F355067

General Info

Members Datasets Scaffolds Average Seq Length
242 211 189 125

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0104759|Ga0501067_0104759_11_439
Length 142
Sequence MVISEMTLHPNDSPTQARIRTPLARVRGLGSAKEGADHFWKQRVTAIANLVLVCILAGIVVHLIGADYATVKKTLAKPLVGILLILLVLSGVHHMRLGMQTIIEDYVTSEGRKIALLMLNSFFAICVALSCIFAVLKLSLGA

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
3 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
4 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
5 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
6 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
7 2643221568 Rhizobium sp. Root564 Isolate Unclassified
8 2643221618 Ensifer sp. Root231 Isolate Unclassified
9 2643221626 Ensifer sp. Root31 Isolate Unclassified
10 2643221655 Ensifer sp. Root1252 Isolate Unclassified
11 2643221659 Ensifer sp. Root127 Isolate Unclassified
12 2643221698 Ensifer sp. Root142 Isolate Unclassified
13 2643221712 Ensifer sp. Root258 Isolate Unclassified
14 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
15 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
16 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
17 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
18 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
19 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
20 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
21 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
22 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
23 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
24 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
25 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
26 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
27 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
28 2844163670 Ensifer sp. 1H6 Isolate Unclassified
29 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
30 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
31 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
32 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
33 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
34 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
35 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
36 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
37 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
38 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
39 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
40 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
41 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
42 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
43 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
44 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
45 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
46 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
47 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
48 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
206 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
207 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
208 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
209 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
210 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
211 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.03
Metatranscriptomes 2.07
Isolates 21.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 7.44
Nodule 11.57
Rhizoplane 11.57
Rhizosphere 54.55
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10080090 3300001990 Unclassified 972
