F354768

General Info

Members Datasets Scaffolds Average Seq Length
242 171 242 251

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10061753|Ga0207683_100617534
Length 305
Sequence MPARAELAPSAHGGAPAEHTLGRGKSLPRPRLSGTVPRPFVFLRKTVWFFMPPPRRIQLSQDMLIAVFGDSWPAEDVSAAAELLAGGEGRFPSGIRSLPSDLVRAVQRERLLAATMRASAELGYEEFSVQDVLDRAGVSRPTFYEHFANKEDGFLAAFDAATLRLLSRLERAGGSESESWRERLRLSLEELLRFVREEPDAAMTLVVDSRAATPAAMQRRDELLERLADCLDTEVRAGISEAPAPSAISAAGIVGGIESLLYSRLYRGEGDDLGSLLPSLMYFAVLPYEGHEAASEEMNAATTVG

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 10.74
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10001377 3300002239 Bacteria 3219
2 Ga0070683_100000269 3300005329 Bacteria 35724
3 Ga0070683_100006749 3300005329 Bacteria 9639
4 Ga0070677_10001579 3300005333 Bacteria 7211
5 Ga0070666_10198938 3300005335 Bacteria 1410
6 Ga0070691_10000052 3300005341 Bacteria 32264
7 Ga0070673_100002079 3300005364 Bacteria 12071
8 Ga0070667_100546720 3300005367 Unclassified 1064
9 Ga0070713_100018675 3300005436 Bacteria 5272
10 Ga0070700_100014855 3300005441 Bacteria 4401
11 Ga0070663_100006309 3300005455 Bacteria 7116
12 Ga0070662_100000005 3300005457 Bacteria 183056
13 Ga0070681_10006346 3300005458 Bacteria 11499
14 Ga0068867_100003856 3300005459 Bacteria 10543
15 Ga0070679_100000860 3300005530 Bacteria 26409
16 Ga0070684_100035808 3300005535 Bacteria 4250
17 Ga0068853_100003888 3300005539 Bacteria 11450
18 Ga0070672_100000018 3300005543 Bacteria 70205
19 Ga0070693_100000319 3300005547 Bacteria 22093
20 Ga0070665_100000341 3300005548 Bacteria 70565
21 Ga0070665_100000846 3300005548 Bacteria 39881
22 Ga0070665_100079136 3300005548 Bacteria 3293
23 Ga0070665_100581710 3300005548 Bacteria 1133
24 Ga0068855_100149111 3300005563 Bacteria 2660
25 Ga0068854_100007541 3300005578 Bacteria 6953
26 Ga0068856_100000654 3300005614 Bacteria 37552
27 Ga0068856_100017230 3300005614 Bacteria 7001
28 Ga0068856_100704600 3300005614 Bacteria 1030
29 Ga0068866_10062839 3300005718 Bacteria 1933
30 Ga0068861_100072550 3300005719 Bacteria 2671
31 Ga0068861_100402554 3300005719 Bacteria 1215
32 Ga0068851_10028211 3300005834 Bacteria 2772
33 Ga0068863_100004151 3300005841 Bacteria 14307
34 Ga0068858_100000251 3300005842 Bacteria 57269
35 Ga0070715_10000011 3300006163 Bacteria 183857
36 Ga0068865_100100561 3300006881 Bacteria 2116
37 Ga0105240_10129845 3300009093 Bacteria 3024
38 Ga0105245_10000151 3300009098 Bacteria 65950
39 Ga0105245_10000743 3300009098 Bacteria 29457
40 Ga0105247_10097846 3300009101 Bacteria 1872
41 Ga0114129_10867412 3300009147 Bacteria 1146
42 Ga0105242_10024291 3300009176 Bacteria 4785
43 Ga0105242_10052016 3300009176 Bacteria 3341
44 Ga0105248_10588430 3300009177 Bacteria 1256
45 Ga0105249_10000371 3300009553 Bacteria 44499
46 Ga0105239_10828721 3300010375 Bacteria 1060
47 Ga0157374_10034713 3300013296 Bacteria 4610
48 Ga0157378_10000598 3300013297 Bacteria 33812
49 Ga0157378_10028090 3300013297 Bacteria 4961
50 Ga0157375_10002149 3300013308 Bacteria 17037
51 Ga0157375_10346500 3300013308 Bacteria 1651
52 Ga0157375_10736230 3300013308 Unclassified 1138
53 Ga0163163_10204709 3300014325 Bacteria 2022
54 Ga0163163_10450316 3300014325 Bacteria 1347
55 Ga0157380_10000604 3300014326 Bacteria 22074
56 Ga0157377_10099105 3300014745 Unclassified 1733
57 Ga0157379_10022718 3300014968 Bacteria 5558
58 Ga0157376_10020413 3300014969 Bacteria 5124
59 Ga0206352_11043552 3300020078 Bacteria 1025
60 Ga0207656_10001576 3300025321 Bacteria 7583
61 Ga0207682_10002923 3300025893 Bacteria 7535
62 Ga0207642_10000001 3300025899 Bacteria 714030
