F354852

General Info

Members Datasets Scaffolds Average Seq Length
242 152 484 410

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0038868|Ga0373937_0038868_2672_3979
Length 435
Sequence MSSAEFGSNRFDIRNSTFEILPTMRRRVVITGLGVITSLGEAVDEMWDAVCAGRSGIVPIKRWDPTRYPSRFGGECTNFDVTRYGVEFKEAKRLDRFAQFGVGASVNAVRDSGIEFSKEDPFRCGVLIGSGIGGIETLEEQNKILNSRGPTRVSPFTVPRLMVNAASGNVSIMFKLNGPNTAVATACATGANAIGDAGRFIQHDLADVMIAGGSEAALCELGLASFSAARALSTRNEEPTRASRPWDKGRDGFVMAEGAGVVVLEELEHARKRAARIYAELVGYGMSGDAYHITAPWEDGRGAALAMNAALKDASVSPEVIDYINAHGTSTPLGDIAETRAVKSSFGAHAKKVVISSTKSQLGHLLGASGGVEAVIAAMVVSRNLVPPTINLDDPDPECDLDYTPHKARDMKVTYVMSNSFGFGGHNASLLLKKF

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
149 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
150 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
151 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
152 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0.83
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 0.41
Rhizosphere 91.74
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0038868 3300036401 Bacteria 4336
2 JGI24751J29686_10002346 3300002459 Bacteria 3820
3 rootH2_10038322 3300003320 Bacteria 18319
4 rootH1_10023919 3300003323 Bacteria 2026
5 rootH1_10287800 3300003323 Bacteria 2343
6 Ga0070658_10037478 3300005327 Bacteria 3909
7 Ga0070683_100101136 3300005329 Bacteria 2714
8 Ga0070690_100133636 3300005330 Bacteria 1678
9 Ga0070677_10070065 3300005333 Bacteria 1473
10 Ga0070682_100002617 3300005337 Bacteria 9943
11 Ga0070682_100004763 3300005337 Bacteria 7543
12 Ga0070682_100036320 3300005337 Bacteria 3012
13 Ga0070682_100055972 3300005337 Bacteria 2479
14 Ga0070682_100084097 3300005337 Bacteria 2067
15 Ga0070689_100000043 3300005340 Bacteria 79179
16 Ga0070692_10055049 3300005345 Bacteria 2079
17 Ga0070668_100153551 3300005347 Bacteria 1864
18 Ga0070675_100012799 3300005354 Bacteria 6583
19 Ga0070667_100067195 3300005367 Bacteria 3047
20 Ga0070667_100294638 3300005367 Bacteria 1460
21 Ga0070714_100004277 3300005435 Bacteria 10756
22 Ga0070694_100004784 3300005444 Bacteria 8150
23 Ga0070685_10021703 3300005466 Bacteria 3492
24 Ga0070698_100064072 3300005471 Bacteria 3705
25 Ga0070672_100000681 3300005543 Bacteria 19991
26 Ga0070665_100000787 3300005548 Bacteria 41716
27 Ga0070704_100056133 3300005549 Bacteria 2796
28 Ga0068855_100000719 3300005563 Bacteria 40658
29 Ga0068855_100012063 3300005563 Bacteria 10447
30 Ga0068855_100028895 3300005563 Bacteria 6634
31 Ga0068857_100047816 3300005577 Bacteria 3799
32 Ga0068856_100055910 3300005614 Bacteria 3894
33 Ga0068856_100095766 3300005614 Bacteria 2957
34 Ga0068859_100129085 3300005617 Bacteria 2598
35 Ga0068861_100017956 3300005719 Bacteria 5031
36 Ga0068861_100028559 3300005719 Bacteria 4071
37 Ga0068862_100241988 3300005844 Bacteria 1641
38 Ga0081455_10021917 3300005937 Bacteria 5984