2 JGI25162J39368_1000879 3300002737 Bacteria 19691
3 JGI25165J46597_1001977 3300003214 Bacteria 7923
4 rootH2_10032833 3300003320 Bacteria 3553
5 Ga0055526_1000528 3300003771 Bacteria 30285
6 Ga0058692_1008528 3300003856 Bacteria 2642
7 Ga0070690_100957223 3300005330 Unclassified 672
8 Ga0070670_100000183 3300005331 Bacteria 57446
9 Ga0070682_100627334 3300005337 Bacteria 852
10 Ga0070660_100277108 3300005339 Bacteria 1372
11 Ga0070691_10365543 3300005341 Bacteria 805
12 Ga0070661_101215619 3300005344 Bacteria 630
13 Ga0070668_100199832 3300005347 Bacteria 1641
14 Ga0070673_101595244 3300005364 Bacteria 616
15 Ga0070659_100034072 3300005366 Bacteria 3960
16 Ga0070709_10079021 3300005434 Bacteria 2142
17 Ga0070701_10592031 3300005438 Bacteria 733
18 Ga0070711_101439618 3300005439 Bacteria 600
19 Ga0070705_100366466 3300005440 Bacteria 1056
20 Ga0070663_100000240 3300005455 Bacteria 27751
21 Ga0068867_102059765 3300005459 Bacteria 540
22 Ga0070679_100337678 3300005530 Bacteria 1455
23 Ga0068853_100004963 3300005539 Bacteria 10369
24 Ga0070695_100042122 3300005545 Bacteria 2897
25 Ga0070696_100102088 3300005546 Bacteria 2056
26 Ga0070693_100572313 3300005547 Bacteria 812
27 Ga0070665_101030908 3300005548 Bacteria 835
28 Ga0070665_101467519 3300005548 Bacteria 691
29 Ga0070665_101797051 3300005548 Bacteria 620
30 Ga0070704_100989986 3300005549 Bacteria 760
31 Ga0068855_100417755 3300005563 Bacteria 1467
32 Ga0068857_100012507 3300005577 Bacteria 7390
33 Ga0068856_100014117 3300005614 Bacteria 7725
34 Ga0068856_100430772 3300005614 Bacteria 1339
35 Ga0068852_101765257 3300005616 Bacteria 641
36 Ga0068864_100292958 3300005618 Bacteria 1521
37 Ga0068870_10504645 3300005840 Bacteria 807
38 Ga0068858_100184171 3300005842 Bacteria 1972
39 Ga0068860_101200907 3300005843 Bacteria 779
40 Ga0068862_100937465 3300005844 Bacteria 853
41 Ga0081455_10000371 3300005937 Bacteria 59407
42 Ga0075369_10144601 3300006186 Bacteria 1085
43 Ga0075370_10870955 3300006353 Bacteria 550
44 Ga0068865_100391258 3300006881 Bacteria 1136
45 Ga0099826_10030104 3300006948 Bacteria 3947
46 Ga0105244_10164819 3300009036 Bacteria 1057
47 Ga0105240_11255408 3300009093 Bacteria 783
48 Ga0105247_10910504 3300009101 Unclassified 680
49 Ga0105241_10062697 3300009174 Bacteria 2867
50 Ga0105238_10032342 3300009551 Bacteria 5323
51 Ga0105239_10633940 3300010375 Bacteria 1220
52 Ga0105246_10283931 3300011119 Bacteria 1329
53 Ga0157370_10292918 3300013104 Bacteria 1503
54 Ga0157369_10054912 3300013105 Bacteria 4300
55 Ga0157369_10087123 3300013105 Bacteria 3335
56 Ga0157374_11763165 3300013296 Bacteria 644
57 Ga0157378_10607300 3300013297 Bacteria 1106
58 Ga0157372_10166293 3300013307 Bacteria 2551
59 Ga0157372_12224639 3300013307 Bacteria 630
60 Ga0157375_10495624 3300013308 Bacteria 1386
61 Ga0182008_10919883 3300014497 Bacteria 516
62 Ga0213876_10740605 3300021384 Unclassified 523
63 Ga0209563_102664 3300025230 Bacteria 3946
64 Ga0209437_100057 3300025233 Bacteria 362922
65 Ga0209148_1007754 3300025254 Bacteria 2202
66 Ga0209759_1014622 3300025256 Bacteria 2065
67 Ga0209233_1000134 3300025261 Bacteria 202535
68 Ga0209455_1010448 3300025272 Bacteria 2359
69 Ga0209025_1042368 3300025294 Bacteria 1935
70 Ga0209564_1000752 3300025295 Bacteria 45914
71 Ga0207653_10281211 3300025885 Bacteria 642
72 Ga0207647_10090822 3300025904 Bacteria 1821
73 Ga0207705_10693446 3300025909 Bacteria 792
74 Ga0207654_10042128 3300025911 Bacteria 2582
75 Ga0207707_10087376 3300025912 Bacteria 2724
76 Ga0207671_10184159 3300025914 Bacteria 1626
77 Ga0207657_10090785 3300025919 Bacteria 2549