63 Ga0207685_10000001 3300025905 Bacteria 604473
64 Ga0207707_10025899 3300025912 Bacteria 5129
65 Ga0207695_10396118 3300025913 Bacteria 1265
66 Ga0207671_10200207 3300025914 Bacteria 1559
67 Ga0207663_10013396 3300025916 Bacteria 4457
68 Ga0207660_10435076 3300025917 Unclassified 1059
69 Ga0207652_10001058 3300025921 Bacteria 25049
70 Ga0207652_10008865 3300025921 Bacteria 8104
71 Ga0207687_10000037 3300025927 Bacteria 120493
72 Ga0207687_10000399 3300025927 Bacteria 29473
73 Ga0207700_10000016 3300025928 Bacteria 202434
74 Ga0207706_10000006 3300025933 Bacteria 216994
75 Ga0207686_10008296 3300025934 Bacteria 5606
76 Ga0207686_10031900 3300025934 Bacteria 3132
77 Ga0207704_10062711 3300025938 Bacteria 2313
78 Ga0207691_10000121 3300025940 Bacteria 70558
79 Ga0207661_10000068 3300025944 Bacteria 70953
80 Ga0207661_10001761 3300025944 Bacteria 14817
81 Ga0207661_10031358 3300025944 Bacteria 4105
82 Ga0207661_10088650 3300025944 Bacteria 2572
83 Ga0207651_10026101 3300025960 Bacteria 3643
84 Ga0207712_10000037 3300025961 Bacteria 195906
85 Ga0207640_10005407 3300025981 Bacteria 6963
86 Ga0207658_10077774 3300025986 Bacteria 2532
87 Ga0207677_10000478 3300026023 Bacteria 26224
88 Ga0207703_10000128 3300026035 Bacteria 91359
89 Ga0207678_10194730 3300026067 Bacteria 1732
90 Ga0207708_10025886 3300026075 Bacteria 4438
91 Ga0207702_10000099 3300026078 Bacteria 100461
92 Ga0207702_10012047 3300026078 Bacteria 7190
93 Ga0207641_10008573 3300026088 Bacteria 8443
94 Ga0207648_10005689 3300026089 Bacteria 12502
95 Ga0207675_100111031 3300026118 Bacteria 2587
96 Ga0207683_10061753 3300026121 Bacteria 3298
97 Ga0268266_10000020 3300028379 Bacteria 527065
98 Ga0268266_10000342 3300028379 Bacteria 72894
99 Ga0268266_10003048 3300028379 Bacteria 17158
100 Ga0265319_1000091 3300028563 Bacteria 70394
101 Ga0265338_10000752 3300028800 Bacteria 55238
102 Ga0265325_10007063 3300031241 Bacteria 6762
103 Ga0265331_10043717 3300031250 Bacteria 2168
104 Ga0373956_0094611 3300035119 Bacteria 1381
105 Ga0373937_0119145 3300036401 Bacteria 2459
106 Ga0451853_0689214 3300041512 Bacteria 1928
107 Ga0451853_1541713 3300041512 Bacteria 2110
108 Ga0495592_0000532 3300046454 Bacteria 27337
109 Ga0495629_0000552 3300046459 Bacteria 30604
110 Ga0495629_0003869 3300046459 Bacteria 11288
111 Ga0495629_0011678 3300046459 Bacteria 6373
112 Ga0495641_0000001 3300046461 Bacteria 485224
113 Ga0495641_0005533 3300046461 Bacteria 8485
114 Ga0495651_0021442 3300046462 Bacteria 5022
115 Ga0495653_0031267 3300046463 Unclassified 4232
116 Ga0495653_0165635 3300046463 Bacteria 1530
117 Ga0495662_0001430 3300046476 Bacteria 11822
118 Ga0495594_0000007 3300046499 Bacteria 160047
119 Ga0495606_0000057 3300046507 Bacteria 197956
120 Ga0495608_0000788 3300046511 Bacteria 22260
121 Ga0495608_0105454 3300046511 Bacteria 1814
122 Ga0495618_0000431 3300046514 Bacteria 30196
123 Ga0495620_0001409 3300046515 Bacteria 14438
124 Ga0495628_0028830 3300046516 Bacteria 4508
125 Ga0495628_0030900 3300046516 Unclassified 4334
126 Ga0495630_0000011 3300046517 Bacteria 232063
127 Ga0495630_0001454 3300046517 Bacteria 16406
128 Ga0495630_0008980 3300046517 Bacteria 7178
129 Ga0495644_0003814 3300046523 Bacteria 5927
130 Ga0495652_0000003 3300046529 Bacteria 597094
131 Ga0495652_0051866 3300046529 Bacteria 3501
132 Ga0495652_0288221 3300046529 Bacteria 1199
133 Ga0495640_0010051 3300046533 Bacteria 7335
134 Ga0495586_0001585 3300046535 Bacteria 12509
135 Ga0495598_0007409 3300046537 Bacteria 2517
136 Ga0495622_0000437 3300046557 Bacteria 27136
137 Ga0495657_0056127 3300046675 Bacteria 2624
