912 169
35 3300005459 Ga0068867_100012134 Ga0068867_1000121346 169
36 3300005543 Ga0070672_100008185 Ga0070672_1000081854 169
37 3300005546 Ga0070696_100071798 Ga0070696_1000717981 169
38 3300005719 Ga0068861_100033032 Ga0068861_1000330323 169
39 3300005844 Ga0068862_100020857 Ga0068862_1000208574 169
40 3300006844 Ga0075428_100123726 Ga0075428_1001237262 169
41 3300006846 Ga0075430_100070749 Ga0075430_1000707492 169
42 3300006881 Ga0068865_100004766 Ga0068865_1000047666 169
43 3300009147 Ga0114129_10181072 Ga0114129_101810722 169
44 3300014326 Ga0157380_10164453 Ga0157380_101644533 169
45 3300025893 Ga0207682_10031777 Ga0207682_100317774 169
46 3300025907 Ga0207645_10010238 Ga0207645_100102383 169
47 3300025917 Ga0207660_10158516 Ga0207660_101585162 169
48 3300025933 Ga0207706_10003877 Ga0207706_100038776 169
49 3300025937 Ga0207669_10031454 Ga0207669_100314546 169
50 3300025940 Ga0207691_10020921 Ga0207691_100209213 169
51 3300026089 Ga0207648_10000313 Ga0207648_100003136 169
52 3300026118 Ga0207675_100012828 Ga0207675_1000128286 169
53 3300027424 Ga0209984_1010755 Ga0209984_10107552 169
54 3300027614 Ga0209970_1002321 Ga0209970_10023213 169
55 3300027617 Ga0210002_1000845 Ga0210002_10008453 169
56 3300027665 Ga0209983_1001121 Ga0209983_10011213 169
57 3300027682 Ga0209971_1000853 Ga0209971_10008536 169
58 3300027695 Ga0209966_1003250 Ga0209966_10032502 169
59 3300027876 Ga0209974_10000548 Ga0209974_1000054818 169
60 3300027907 Ga0207428_10034422 Ga0207428_100344223 169
61 3300028380 Ga0268265_10056930 Ga0268265_100569302 169
62 3300042125 Ga0450923_021157 Ga0450923_021157_75_695 169
63 3300042436 Ga0439435_0050897 Ga0439435_0050897_284_904 169
64 3300042532 Ga0450893_0037086 Ga0450893_0037086_129_749 169
65 3300049569 Ga0501032_0430495 Ga0501032_0430495_184_804 169
66 3300049572 Ga0501036_0081358 Ga0501036_0081358_90_710 169
67 3300049576 Ga0501040_0392027 Ga0501040_0392027_29_649 169
68 3300049580 Ga0501046_0090108 Ga0501046_0090108_1467_2087 169
69 3300049587 Ga0501071_0122185 Ga0501071_0122185_1261_1881 169
70 3300049588 Ga0501072_0028264 Ga0501072_0028264_1407_2027 169
71 3300049591 Ga0501075_0058424 Ga0501075_0058424_1067_1687 169
72 3300049741 Ga0501079_0318259 Ga0501079_0318259_372_992 169
73 3300050507 nmdc:mga05p37_270114_c1 nmdc:mga05p37_270114_c1_964_1584 169
74 3300050508 nmdc:mga09592_296174_c1 nmdc:mga09592_296174_c1_19_639 169
75 3300050510 nmdc:mga06r32_24034_c1 nmdc:mga06r32_24034_c1_1986_2606 169
76 3300050510 nmdc:mga06r32_381841_c1 nmdc:mga06r32_381841_c1_105_725 169
77 3300050511 nmdc:mga08y16_69402_c1 nmdc:mga08y16_69402_c1_65_685 169
78 3300036712 Ga0316584_0857121 Ga0316584_0857121_12_527 171
79 3300031728 Ga0316578_10015240 Ga0316578_100152405 172
80 3300031733 Ga0316577_10007369 Ga0316577_100073693 172
81 3300032168 Ga0316593_10003055 Ga0316593_100030553 172
82 3300033524 Ga0316592_1010499 Ga0316592_10104993 172
83 3300033541 Ga0316596_1008222 Ga0316596_10082223 172
84 3300036647 Ga0316582_0206705 Ga0316582_0206705_662_1264 172
85 3300036712 Ga0316584_0002043 Ga0316584_0002043_7308_7910 172
86 3300031901 Ga0307406_10311494 Ga0307406_103114942 173
87 3300042439 Ga0439464_0045474 Ga0439464_0045474_240_860 175
88 3300026121 Ga0207683_10224402 Ga0207683_102244022 176
89 3300033529 Ga0316587_1002879 Ga0316587_10028793 182
90 3300035398 Ga0316574_0137715 Ga0316574_0137715_571_1173 182
91 3300031727 Ga0316576_10160654 Ga0316576_101606543 190
92 3300031728 Ga0316578_10068019 Ga0316578_100680193 190