39 Ga0081455_10037216 3300005937 Bacteria 4324
40 Ga0081455_10050225 3300005937 Bacteria 3588
41 Ga0075432_10002194 3300006058 Bacteria 6501
42 Ga0075366_10002453 3300006195 Bacteria 9494
43 Ga0075366_10008589 3300006195 Bacteria 5686
44 Ga0075428_100035694 3300006844 Bacteria 5479
45 Ga0075428_100044579 3300006844 Bacteria 4873
46 Ga0075428_100055824 3300006844 Bacteria 4327
47 Ga0075428_100158654 3300006844 Bacteria 2456
48 Ga0075428_100323431 3300006844 Bacteria 1657
49 Ga0075430_100106887 3300006846 Bacteria 2334
50 Ga0075433_10026006 3300006852 Bacteria 4951
51 Ga0097620_100129088 3300006931 Bacteria 2598
52 Ga0105240_10064203 3300009093 Bacteria 4563
53 Ga0105240_10084590 3300009093 Bacteria 3889
54 Ga0111539_10013080 3300009094 Bacteria 10381
55 Ga0111539_10017940 3300009094 Bacteria 8767
56 Ga0111539_10030979 3300009094 Bacteria 6499
57 Ga0111539_10098863 3300009094 Bacteria 3427
58 Ga0111539_10256646 3300009094 Bacteria 2036
59 Ga0105245_10007078 3300009098 Bacteria 9841
60 Ga0114129_10000423 3300009147 Bacteria 50159
61 Ga0114129_10008426 3300009147 Bacteria 14689
62 Ga0114129_10129425 3300009147 Bacteria 3469
63 Ga0105241_10056842 3300009174 Bacteria 3000
64 Ga0105248_10108384 3300009177 Bacteria 3132
65 Ga0105249_10013204 3300009553 Bacteria 7289
66 Ga0157369_10199986 3300013105 Bacteria 2098
67 Ga0157374_10175895 3300013296 Bacteria 2089
68 Ga0157372_10369858 3300013307 Bacteria 1670
69 Ga0163163_10013089 3300014325 Bacteria 7579
70 Ga0157379_10000949 3300014968 Bacteria 23517
71 Ga0157376_10020819 3300014969 Bacteria 5083
72 Ga0157376_10047053 3300014969 Bacteria 3560
73 Ga0197907_10711009 3300020069 Bacteria 2014
74 Ga0213872_10000833 3300021361 Bacteria 22375
75 Ga0213872_10001581 3300021361 Bacteria 14490
76 Ga0213872_10051126 3300021361 Bacteria 1875
77 Ga0207682_10012333 3300025893 Bacteria 3338
78 Ga0207654_10043542 3300025911 Bacteria 2545
79 Ga0207695_10000153 3300025913 Bacteria 206288
80 Ga0207695_10060315 3300025913 Bacteria 3927
81 Ga0207650_10019545 3300025925 Bacteria 4762
82 Ga0207659_10007607 3300025926 Bacteria 6678
83 Ga0207687_10011499 3300025927 Bacteria 5784
84 Ga0207644_10008962 3300025931 Bacteria 6555
85 Ga0207644_10101515 3300025931 Bacteria 2162
86 Ga0207690_10061058 3300025932 Bacteria 2561
87 Ga0207690_10072829 3300025932 Bacteria 2374
88 Ga0207709_10126060 3300025935 Bacteria 1737
89 Ga0207670_10000022 3300025936 Bacteria 145904
90 Ga0207691_10001072 3300025940 Bacteria 27194
91 Ga0207679_10055130 3300025945 Bacteria 2929
92 Ga0207667_10000545 3300025949 Bacteria 49687
93 Ga0207667_10088652 3300025949 Bacteria 3199
94 Ga0207651_10090842 3300025960 Bacteria 2234
95 Ga0207678_10011922 3300026067 Bacteria 7635
96 Ga0207702_10042605 3300026078 Bacteria 3808
97 Ga0207674_10003067 3300026116 Bacteria 20666