78 Ga0207652_10568868 3300025921 Bacteria 1018
79 Ga0207694_10273439 3300025924 Bacteria 1386
80 Ga0207650_10000151 3300025925 Bacteria 83229
81 Ga0207690_10624607 3300025932 Bacteria 881
82 Ga0207704_11374360 3300025938 Bacteria 605
83 Ga0207679_10314138 3300025945 Bacteria 1355
84 Ga0207667_10222078 3300025949 Bacteria 1936
85 Ga0207677_10236816 3300026023 Bacteria 1474
86 Ga0207703_10401506 3300026035 Bacteria 1272
87 Ga0207639_10124178 3300026041 Bacteria 2126
88 Ga0207639_11337174 3300026041 Bacteria 672
89 Ga0207678_10000440 3300026067 Bacteria 37762
90 Ga0207702_10014459 3300026078 Bacteria 6553
91 Ga0207702_10377901 3300026078 Bacteria 1362
92 Ga0207641_11048645 3300026088 Bacteria 813
93 Ga0207676_10153518 3300026095 Bacteria 1986
94 Ga0207674_10266529 3300026116 Bacteria 1660
95 Ga0207675_100975722 3300026118 Bacteria 865
96 Ga0207698_10398227 3300026142 Bacteria 1315
97 Ga0209371_1001857 3300027312 Bacteria 12997
98 Ga0209371_1005149 3300027312 Bacteria 5340
99 Ga0209282_1039116 3300027666 Bacteria 2833
100 Ga0268266_11465530 3300028379 Bacteria 658
101 Ga0268265_10634945 3300028380 Bacteria 1025
102 Ga0268264_10906056 3300028381 Bacteria 885
103 Ga0268256_1008786 3300030500 Bacteria 3431
104 Ga0268256_1020398 3300030500 Bacteria 1787
105 Ga0307408_101378257 3300031548 Bacteria 663
106 Ga0307408_101394494 3300031548 Bacteria 660
107 Ga0307516_10332797 3300031730 Bacteria 1187
108 Ga0373936_0065935 3300035113 Bacteria 1486
109 Ga0373935_0354836 3300035692 Bacteria 1046
110 Ga0316582_0302039 3300036647 Bacteria 1100
111 Ga0395899_0000124 3300037312 Bacteria 122011
112 Ga0395900_0000086 3300037418 Bacteria 171749
113 Ga0395900_0047566 3300037418 Bacteria 4417
114 Ga0395900_0100158 3300037418 Bacteria 2976
115 Ga0395898_0000285 3300037466 Bacteria 122279
116 Ga0395898_0525522 3300037466 Bacteria 1125
117 Ga0395905_0000133 3300037471 Bacteria 123500
118 Ga0395901_0000092 3300038443 Bacteria 121976
119 Ga0436365_0513625 3300039437 Bacteria 1647
120 Ga0436365_0610273 3300039437 Bacteria 554
121 Ga0451837_0998999 3300041494 Bacteria 702
122 Ga0466963_0078708 3300044694 Bacteria 2229
123 Ga0451576_0281274 3300045051 Bacteria 1740
124 Ga0495606_0645099 3300046507 Bacteria 513
125 Ga0495602_0250931 3300048088 Bacteria 1319
126 Ga0496100_0091138 3300048903 Bacteria 2080
127 Ga0496101_0124953 3300048904 Bacteria 1949
128 Ga0496101_1038792 3300048904 Bacteria 644
129 Ga0496102_0045861 3300048905 Bacteria 3968
130 Ga0496102_0125301 3300048905 Bacteria 2401
131 Ga0496102_0134429 3300048905 Bacteria 2317
132 Ga0496102_0275919 3300048905 Bacteria 1584
133 Ga0496104_0002253 3300048907 Bacteria 16633
134 Ga0496104_0165263 3300048907 Bacteria 2122
135 Ga0496105_0069186 3300048908 Bacteria 2917
136 Ga0496106_0027734 3300048909 Bacteria 4219
137 Ga0496106_0105151 3300048909 Bacteria 2193
138 Ga0496106_0217690 3300048909 Bacteria 1522
139 Ga0496107_0006452 3300048910 Bacteria 8068
140 Ga0496107_0377722 3300048910 Bacteria 1054
141 Ga0496108_0073643 3300048911 Bacteria 2883
142 Ga0496108_0302043 3300048911 Bacteria 1394
143 Ga0496108_0393083 3300048911 Bacteria 1211
144 Ga0496109_0052808 3300048912 Bacteria 3705
145 Ga0496109_1288860 3300048912 Bacteria 667
146 Ga0496110_0024773 3300048913 Bacteria 5119
147 Ga0496110_0276724 3300048913 Bacteria 1528
148 Ga0496112_0078918 3300048915 Bacteria 3255
149 Ga0496113_0043494 3300048916 Bacteria 3324
150 Ga0496114_0096500 3300048917 Bacteria 2517
151 Ga0496115_0010949 3300048918 Bacteria 6791
152 Ga0496115_0016288 3300048918 Bacteria 5657