138 Ga0495599_0026454 3300046678 Bacteria 3636
139 Ga0495647_0000351 3300046681 Bacteria 12999
140 Ga0495669_0006336 3300046684 Bacteria 4943
141 Ga0495613_0000654 3300046689 Bacteria 27451
142 Ga0495613_0007052 3300046689 Bacteria 8364
143 Ga0495624_0003396 3300046690 Bacteria 11814
144 Ga0495624_0006879 3300046690 Bacteria 8028
145 Ga0495624_0032697 3300046690 Bacteria 3371
146 Ga0495670_0047674 3300046691 Unclassified 2142
147 Ga0495600_0018864 3300046809 Bacteria 4400
148 Ga0495604_0000078 3300047317 Bacteria 83632
149 Ga0495674_0001786 3300047319 Bacteria 21206
150 Ga0495676_0000554 3300047321 Bacteria 30721
151 Ga0495676_0026802 3300047321 Bacteria 4953
152 Ga0495680_0005689 3300047322 Bacteria 11667
153 Ga0495680_0011137 3300047322 Bacteria 7986
154 Ga0496100_0000007 3300048903 Bacteria 261266
155 Ga0496101_0000013 3300048904 Bacteria 261266
156 Ga0496102_0000045 3300048905 Bacteria 186726
157 Ga0496102_0003511 3300048905 Bacteria 13286
158 Ga0496102_0047994 3300048905 Bacteria 3882
159 Ga0496103_0000050 3300048906 Bacteria 152034
160 Ga0496104_0000013 3300048907 Bacteria 397163
161 Ga0496104_0003112 3300048907 Bacteria 14308
162 Ga0496104_0017049 3300048907 Bacteria 6609
163 Ga0496104_0152152 3300048907 Bacteria 2220
164 Ga0496105_0000351 3300048908 Bacteria 30325
165 Ga0496105_0012422 3300048908 Bacteria 6741
166 Ga0496105_0045032 3300048908 Bacteria 3640
167 Ga0496106_0033841 3300048909 Bacteria 3814
168 Ga0496107_0000007 3300048910 Bacteria 257113
169 Ga0496108_0000001 3300048911 Bacteria 919044
170 Ga0496108_0106825 3300048911 Bacteria 2390
171 Ga0496109_0000006 3300048912 Bacteria 325513
172 Ga0496109_0000248 3300048912 Bacteria 51780
173 Ga0496109_0440830 3300048912 Bacteria 1230
174 Ga0496109_0868724 3300048912 Bacteria 840
175 Ga0496110_0093729 3300048913 Bacteria 2688
176 Ga0496111_0013673 3300048914 Bacteria 5529
177 Ga0496114_0000003 3300048917 Bacteria 630981
178 Ga0496114_0537202 3300048917 Bacteria 1034
179 Ga0496115_0000071 3300048918 Bacteria 91922
180 Ga0496117_0004714 3300048920 Bacteria 14807
181 Ga0496118_0001304 3300048921 Bacteria 37961
182 Ga0496118_0042457 3300048921 Bacteria 3587
183 Ga0496119_0003008 3300048922 Bacteria 17854
184 Ga0496119_0012622 3300048922 Bacteria 6840
185 Ga0496120_0007264 3300048923 Bacteria 8282
186 Ga0496121_0010365 3300048924 Bacteria 10526
187 Ga0496121_0019448 3300048924 Bacteria 6789
188 Ga0496121_0369231 3300048924 Unclassified 950
189 Ga0496124_0041514 3300048927 Bacteria 3969
190 Ga0496125_0061496 3300048928 Bacteria 3011
191 Ga0496125_0110795 3300048928 Bacteria 1989
192 Ga0496126_0060822 3300048929 Bacteria 3395
193 Ga0496126_0138366 3300048929 Bacteria 2098
194 Ga0501032_0005430 3300049569 Bacteria 9470
195 Ga0501033_0002771 3300049570 Bacteria 14700
196 Ga0501034_0019221 3300049571 Bacteria 6993
197 Ga0501034_0240188 3300049571 Bacteria 1758
198 Ga0501034_0512079 3300049571 Bacteria 1113
199 Ga0501036_0007955 3300049572 Bacteria 8677
200 Ga0501037_0012861 3300049573 Bacteria 6167
201 Ga0501038_0002980 3300049574 Bacteria 15783
202 Ga0501039_0147775 3300049575 Bacteria 1847
203 Ga0501042_0019909 3300049578 Bacteria 4666
204 Ga0501042_0127641 3300049578 Bacteria 1832
205 Ga0501043_0008412 3300049579 Bacteria 8126
206 Ga0501046_0010956 3300049580 Bacteria 7774
207 Ga0501047_0004982 3300049581 Bacteria 12465
208 Ga0501047_0010632 3300049581 Bacteria 8701
209 Ga0501047_0174482 3300049581 Bacteria 2018
210 Ga0501047_0239046 3300049581 Bacteria 1667
211 Ga0501048_0008910 3300049582 Bacteria 7553
212 Ga0501068_0016514 3300049584 Bacteria 4256