98 Ga0207674_10040010 3300026116 Bacteria 4858
99 Ga0207675_100012501 3300026118 Bacteria 7930
100 Ga0207698_10004875 3300026142 Bacteria 8225
101 Ga0207428_10001898 3300027907 Bacteria 21191
102 Ga0207428_10023475 3300027907 Bacteria 5187
103 Ga0268266_10003743 3300028379 Bacteria 14957
104 Ga0268265_10213020 3300028380 Bacteria 1685
105 Ga0265337_1004247 3300028556 Bacteria 5986
106 Ga0265326_10003296 3300028558 Bacteria 5317
107 Ga0265336_10001299 3300028666 Bacteria 11709
108 Ga0265336_10007897 3300028666 Bacteria 3759
109 Ga0265336_10014075 3300028666 Bacteria 2656
110 Ga0307515_10060795 3300028794 Bacteria 5378
111 Ga0265332_10024981 3300031238 Bacteria 2626
112 Ga0265320_10000636 3300031240 Bacteria 26821
113 Ga0265340_10002691 3300031247 Bacteria 10100
114 Ga0265339_10001708 3300031249 Bacteria 16180
115 Ga0265339_10031590 3300031249 Bacteria 2991
116 Ga0265316_10007371 3300031344 Bacteria 10366
117 Ga0307508_10003516 3300031616 Bacteria 15784
118 Ga0265314_10000002 3300031711 Bacteria 2092193
119 Ga0265314_10013205 3300031711 Bacteria 6685
120 Ga0265314_10116545 3300031711 Bacteria 1689
121 Ga0307516_10003205 3300031730 Bacteria 21250
122 Ga0307409_100092676 3300031995 Bacteria 2480
123 Ga0307415_100069952 3300032126 Bacteria 2463
124 Ga0373935_0099450 3300035692 Bacteria 1915
125 Ga0373927_0069158 3300035695 Bacteria 2285
126 Ga0373937_0282898 3300036401 Bacteria 1566
127 Ga0373937_0285583 3300036401 Bacteria 1559
128 Ga0373925_0015304 3300037068 Bacteria 5547
129 Ga0395900_0321021 3300037418 Bacteria 1529
130 Ga0436361_0366330 3300039447 Bacteria 8422
131 Ga0436361_0434098 3300039447 Bacteria 1181
132 Ga0436361_0750660 3300039447 Bacteria 13620
133 Ga0451837_0698349 3300041494 Bacteria 1579
134 Ga0451849_0170892 3300041505 Bacteria 2278
135 Ga0451851_0531277 3300041507 Bacteria 1115
136 Ga0451851_0931612 3300041507 Bacteria 4217
137 Ga0451853_1252695 3300041512 Bacteria 22853
138 Ga0439444_0017417 3300042437 Bacteria 1233
139 Ga0453683_0030663 3300044673 Bacteria 3399
140 Ga0453683_0034103 3300044673 Unclassified 3209
141 Ga0453684_0088983 3300044712 Bacteria 3821
142 Ga0453684_0345079 3300044712 Bacteria 1680
143 Ga0451576_0000196 3300045051 Bacteria 153035
144 Ga0451576_0004424 3300045051 Bacteria 18260
145 Ga0451576_0044673 3300045051 Bacteria 4669
146 Ga0451576_0143504 3300045051 Bacteria 2490
147 Ga0451576_0301860 3300045051 Bacteria 1675
148 Ga0466958_0001522 3300045836 Bacteria 11107
149 Ga0495580_0009043 3300046472 Bacteria 7860
150 Ga0495630_0009926 3300046517 Bacteria 6857
151 Ga0495630_0043605 3300046517 Bacteria 3352
152 Ga0495587_0033232 3300046536 Bacteria 3115
153 Ga0495613_0012969 3300046689 Bacteria 6192
154 Ga0495624_0007335 3300046690 Bacteria 7742
155 Ga0495581_0044477 3300047315 Bacteria 2568
156 Ga0495674_0023644 3300047319 Bacteria 5659
157 Ga0495684_0007849 3300047471 Bacteria 8259