93 3300031733 Ga0316577_10010745 Ga0316577_1001074511 190
94 3300032137 Ga0316585_10005145 Ga0316585_100051454 190
95 3300032168 Ga0316593_10005483 Ga0316593_100054832 190
96 3300033527 Ga0316586_1016579 Ga0316586_10165793 190
97 3300033541 Ga0316596_1002852 Ga0316596_10028524 190
98 3300038726 Ga0400490_00437 Ga0400490_00437_1144_1716 190
99 3300049127 Ga0501306_000035 Ga0501306_000035_6196_6810 191
100 3300049531 Ga0501315_000686 Ga0501315_000686_709_1323 191
101 3300031251 Ga0265327_10046965 Ga0265327_100469652 196
102 iso_pu_bacteria 8054357960 8054359132 197
103 3300031733 Ga0316577_10202018 Ga0316577_102020182 200
104 3300032168 Ga0316593_10014042 Ga0316593_100140423 200
105 3300032168 Ga0316593_10019240 Ga0316593_100192404 200
106 3300032168 Ga0316593_10026472 Ga0316593_100264723 200
107 3300033541 Ga0316596_1001024 Ga0316596_100102412 200
108 3300033541 Ga0316596_1024647 Ga0316596_10246473 200
109 3300035398 Ga0316574_0151887 Ga0316574_0151887_840_1442 200
110 3300036712 Ga0316584_0128575 Ga0316584_0128575_576_1178 200
111 3300037588 Ga0316581_0001208 Ga0316581_0001208_1180_1782 200
112 iso_pu_bacteria 2738541276 2738716718 200
113 iso_pu_bacteria 8001522603 8001524062 200
114 3300005334 Ga0068869_100042588 Ga0068869_1000425882 201
115 3300005336 Ga0070680_100073142 Ga0070680_1000731423 201
116 3300005337 Ga0070682_100087381 Ga0070682_1000873811 201
117 3300005354 Ga0070675_100245605 Ga0070675_1002456052 201
118 3300005441 Ga0070700_100150466 Ga0070700_1001504662 201
119 3300005444 Ga0070694_100272166 Ga0070694_1002721662 201
120 3300005456 Ga0070678_100282957 Ga0070678_1002829572 201
121 3300005459 Ga0068867_100462052 Ga0068867_1004620522 201
122 3300005546 Ga0070696_100058420 Ga0070696_1000584203 201
123 3300005546 Ga0070696_100392305 Ga0070696_1003923052 201
124 3300005549 Ga0070704_100422042 Ga0070704_1004220422 201
125 3300005578 Ga0068854_100524380 Ga0068854_1005243802 201
126 3300005617 Ga0068859_100139526 Ga0068859_1001395261 201
127 3300005719 Ga0068861_100022361 Ga0068861_1000223615 201
128 3300006195 Ga0075366_10043538 Ga0075366_100435382 201
129 3300006844 Ga0075428_100014893 Ga0075428_10001489315 201
130 3300006852 Ga0075433_10093932 Ga0075433_100939322 201
131 3300006880 Ga0075429_100096373 Ga0075429_1000963733 201
132 3300006881 Ga0068865_100203924 Ga0068865_1002039243 201
133 3300006931 Ga0097620_100139528 Ga0097620_1001395281 201
134 3300007076 Ga0075435_100191575 Ga0075435_1001915752 201
135 3300009094 Ga0111539_10068055 Ga0111539_100680554 201
136 3300009094 Ga0111539_10622483 Ga0111539_106224833 201
137 3300009148 Ga0105243_10120343 Ga0105243_101203433 201
138 3300014326 Ga0157380_10415684 Ga0157380_104156842 201
139 3300021384 Ga0213876_10025974 Ga0213876_100259744 201
140 3300025899 Ga0207642_10104940 Ga0207642_101049402 201
141 3300025942 Ga0207689_10120932 Ga0207689_101209324 201
142 3300026075 Ga0207708_10015186 Ga0207708_100151863 201
143 3300026089 Ga0207648_10098266 Ga0207648_100982663 201
144 3300026118 Ga0207675_100012427 Ga0207675_1000124272 201
145 3300026121 Ga0207683_10130802 Ga0207683_101308023 201
146 3300027695 Ga0209966_1003514 Ga0209966_10035143 201
147 3300027907 Ga0207428_10056726 Ga0207428_100567265 201
148 3300027907 Ga0207428_10179517 Ga0207428_101795173 201
149 3300039437 Ga0436365_1680067 Ga0436365_1680067_1320_1937 201
150 3300049573 Ga0501037_0321782 Ga0501037_0321782_115_720 201
151 3300049576 Ga0501040_0284222 Ga0501040_0284222_394_999 201