213 Ga0501069_0014298 3300049585 Bacteria 4242
214 Ga0501070_0002754 3300049586 Bacteria 15347
215 Ga0501070_0007745 3300049586 Bacteria 9103
216 Ga0501070_0031218 3300049586 Bacteria 4463
217 Ga0501070_0159332 3300049586 Bacteria 1861
218 Ga0501073_0033340 3300049589 Bacteria 3667
219 Ga0501075_0005802 3300049591 Bacteria 8446
220 Ga0501076_0019795 3300049592 Bacteria 5149
221 Ga0501080_0033103 3300049742 Bacteria 4824
222 Ga0501083_0003488 3300049744 Bacteria 11002
223 Ga0501083_0008477 3300049744 Bacteria 7262
224 Ga0501035_0003459 3300049822 Bacteria 15111
225 Ga0501035_0107491 3300049822 Bacteria 2446
226 Ga0501044_0004658 3300049823 Bacteria 15347
227 Ga0501044_0157596 3300049823 Bacteria 2249
228 Ga0501045_0442585 3300049824 Bacteria 966
229 Ga0495601_0000131 3300053077 Bacteria 42431
230 Ga0495601_0007034 3300053077 Bacteria 6593
231 Ga0495601_0218575 3300053077 Bacteria 1244
232 Ga0495612_0001467 3300053078 Bacteria 9704
233 Ga0495612_0009025 3300053078 Bacteria 4044
234 Ga0495655_0000004 3300053083 Bacteria 293683
235 Ga0495595_0000101 3300053084 Bacteria 38966
236 Ga0500566_0149471 3300053094 Bacteria 1230
237 Ga0500641_0014285 3300053096 Bacteria 2928
238 Ga0500595_083900 3300053119 Unclassified 929
239 Ga0500614_000424 3300053123 Bacteria 11009
240 Ga0500628_000004 3300053129 Bacteria 202098
241 Ga0500658_0021519 3300053134 Bacteria 2444
242 Ga0501082_0012506 3300060353 Bacteria 7291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0868724 Ga0496109_0868724_140_745 201
2 3300041512 Ga0451853_0689214 Ga0451853_0689214_930_1652 217
3 3300025913 Ga0207695_10396118 Ga0207695_103961182 229
4 3300049592 Ga0501076_0019795 Ga0501076_0019795_3239_3952 235
5 3300005335 Ga0070666_10198938 Ga0070666_101989381 237
6 3300005841 Ga0068863_100004151 Ga0068863_10000415110 237
7 3300026088 Ga0207641_10008573 Ga0207641_100085734 237
8 3300049571 Ga0501034_0240188 Ga0501034_0240188_19_738 237
9 3300049823 Ga0501044_0157596 Ga0501044_0157596_107_826 237
10 3300005539 Ga0068853_100003888 Ga0068853_1000038883 238
11 3300005563 Ga0068855_100149111 Ga0068855_1001491114 238
12 3300009098 Ga0105245_10000151 Ga0105245_1000015154 238
13 3300009176 Ga0105242_10052016 Ga0105242_100520164 238
14 3300013308 Ga0157375_10346500 Ga0157375_103465001 238
15 3300025934 Ga0207686_10031900 Ga0207686_100319003 238
16 3300046511 Ga0495608_0105454 Ga0495608_0105454_443_1165 238
17 3300046517 Ga0495630_0008980 Ga0495630_0008980_1934_2656 238
18 3300046529 Ga0495652_0288221 Ga0495652_0288221_268_990 238
19 3300046690 Ga0495624_0006879 Ga0495624_0006879_5675_6397 238
20 3300047321 Ga0495676_0000554 Ga0495676_0000554_29240_29962 238
21 3300048913 Ga0496110_0093729 Ga0496110_0093729_891_1613 238
22 3300053077 Ga0495601_0000131 Ga0495601_0000131_36671_37393 238
23 3300009553 Ga0105249_10000371 Ga0105249_1000037144 239
24 3300014968 Ga0157379_10022718 Ga0157379_100227182 239
25 3300046523 Ga0495644_0003814 Ga0495644_0003814_2639_3364 239
26 3300046691 Ga0495670_0047674 Ga0495670_0047674_556_1281 239
27 3300048907 Ga0496104_0000013 Ga0496104_0000013_198_923 239
28 3300048908 Ga0496105_0045032 Ga0496105_0045032_2718_3443 239
29 3300048922 Ga0496119_0012622 Ga0496119_0012622_258_992 241
30 3300005548 Ga0070665_100581710 Ga0070665_1005817101 242
31 3300009093 Ga0105240_10129845 Ga0105240_101298452 242
32 3300009147 Ga0114129_10867412 Ga0114129_108674121 242
33 3300009177 Ga0105248_10588430 Ga0105248_105884301 242
34 3300046689 Ga0495613_0000654 Ga0495613_0000654_2720_3484 242
35 3300048905 Ga0496102_0047994 Ga0496102_0047994_228_989 242