158 Ga0495684_0011253 3300047471 Bacteria 6912
159 Ga0496114_0008446 3300048917 Bacteria 8158
160 Ga0501031_0004285 3300049568 Bacteria 9226
161 Ga0501031_0040402 3300049568 Bacteria 3046
162 Ga0501032_0010730 3300049569 Bacteria 6594
163 Ga0501032_0069512 3300049569 Bacteria 2350
164 Ga0501033_0005611 3300049570 Bacteria 9915
165 Ga0501034_0000078 3300049571 Bacteria 171437
166 Ga0501034_0000532 3300049571 Bacteria 60495
167 Ga0501034_0001083 3300049571 Bacteria 38441
168 Ga0501034_0017044 3300049571 Bacteria 7449
169 Ga0501034_0023700 3300049571 Bacteria 6251
170 Ga0501034_0029380 3300049571 Bacteria 5586
171 Ga0501034_0032987 3300049571 Bacteria 5258
172 Ga0501036_0144817 3300049572 Bacteria 2004
173 Ga0501037_0013553 3300049573 Bacteria 6003
174 Ga0501037_0042970 3300049573 Bacteria 3321
175 Ga0501037_0214705 3300049573 Bacteria 1355
176 Ga0501038_0000298 3300049574 Bacteria 42116
177 Ga0501039_0021845 3300049575 Bacteria 4910
178 Ga0501040_0027750 3300049576 Bacteria 3813
179 Ga0501042_0077927 3300049578 Bacteria 2373
180 Ga0501043_0000591 3300049579 Bacteria 32159
181 Ga0501043_0068093 3300049579 Bacteria 2795
182 Ga0501043_0114544 3300049579 Bacteria 2116
183 Ga0501046_0000015 3300049580 Bacteria 242157
184 Ga0501047_0005179 3300049581 Bacteria 12236
185 Ga0501047_0044412 3300049581 Bacteria 4293
186 Ga0501047_0051775 3300049581 Bacteria 3968
187 Ga0501047_0060124 3300049581 Bacteria 3667
188 Ga0501048_0010216 3300049582 Bacteria 7020
189 Ga0501067_0064949 3300049583 Bacteria 2020
190 Ga0501068_0060810 3300049584 Bacteria 2294
191 Ga0501069_0009220 3300049585 Bacteria 5206
192 Ga0501070_0052111 3300049586 Bacteria 3397
193 Ga0501070_0120077 3300049586 Bacteria 2172
194 Ga0501072_0105419 3300049588 Bacteria 2241
195 Ga0501072_0214500 3300049588 Bacteria 1534
196 Ga0501076_0177061 3300049592 Bacteria 1738
197 Ga0501079_0004490 3300049741 Bacteria 10353
198 Ga0501079_0226956 3300049741 Bacteria 1459
199 Ga0501080_0001179 3300049742 Bacteria 21661
200 Ga0501080_0012961 3300049742 Bacteria 7654
201 Ga0501080_0134976 3300049742 Bacteria 2284
202 Ga0501080_0155162 3300049742 Bacteria 2115
203 Ga0501080_0320584 3300049742 Bacteria 1403
204 Ga0501083_0000015 3300049744 Bacteria 175355
205 Ga0501083_0001201 3300049744 Bacteria 17527
206 Ga0501083_0023406 3300049744 Bacteria 4284
207 Ga0501035_0111344 3300049822 Bacteria 2399
208 Ga0501044_0000696 3300049823 Bacteria 40634
209 Ga0501044_0003727 3300049823 Bacteria 17120
210 Ga0501044_0017704 3300049823 Bacteria 7643
211 Ga0501044_0027346 3300049823 Bacteria 6029
212 Ga0501044_0208211 3300049823 Bacteria 1911
213 nmdc:mga0k408_3390_c1 3300050493 Bacteria 8445
214 nmdc:mga05p37_383879_c1 3300050507 Bacteria 1645
215 nmdc:mga05p37_56079_c1 3300050507 Bacteria 4851
216 nmdc:mga05p37_78100_c1 3300050507 Bacteria 4076