152 3300049576 Ga0501040_0479683 Ga0501040_0479683_179_784 201
153 3300049577 Ga0501041_0117755 Ga0501041_0117755_305_910 201
154 3300049578 Ga0501042_0165490 Ga0501042_0165490_947_1552 201
155 3300049578 Ga0501042_0166992 Ga0501042_0166992_636_1241 201
156 3300049587 Ga0501071_0021715 Ga0501071_0021715_555_1160 201
157 3300049587 Ga0501071_0331548 Ga0501071_0331548_216_821 201
158 3300049590 Ga0501074_0099317 Ga0501074_0099317_157_762 201
159 3300049591 Ga0501075_0361263 Ga0501075_0361263_201_806 201
160 3300049592 Ga0501076_0096937 Ga0501076_0096937_772_1377 201
161 3300049741 Ga0501079_0080331 Ga0501079_0080331_1389_1994 201
162 3300049743 Ga0501081_0395853 Ga0501081_0395853_19_624 201
163 3300049824 Ga0501045_0536779 Ga0501045_0536779_65_670 201
164 3300050493 nmdc:mga0k408_11178_c2 nmdc:mga0k408_11178_c2_1611_2225 201
165 3300050508 nmdc:mga09592_102822_c1 nmdc:mga09592_102822_c1_998_1603 201
166 3300050511 nmdc:mga08y16_15367_c1 nmdc:mga08y16_15367_c1_692_1297 201
167 3300050511 nmdc:mga08y16_215981_c1 nmdc:mga08y16_215981_c1_1249_1854 201
168 3300050513 nmdc:mga0rr50_174995_c1 nmdc:mga0rr50_174995_c1_340_945 201
169 3300050515 nmdc:mga0a205_71944_c1 nmdc:mga0a205_71944_c1_1344_1949 201
170 3300053108 Ga0500562_045216 Ga0500562_045216_331_945 201
171 3300060353 Ga0501082_0666378 Ga0501082_0666378_49_654 201
172 3300060353 Ga0501082_0893036 Ga0501082_0893036_134_739 201
173 3300028800 Ga0265338_10006324 Ga0265338_1000632425 203
174 3300032168 Ga0316593_10074691 Ga0316593_100746912 203
175 3300033529 Ga0316587_1004289 Ga0316587_10042894 203
176 3300038725 Ga0400484_24395 Ga0400484_24395_455_1066 203
177 3300038725 Ga0400484_25426 Ga0400484_25426_500_1111 203
178 3300038725 Ga0400484_30405 Ga0400484_30405_12866_13477 203
179 3300038726 Ga0400490_07361 Ga0400490_07361_1910_2521 203
180 3300038726 Ga0400490_39901 Ga0400490_39901_1192_1803 203
181 3300038735 Ga0400485_02770 Ga0400485_02770_6596_7207 203
182 3300038735 Ga0400485_03111 Ga0400485_03111_1400_2011 203
183 3300038735 Ga0400485_19181 Ga0400485_19181_53388_53999 203
184 3300038741 Ga0400488_03437 Ga0400488_03437_2767_3378 203
185 3300038741 Ga0400488_25285 Ga0400488_25285_661_1272 203
186 3300038741 Ga0400488_25665 Ga0400488_25665_382_993 203
187 3300038741 Ga0400488_39380 Ga0400488_39380_41_652 203
188 3300038741 Ga0400488_57964 Ga0400488_57964_1104_1715 203
189 3300038741 Ga0400488_58342 Ga0400488_58342_679_1290 203
190 3300038742 Ga0400486_24759 Ga0400486_24759_11_622 203
191 3300038742 Ga0400486_25543 Ga0400486_25543_55967_56578 203
192 3300038742 Ga0400486_25694 Ga0400486_25694_12519_13130 203
193 3300038742 Ga0400486_26796 Ga0400486_26796_2901_3512 203
194 3300039062 Ga0400483_057945 Ga0400483_057945_59_670 203
195 3300039062 Ga0400483_069247 Ga0400483_069247_711_1322 203
196 3300039062 Ga0400483_140144 Ga0400483_140144_1730_2341 203
197 3300039062 Ga0400483_141649 Ga0400483_141649_7282_7893 203
198 3300039062 Ga0400483_173686 Ga0400483_173686_737_1348 203
199 3300039062 Ga0400483_243923 Ga0400483_243923_757_1368 203
200 3300039093 Ga0400489_34148 Ga0400489_34148_1543_2154 203
201 3300039110 Ga0400487_02246 Ga0400487_02246_17766_18377 203
202 3300039110 Ga0400487_25190 Ga0400487_25190_1025_1636 203
203 3300039110 Ga0400487_28799 Ga0400487_28799_769_1380 203
204 3300039110 Ga0400487_29008 Ga0400487_29008_1131_1742 203
205 3300039110 Ga0400487_33622 Ga0400487_33622_380_991 203
206 3300039110 Ga0400487_66163 Ga0400487_66163_2086_2697 203
207 3300003323 rootH1_10060094 rootH1_1006009410 204