36 3300048924 Ga0496121_0010365 Ga0496121_0010365_9256_10017 242
37 3300049581 Ga0501047_0239046 Ga0501047_0239046_834_1595 242
38 3300049744 Ga0501083_0003488 Ga0501083_0003488_5256_6017 242
39 3300005455 Ga0070663_100006309 Ga0070663_1000063091 243
40 3300025917 Ga0207660_10435076 Ga0207660_104350761 243
41 3300025921 Ga0207652_10008865 Ga0207652_100088651 243
42 3300025944 Ga0207661_10088650 Ga0207661_100886504 243
43 3300026067 Ga0207678_10194730 Ga0207678_101947301 243
44 3300020078 Ga0206352_11043552 Ga0206352_110435522 244
45 3300046463 Ga0495653_0165635 Ga0495653_0165635_64_828 244
46 3300046514 Ga0495618_0000431 Ga0495618_0000431_26765_27529 244
47 3300046690 Ga0495624_0032697 Ga0495624_0032697_2590_3354 244
48 3300046809 Ga0495600_0018864 Ga0495600_0018864_2680_3444 244
49 3300053119 Ga0500595_083900 Ga0500595_083900_153_914 244
50 3300009176 Ga0105242_10024291 Ga0105242_100242912 245
51 3300046529 Ga0495652_0051866 Ga0495652_0051866_1557_2297 246
52 3300047319 Ga0495674_0001786 Ga0495674_0001786_14606_15355 247
53 3300005329 Ga0070683_100000269 Ga0070683_10000026917 248
54 3300005436 Ga0070713_100018675 Ga0070713_1000186754 248
55 3300005535 Ga0070684_100035808 Ga0070684_1000358083 248
56 3300005543 Ga0070672_100000018 Ga0070672_10000001863 248
57 3300005548 Ga0070665_100000846 Ga0070665_10000084615 248
58 3300005614 Ga0068856_100000654 Ga0068856_10000065436 248
59 3300005614 Ga0068856_100017230 Ga0068856_1000172309 248
60 3300005834 Ga0068851_10028211 Ga0068851_100282113 248
61 3300009101 Ga0105247_10097846 Ga0105247_100978463 248
62 3300013297 Ga0157378_10000598 Ga0157378_1000059818 248
63 3300013297 Ga0157378_10028090 Ga0157378_100280906 248
64 3300014969 Ga0157376_10020413 Ga0157376_100204134 248
65 3300025321 Ga0207656_10001576 Ga0207656_100015765 248
66 3300025928 Ga0207700_10000016 Ga0207700_1000001673 248
67 3300025940 Ga0207691_10000121 Ga0207691_1000012113 248
68 3300025944 Ga0207661_10000068 Ga0207661_1000006822 248
69 3300026078 Ga0207702_10000099 Ga0207702_1000009938 248
70 3300026078 Ga0207702_10012047 Ga0207702_100120472 248
71 3300028379 Ga0268266_10003048 Ga0268266_1000304815 248
72 3300046459 Ga0495629_0000552 Ga0495629_0000552_22427_23179 248
73 3300046461 Ga0495641_0005533 Ga0495641_0005533_343_1107 248
74 3300046507 Ga0495606_0000057 Ga0495606_0000057_190963_191727 248
75 3300046517 Ga0495630_0000011 Ga0495630_0000011_59057_59821 248
76 3300046681 Ga0495647_0000351 Ga0495647_0000351_7307_8071 248
77 3300046689 Ga0495613_0007052 Ga0495613_0007052_4973_5737 248
78 3300046690 Ga0495624_0003396 Ga0495624_0003396_2642_3406 248
79 3300047317 Ga0495604_0000078 Ga0495604_0000078_12124_12888 248
80 3300048907 Ga0496104_0017049 Ga0496104_0017049_4329_5093 248
81 3300048911 Ga0496108_0106825 Ga0496108_0106825_196_960 248
82 3300048912 Ga0496109_0000248 Ga0496109_0000248_50148_50912 248
83 3300048914 Ga0496111_0013673 Ga0496111_0013673_4346_5098 248
84 3300049586 Ga0501070_0031218 Ga0501070_0031218_328_1080 248
85 3300053077 Ga0495601_0007034 Ga0495601_0007034_3212_3976 248
86 3300053078 Ga0495612_0009025 Ga0495612_0009025_337_1110 248
87 3300005329 Ga0070683_100006749 Ga0070683_1000067499 249
88 3300005333 Ga0070677_10001579 Ga0070677_100015799 249
89 3300005364 Ga0070673_100002079 Ga0070673_1000020792 249
90 3300005367 Ga0070667_100546720 Ga0070667_1005467202 249
91 3300005458 Ga0070681_10006346 Ga0070681_100063465 249
92 3300005530 Ga0070679_100000860 Ga0070679_1000008608 249
93 3300005548 Ga0070665_100000341 Ga0070665_1000003417 249
94 3300005578 Ga0068854_100007541 Ga0068854_1000075415 249