217 nmdc:mga05p37_89372_c1 3300050507 Bacteria 3796
218 nmdc:mga09592_153494_c1 3300050508 Bacteria 1987
219 nmdc:mga09592_44189_c1 3300050508 Bacteria 3750
220 nmdc:mga06r32_28098_c1 3300050510 Bacteria 5261
221 nmdc:mga08y16_133645_c1 3300050511 Bacteria 2579
222 nmdc:mga08y16_5143_c1 3300050511 Bacteria 13675
223 nmdc:mga08y16_98166_c1 3300050511 Bacteria 3050
224 nmdc:mga0n895_1629_c1 3300050512 Bacteria 16950
225 nmdc:mga0a205_5157_c1 3300050515 Bacteria 11748
226 Ga0495595_0090459 3300053084 Bacteria 1468
227 Ga0495619_0042878 3300053085 Bacteria 2965
228 Ga0500555_000015 3300053103 Bacteria 230204
229 Ga0500642_0001730 3300053130 Bacteria 6298
230 Ga0501084_0000947 3300054114 Bacteria 22455
231 Ga0501084_0001268 3300054114 Bacteria 19908
232 Ga0501084_0026133 3300054114 Bacteria 4870
233 Ga0501084_0036798 3300054114 Bacteria 4090
234 Ga0587079_004867 3300059647 Bacteria 1860
235 Ga0501082_0034991 3300060353 Bacteria 4329
236 Ga0501082_0111642 3300060353 Bacteria 2366
237 Ga0501082_0206485 3300060353 Bacteria 1709
238 2687238385 2684623219 Bacteria 8442773
239 2688065941 2687453257 Bacteria 6784659
240 2889418502 2889415604 Bacteria 8048700
241 2897808691 2897803580 Bacteria 7000062
242 2920112163 2920107658 Bacteria 10042636
243 Ga0373937_0038868
244 JGI24751J29686_10002346
245 rootH2_10038322
246 rootH1_10023919
247 rootH1_10287800
248 Ga0070658_10037478
249 Ga0070683_100101136
250 Ga0070690_100133636
251 Ga0070677_10070065
252 Ga0070682_100002617
253 Ga0070682_100004763
254 Ga0070682_100036320
255 Ga0070682_100055972
256 Ga0070682_100084097
257 Ga0070689_100000043
258 Ga0070692_10055049
259 Ga0070668_100153551
260 Ga0070675_100012799
261 Ga0070667_100067195
262 Ga0070667_100294638
263 Ga0070714_100004277
264 Ga0070694_100004784
265 Ga0070685_10021703
266 Ga0070698_100064072
267 Ga0070672_100000681
268 Ga0070665_100000787
269 Ga0070704_100056133
270 Ga0068855_100000719
271 Ga0068855_100012063
272 Ga0068855_100028895
273 Ga0068857_100047816
274 Ga0068856_100055910
275 Ga0068856_100095766
276 Ga0068859_100129085
277 Ga0068861_100017956
278 Ga0068861_100028559
279 Ga0068862_100241988
280 Ga0081455_10021917
281 Ga0081455_10037216
282 Ga0081455_10050225
283 Ga0075432_10002194
284 Ga0075366_10002453
285 Ga0075366_10008589
286 Ga0075428_100035694
287 Ga0075428_100044579
288 Ga0075428_100055824
289 Ga0075428_100158654
290 Ga0075428_100323431
291 Ga0075430_100106887
292 Ga0075433_10026006
293 Ga0097620_100129088
294 Ga0105240_10064203
295 Ga0105240_10084590
296 Ga0111539_10013080
297 Ga0111539_10017940
298 Ga0111539_10030979
299 Ga0111539_10098863
300 Ga0111539_10256646
301 Ga0105245_10007078
302 Ga0114129_10000423
303 Ga0114129_10008426
304 Ga0114129_10129425
305 Ga0105241_10056842
306 Ga0105248_10108384
307 Ga0105249_10013204
308 Ga0157369_10199986
309 Ga0157374_10175895