208 3300003574 Ga0007410J51695_1019754 Ga0007410J51695_10197543 204
209 3300005331 Ga0070670_100000015 Ga0070670_1000000154 204
210 3300005367 Ga0070667_100593195 Ga0070667_1005931951 204
211 3300025299 Ga0209256_1025823 Ga0209256_10258233 204
212 3300028577 Ga0265318_10086108 Ga0265318_100861082 204
213 3300028666 Ga0265336_10010889 Ga0265336_100108894 204
214 3300031250 Ga0265331_10038283 Ga0265331_100382832 204
215 3300031251 Ga0265327_10003993 Ga0265327_1000399325 204
216 3300031548 Ga0307408_100088152 Ga0307408_1000881522 204
217 3300031824 Ga0307413_10065924 Ga0307413_100659243 204
218 3300031901 Ga0307406_10015233 Ga0307406_100152339 204
219 3300032002 Ga0307416_100355107 Ga0307416_1003551073 204
220 3300032168 Ga0316593_10000027 Ga0316593_1000002726 204
221 3300032168 Ga0316593_10002148 Ga0316593_100021487 204
222 3300032168 Ga0316593_10004139 Ga0316593_100041396 204
223 3300032168 Ga0316593_10021714 Ga0316593_100217143 204
224 3300032168 Ga0316593_10047315 Ga0316593_100473152 204
225 3300032168 Ga0316593_10086368 Ga0316593_100863682 204
226 3300033524 Ga0316592_1000006 Ga0316592_10000064 204
227 3300033524 Ga0316592_1000008 Ga0316592_10000084 204
228 3300033527 Ga0316586_1000040 Ga0316586_100004017 204
229 3300033528 Ga0316588_1001236 Ga0316588_10012364 204
230 3300033528 Ga0316588_1002254 Ga0316588_10022543 204
231 3300033529 Ga0316587_1000021 Ga0316587_10000214 204
232 3300033529 Ga0316587_1017228 Ga0316587_10172282 204
233 3300033541 Ga0316596_1000016 Ga0316596_100001626 204
234 3300033541 Ga0316596_1001141 Ga0316596_10011419 204
235 3300033541 Ga0316596_1002958 Ga0316596_10029586 204
236 3300036712 Ga0316584_0021671 Ga0316584_0021671_4040_4654 204
237 3300039062 Ga0400483_029392 Ga0400483_029392_1411_2028 204
238 3300039062 Ga0400483_224990 Ga0400483_224990_457_1071 204
239 3300042129 Ga0450891_001604 Ga0450891_001604_718_1332 204
240 3300049571 Ga0501034_0075626 Ga0501034_0075626_366_980 204
241 3300049578 Ga0501042_0125025 Ga0501042_0125025_147_767 204
242 3300060346 Ga0587111_0009586 Ga0587111_0009586_692_1306 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

204

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9506 7 204
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9498 3 204
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9444 7 204
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9442 1 204
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9436 3 204
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7931 1 204 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7887 1 204 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7565 1 204 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7528 1 204 3.40.1370.10
af_Q54RB5_40_257_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7244 1 203 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A1G5SFL3-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9895 104 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A484Y9P8-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9847 126 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2G6KQ82-F1-model_v4 50S ribosomal protein L4 0.9826 127 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A536U9H5-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9815 99 204 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A534DYB7-F1-model_v4 deleted 0.9776 120 204

Feature Viewer

pLDDT pTM Quality
78.13 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map