95 3300005614 Ga0068856_100704600 Ga0068856_1007046002 249
96 3300005719 Ga0068861_100402554 Ga0068861_1004025541 249
97 3300005842 Ga0068858_100000251 Ga0068858_10000025150 249
98 3300009098 Ga0105245_10000743 Ga0105245_1000074320 249
99 3300013296 Ga0157374_10034713 Ga0157374_100347132 249
100 3300014745 Ga0157377_10099105 Ga0157377_100991053 249
101 3300025893 Ga0207682_10002923 Ga0207682_100029232 249
102 3300025912 Ga0207707_10025899 Ga0207707_100258992 249
103 3300025921 Ga0207652_10001058 Ga0207652_100010586 249
104 3300025927 Ga0207687_10000037 Ga0207687_1000003777 249
105 3300025927 Ga0207687_10000399 Ga0207687_1000039920 249
106 3300025944 Ga0207661_10001761 Ga0207661_100017614 249
107 3300025960 Ga0207651_10026101 Ga0207651_100261013 249
108 3300025981 Ga0207640_10005407 Ga0207640_100054075 249
109 3300026035 Ga0207703_10000128 Ga0207703_100001283 249
110 3300028379 Ga0268266_10000020 Ga0268266_10000020457 249
111 3300028563 Ga0265319_1000091 Ga0265319_100009160 249
112 3300028800 Ga0265338_10000752 Ga0265338_1000075260 249
113 3300031241 Ga0265325_10007063 Ga0265325_100070634 249
114 3300031250 Ga0265331_10043717 Ga0265331_100437172 249
115 3300035119 Ga0373956_0094611 Ga0373956_0094611_606_1361 249
116 3300036401 Ga0373937_0119145 Ga0373937_0119145_413_1168 249
117 3300046459 Ga0495629_0003869 Ga0495629_0003869_2080_2835 249
118 3300046459 Ga0495629_0011678 Ga0495629_0011678_832_1587 249
119 3300046461 Ga0495641_0000001 Ga0495641_0000001_442058_442813 249
120 3300046515 Ga0495620_0001409 Ga0495620_0001409_4758_5513 249
121 3300046516 Ga0495628_0028830 Ga0495628_0028830_809_1564 249
122 3300046529 Ga0495652_0000003 Ga0495652_0000003_273011_273769 249
123 3300046533 Ga0495640_0010051 Ga0495640_0010051_4808_5566 249
124 3300046535 Ga0495586_0001585 Ga0495586_0001585_2668_3423 249
125 3300046678 Ga0495599_0026454 Ga0495599_0026454_484_1239 249
126 3300046684 Ga0495669_0006336 Ga0495669_0006336_1401_2156 249
127 3300047321 Ga0495676_0026802 Ga0495676_0026802_1604_2389 249
128 3300047322 Ga0495680_0011137 Ga0495680_0011137_833_1588 249
129 3300048903 Ga0496100_0000007 Ga0496100_0000007_260335_261090 249
130 3300048904 Ga0496101_0000013 Ga0496101_0000013_260335_261090 249
131 3300048909 Ga0496106_0033841 Ga0496106_0033841_2590_3345 249
132 3300048910 Ga0496107_0000007 Ga0496107_0000007_254476_255231 249
133 3300048911 Ga0496108_0000001 Ga0496108_0000001_417_1172 249
134 3300048912 Ga0496109_0000006 Ga0496109_0000006_417_1172 249
135 3300048917 Ga0496114_0537202 Ga0496114_0537202_172_930 249
136 3300048928 Ga0496125_0110795 Ga0496125_0110795_445_1200 249
137 3300049569 Ga0501032_0005430 Ga0501032_0005430_4775_5533 249
138 3300049570 Ga0501033_0002771 Ga0501033_0002771_10066_10824 249
139 3300049571 Ga0501034_0019221 Ga0501034_0019221_4070_4828 249
140 3300049572 Ga0501036_0007955 Ga0501036_0007955_4144_4902 249
141 3300049573 Ga0501037_0012861 Ga0501037_0012861_1578_2336 249
142 3300049574 Ga0501038_0002980 Ga0501038_0002980_4549_5307 249
143 3300049575 Ga0501039_0147775 Ga0501039_0147775_947_1705 249
144 3300049578 Ga0501042_0127641 Ga0501042_0127641_593_1351 249
145 3300049579 Ga0501043_0008412 Ga0501043_0008412_4027_4785 249
146 3300049580 Ga0501046_0010956 Ga0501046_0010956_3992_4750 249
147 3300049581 Ga0501047_0010632 Ga0501047_0010632_4067_4825 249
148 3300049582 Ga0501048_0008910 Ga0501048_0008910_3754_4512 249
149 3300049584 Ga0501068_0016514 Ga0501068_0016514_464_1222 249
150 3300049585 Ga0501069_0014298 Ga0501069_0014298_520_1278 249
151 3300049586 Ga0501070_0002754 Ga0501070_0002754_10019_10777 249