310 Ga0157372_10369858
311 Ga0163163_10013089
312 Ga0157379_10000949
313 Ga0157376_10020819
314 Ga0157376_10047053
315 Ga0197907_10711009
316 Ga0213872_10000833
317 Ga0213872_10001581
318 Ga0213872_10051126
319 Ga0207682_10012333
320 Ga0207654_10043542
321 Ga0207695_10000153
322 Ga0207695_10060315
323 Ga0207650_10019545
324 Ga0207659_10007607
325 Ga0207687_10011499
326 Ga0207644_10008962
327 Ga0207644_10101515
328 Ga0207690_10061058
329 Ga0207690_10072829
330 Ga0207709_10126060
331 Ga0207670_10000022
332 Ga0207691_10001072
333 Ga0207679_10055130
334 Ga0207667_10000545
335 Ga0207667_10088652
336 Ga0207651_10090842
337 Ga0207678_10011922
338 Ga0207702_10042605
339 Ga0207674_10003067
340 Ga0207674_10040010
341 Ga0207675_100012501
342 Ga0207698_10004875
343 Ga0207428_10001898
344 Ga0207428_10023475
345 Ga0268266_10003743
346 Ga0268265_10213020
347 Ga0265337_1004247
348 Ga0265326_10003296
349 Ga0265336_10001299
350 Ga0265336_10007897
351 Ga0265336_10014075
352 Ga0307515_10060795
353 Ga0265332_10024981
354 Ga0265320_10000636
355 Ga0265340_10002691
356 Ga0265339_10001708
357 Ga0265339_10031590
358 Ga0265316_10007371
359 Ga0307508_10003516
360 Ga0265314_10000002
361 Ga0265314_10013205
362 Ga0265314_10116545
363 Ga0307516_10003205
364 Ga0307409_100092676
365 Ga0307415_100069952
366 Ga0373935_0099450
367 Ga0373927_0069158
368 Ga0373937_0282898
369 Ga0373937_0285583
370 Ga0373925_0015304
371 Ga0395900_0321021
372 Ga0436361_0366330
373 Ga0436361_0434098
374 Ga0436361_0750660
375 Ga0451837_0698349
376 Ga0451849_0170892
377 Ga0451851_0531277
378 Ga0451851_0931612
379 Ga0451853_1252695
380 Ga0439444_0017417
381 Ga0453683_0030663
382 Ga0453683_0034103
383 Ga0453684_0088983
384 Ga0453684_0345079
385 Ga0451576_0000196
386 Ga0451576_0004424
387 Ga0451576_0044673
388 Ga0451576_0143504
389 Ga0451576_0301860
390 Ga0466958_0001522
391 Ga0495580_0009043
392 Ga0495630_0009926
393 Ga0495630_0043605
394 Ga0495587_0033232
395 Ga0495613_0012969
396 Ga0495624_0007335
397 Ga0495581_0044477
398 Ga0495674_0023644
399 Ga0495684_0007849
400 Ga0495684_0011253
401 Ga0496114_0008446
402 Ga0501031_0004285
403 Ga0501031_0040402
404 Ga0501032_0010730
405 Ga0501032_0069512
406 Ga0501033_0005611
407 Ga0501034_0000078
408 Ga0501034_0000532
409 Ga0501034_0001083
410 Ga0501034_0017044
411 Ga0501034_0023700
412 Ga0501034_0029380
413 Ga0501034_0032987
414 Ga0501036_0144817
415 Ga0501037_0013553
416 Ga0501037_0042970
417 Ga0501037_0214705
418 Ga0501038_0000298
419 Ga0501039_0021845
420 Ga0501040_0027750
421 Ga0501042_0077927
422 Ga0501043_0000591
423 Ga0501043_0068093
424 Ga0501043_0114544
425 Ga0501046_0000015
426 Ga0501047_0005179
427 Ga0501047_0044412
428 Ga0501047_0051775
429 Ga0501047_0060124
430 Ga0501048_0010216
431 Ga0501067_0064949
432 Ga0501068_0060810
433 Ga0501069_0009220
434 Ga0501070_0052111
435 Ga0501070_0120077