152 3300049589 Ga0501073_0033340 Ga0501073_0033340_2519_3277 249
153 3300049742 Ga0501080_0033103 Ga0501080_0033103_1910_2668 249
154 3300049744 Ga0501083_0008477 Ga0501083_0008477_2742_3500 249
155 3300049822 Ga0501035_0003459 Ga0501035_0003459_10477_11235 249
156 3300049823 Ga0501044_0004658 Ga0501044_0004658_4571_5329 249
157 3300049824 Ga0501045_0442585 Ga0501045_0442585_73_831 249
158 3300053078 Ga0495612_0001467 Ga0495612_0001467_4458_5213 249
159 3300053123 Ga0500614_000424 Ga0500614_000424_779_1534 249
160 3300060353 Ga0501082_0012506 Ga0501082_0012506_2805_3563 249
161 3300005341 Ga0070691_10000052 Ga0070691_1000005217 250
162 3300005441 Ga0070700_100014855 Ga0070700_1000148557 250
163 3300005547 Ga0070693_100000319 Ga0070693_10000031912 250
164 3300005548 Ga0070665_100079136 Ga0070665_1000791362 250
165 3300005718 Ga0068866_10062839 Ga0068866_100628392 250
166 3300005719 Ga0068861_100072550 Ga0068861_1000725503 250
167 3300006881 Ga0068865_100100561 Ga0068865_1001005612 250
168 3300010375 Ga0105239_10828721 Ga0105239_108287211 250
169 3300013308 Ga0157375_10002149 Ga0157375_1000214914 250
170 3300013308 Ga0157375_10736230 Ga0157375_107362301 250
171 3300014325 Ga0163163_10204709 Ga0163163_102047091 250
172 3300014326 Ga0157380_10000604 Ga0157380_1000060415 250
173 3300025914 Ga0207671_10200207 Ga0207671_102002072 250
174 3300025916 Ga0207663_10013396 Ga0207663_100133965 250
175 3300025938 Ga0207704_10062711 Ga0207704_100627114 250
176 3300025961 Ga0207712_10000037 Ga0207712_10000037188 250
177 3300025986 Ga0207658_10077774 Ga0207658_100777741 250
178 3300026023 Ga0207677_10000478 Ga0207677_100004789 250
179 3300026075 Ga0207708_10025886 Ga0207708_100258867 250
180 3300026118 Ga0207675_100111031 Ga0207675_1001110313 250
181 3300028379 Ga0268266_10000342 Ga0268266_1000034249 250
182 3300041512 Ga0451853_1541713 Ga0451853_1541713_535_1305 250
183 3300046454 Ga0495592_0000532 Ga0495592_0000532_2602_3363 250
184 3300046499 Ga0495594_0000007 Ga0495594_0000007_149411_150169 250
185 3300046516 Ga0495628_0030900 Ga0495628_0030900_2611_3372 250
186 3300046537 Ga0495598_0007409 Ga0495598_0007409_1212_1970 250
187 3300046557 Ga0495622_0000437 Ga0495622_0000437_16750_17508 250
188 3300048905 Ga0496102_0000045 Ga0496102_0000045_7792_8550 250
189 3300048905 Ga0496102_0003511 Ga0496102_0003511_134_895 250
190 3300048906 Ga0496103_0000050 Ga0496103_0000050_143483_144241 250
191 3300048907 Ga0496104_0152152 Ga0496104_0152152_678_1439 250
192 3300048908 Ga0496105_0012422 Ga0496105_0012422_2306_3067 250
193 3300048912 Ga0496109_0440830 Ga0496109_0440830_23_784 250
194 3300048920 Ga0496117_0004714 Ga0496117_0004714_8693_9454 250
195 3300048921 Ga0496118_0001304 Ga0496118_0001304_5303_6064 250
196 3300048921 Ga0496118_0042457 Ga0496118_0042457_32_793 250
197 3300048922 Ga0496119_0003008 Ga0496119_0003008_2712_3473 250
198 3300048923 Ga0496120_0007264 Ga0496120_0007264_4710_5471 250
199 3300048924 Ga0496121_0019448 Ga0496121_0019448_954_1715 250
200 3300048924 Ga0496121_0369231 Ga0496121_0369231_60_821 250
201 3300048927 Ga0496124_0041514 Ga0496124_0041514_1440_2201 250
202 3300048928 Ga0496125_0061496 Ga0496125_0061496_2138_2899 250
203 3300048929 Ga0496126_0060822 Ga0496126_0060822_2257_3018 250
204 3300048929 Ga0496126_0138366 Ga0496126_0138366_906_1667 250
205 3300049571 Ga0501034_0512079 Ga0501034_0512079_102_863 250
206 3300049578 Ga0501042_0019909 Ga0501042_0019909_1533_2291 250
207 3300049581 Ga0501047_0004982 Ga0501047_0004982_158_919 250
208 3300049581 Ga0501047_0174482 Ga0501047_0174482_793_1554 250
209 3300049586 Ga0501070_0007745 Ga0501070_0007745_486_1247 250
210 3300049586 Ga0501070_0159332 Ga0501070_0159332_175_936 250
211 3300049591 Ga0501075_0005802 Ga0501075_0005802_2547_3305 250
212 3300049822 Ga0501035_0107491 Ga0501035_0107491_1090_1851 250
213 3300053083 Ga0495655_0000004 Ga0495655_0000004_216765_217523 250
214 3300053094 Ga0500566_0149471 Ga0500566_0149471_185_946 250
215 3300053096 Ga0500641_0014285 Ga0500641_0014285_2073_2831 250
216 3300053129 Ga0500628_000004 Ga0500628_000004_125180_125938 250
217 3300053134 Ga0500658_0021519 Ga0500658_0021519_335_1096 250
218 3300002239 JGI24034J26672_10001377 JGI24034J26672_100013774 251
219 3300005457 Ga0070662_100000005 Ga0070662_10000000532 251
220 3300005459 Ga0068867_100003856 Ga0068867_1000038569 251
221 3300006163 Ga0070715_10000011 Ga0070715_1000001140 251
222 3300014325 Ga0163163_10450316 Ga0163163_104503162 251
223 3300025899 Ga0207642_10000001 Ga0207642_10000001719 251
224 3300025905 Ga0207685_10000001 Ga0207685_10000001147 251
225 3300025933 Ga0207706_10000006 Ga0207706_10000006208 251
226 3300025934 Ga0207686_10008296 Ga0207686_100082961 251
227 3300025944 Ga0207661_10031358 Ga0207661_100313584 251
228 3300026089 Ga0207648_10005689 Ga0207648_100056899 251
229 3300026121 Ga0207683_10061753 Ga0207683_100617534 251
230 3300046462 Ga0495651_0021442 Ga0495651_0021442_2294_3058 251
231 3300046463 Ga0495653_0031267 Ga0495653_0031267_3036_3800 251
232 3300046476 Ga0495662_0001430 Ga0495662_0001430_4155_4922 251
233 3300046511 Ga0495608_0000788 Ga0495608_0000788_2635_3399 251
234 3300046517 Ga0495630_0001454 Ga0495630_0001454_4897_5661 251
235 3300046675 Ga0495657_0056127 Ga0495657_0056127_526_1290 251
236 3300047322 Ga0495680_0005689 Ga0495680_0005689_2660_3424 251
237 3300048907 Ga0496104_0003112 Ga0496104_0003112_480_1235 251
238 3300048908 Ga0496105_0000351 Ga0496105_0000351_13205_13960 251
239 3300048917 Ga0496114_0000003 Ga0496114_0000003_66291_67058 251
240 3300048918 Ga0496115_0000071 Ga0496115_0000071_57234_58001 251
241 3300053077 Ga0495601_0218575 Ga0495601_0218575_78_833 251
242 3300053084 Ga0495595_0000101 Ga0495595_0000101_2658_3422 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

111

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8807 56 231
5gpa-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8768 58 232
5gpc-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8744 56 237
6o6o-assembly1.cif.gz_B structure of the regulator fasr from mycobacterium tuberculosis 0.8684 57 239
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.8638 56 237
ID Description Score Start End Superfamily
6azhB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9747 60 102 1.10.10.60
3whcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9687 56 98 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9685 55 98 1.10.10.60
6azhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9646 57 102 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9589 56 105 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A838V245-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9783 1 245 GO:0000976
GO:0003700
AF-A0A537YUJ1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9594 47 214 GO:0000976
GO:0003700
AF-A0A838V245-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9515 1 245 GO:0000976
GO:0003700
AF-A0A537YT36-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9508 53 250 GO:0000976
GO:0003700
AF-A0A7W9M1G1-F1-model_v4 AcrR family transcriptional regulator 0.949 53 247 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.99 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map