436 Ga0501072_0105419
437 Ga0501072_0214500
438 Ga0501076_0177061
439 Ga0501079_0004490
440 Ga0501079_0226956
441 Ga0501080_0001179
442 Ga0501080_0012961
443 Ga0501080_0134976
444 Ga0501080_0155162
445 Ga0501080_0320584
446 Ga0501083_0000015
447 Ga0501083_0001201
448 Ga0501083_0023406
449 Ga0501035_0111344
450 Ga0501044_0000696
451 Ga0501044_0003727
452 Ga0501044_0017704
453 Ga0501044_0027346
454 Ga0501044_0208211
455 nmdc:mga0k408_3390_c1
456 nmdc:mga05p37_383879_c1
457 nmdc:mga05p37_56079_c1
458 nmdc:mga05p37_78100_c1
459 nmdc:mga05p37_89372_c1
460 nmdc:mga09592_153494_c1
461 nmdc:mga09592_44189_c1
462 nmdc:mga06r32_28098_c1
463 nmdc:mga08y16_133645_c1
464 nmdc:mga08y16_5143_c1
465 nmdc:mga08y16_98166_c1
466 nmdc:mga0n895_1629_c1
467 nmdc:mga0a205_5157_c1
468 Ga0495595_0090459
469 Ga0495619_0042878
470 Ga0500555_000015
471 Ga0500642_0001730
472 Ga0501084_0000947
473 Ga0501084_0001268
474 Ga0501084_0026133
475 Ga0501084_0036798
476 Ga0587079_004867
477 Ga0501082_0034991
478 Ga0501082_0111642
479 Ga0501082_0206485
480 2687238385
481 2688065941
482 2889418502
483 2897808691
484 2920112163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

278

393

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

25

270

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e5m-assembly1.cif.gz_A-2 beta ketoacyl acyl carrier protein synthase ii (kasii) from synechocystis sp. 0.9864 3 410
5sxo-assembly1.cif.gz_A-2 1.35 angstrom resolution crystal structure of beta-ketoacyl-acp synthase ii (fabf) from listeria monocytogenes 0.9856 3 409
4ls5-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis 0.985 2 410
5sn5-assembly1.cif.gz_A pandda analysis group deposition -- crystal structure of pseudomonas aeruginosa fabf-c164q mutant protein in complex with z2856434897 0.9847 1 410
4r8e-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from yersinia pestis 0.9832 3 409
ID Description Score Start End Superfamily
1j3nB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.992 260 403 3.40.47.10
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9842 2 410 3.40.47.10
1tqyG02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9833 256 409 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9817 1 409 3.40.47.10
af_P9WQD9_267_416_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9802 256 409 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7X9KTZ6-F1-model_v4 deleted 0.9945 238 409
AF-A0A661Q8Q5-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9944 293 409 GO:0004315
GO:0005829
GO:0006633
AF-A0A0N0I575-F1-model_v4 deleted 0.9941 184 410
AF-A0A7C4MQC6-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9917 246 410 GO:0004315
GO:0005829
GO:0006633
AF-A0A6P1YE22-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase 2 (EC 2.3.1.179) 0.9915 1 410 GO:0004315
GO:0005829
GO:0006633

Map