153 Ga0496116_0000057 3300048919 Bacteria 281652
154 Ga0496117_0120579 3300048920 Bacteria 1612
155 Ga0496118_0074368 3300048921 Bacteria 2429
156 Ga0496119_0138800 3300048922 Bacteria 1315
157 Ga0496121_0020154 3300048924 Bacteria 6620
158 Ga0496122_0096365 3300048925 Bacteria 1995
159 Ga0496124_0104853 3300048927 Bacteria 2285
160 Ga0496126_0002222 3300048929 Bacteria 26858
161 Ga0496126_0609847 3300048929 Bacteria 859
162 Ga0501032_0151241 3300049569 Bacteria 1526
163 Ga0501033_0000518 3300049570 Bacteria 36156
164 Ga0501034_0069806 3300049571 Bacteria 3524
165 Ga0501036_1203601 3300049572 Bacteria 617
166 Ga0501042_0570199 3300049578 Bacteria 823
167 Ga0501042_0618115 3300049578 Bacteria 788
168 Ga0501047_0573047 3300049581 Bacteria 952
169 Ga0501048_0000508 3300049582 Bacteria 27268
170 Ga0501067_0104759 3300049583 Bacteria 1572
171 Ga0501070_0659319 3300049586 Bacteria 830
172 Ga0501077_0181741 3300049593 Bacteria 1337
173 Ga0501035_0000316 3300049822 Bacteria 55833
174 Ga0501035_0149490 3300049822 Bacteria 2028
175 Ga0501035_1433821 3300049822 Unclassified 528
176 Ga0501044_0643599 3300049823 Bacteria 950
177 Ga0501045_0548254 3300049824 Bacteria 858
178 nmdc:mga03n38_413705_c1 3300050490 Bacteria 744
179 nmdc:mga00v17_147288_c1 3300050491 Bacteria 1511
180 nmdc:mga0k408_677049_c1 3300050493 Bacteria 605
181 nmdc:mga0sz30_213487_c1 3300050516 Bacteria 858
182 Ga0500595_115555 3300053119 Bacteria 760
183 Ga0500608_101911 3300053122 Bacteria 1329
184 Ga0587090_000170 3300059510 Bacteria 4514
185 Ga0587091_006705 3300059511 Bacteria 1629
186 Ga0587067_006768 3300059640 Bacteria 1613
187 Ga0587072_001139 3300059643 Bacteria 3152
188 Ga0587108_002703 3300059653 Bacteria 1207
189 Ga0501082_0444262 3300060353 Bacteria 1133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0047566 Ga0395900_0047566_384_779 103
2 3300031548 Ga0307408_101378257 Ga0307408_1013782572 108
3 3300049571 Ga0501034_0069806 Ga0501034_0069806_610_993 111
4 3300049582 Ga0501048_0000508 Ga0501048_0000508_5307_5690 113
5 3300005434 Ga0070709_10079021 Ga0070709_100790211 114
6 3300026041 Ga0207639_11337174 Ga0207639_113371741 114
7 3300044694 Ga0466963_0078708 Ga0466963_0078708_1080_1496 115
8 3300050493 nmdc:mga0k408_677049_c1 nmdc:mga0k408_677049_c1_155_514 118
9 iso_pu_bacteria 2512875026 2512973697 121
10 iso_pu_bacteria 2513237160 2514003631 121
11 iso_pu_bacteria 2537561587 2537876649 121
12 iso_pu_bacteria 2615840698 2616557643 121
13 iso_pu_bacteria 2643221568 2643855022 121
14 iso_pu_bacteria 2643221618 2644110058 121
15 iso_pu_bacteria 2643221626 2644150334 121
16 iso_pu_bacteria 2643221655 2644312938 121
17 iso_pu_bacteria 2643221659 2644336486 121
18 iso_pu_bacteria 2643221698 2644546132 121
19 iso_pu_bacteria 2643221712 2644618668 121
20 iso_pu_bacteria 2667528174 2671113537 121
21 iso_pu_bacteria 2775507266 2778173690 121
22 iso_pu_bacteria 2802428858 2802717333 121
23 iso_pu_bacteria 2802428862 2802743181 121
24 iso_pu_bacteria 2802428863 2802749693 121
25 iso_pu_bacteria 2818991448 2819611180 121
26 iso_pu_bacteria 2838029111 2838030873 121
27 iso_pu_bacteria 2838074704 2838078270 121
28 iso_pu_bacteria 2841859092 2841863161 121
29 iso_pu_bacteria 2842475841 2842477605 121
30 iso_pu_bacteria 2842502639 2842504522 121
31 iso_pu_bacteria 2842515876 2842520101 121
32 iso_pu_bacteria 2844163670 2844164257 121
33 iso_pu_bacteria 2899792073 2899795260 121
34 iso_pu_bacteria 2919166419 2919170644 121
35 iso_pu_bacteria 2919408235 2919411005 121
36 iso_pu_bacteria 2933011516 2933015639 121
37 iso_pu_bacteria 2937036028 2937036093 121
38 iso_pu_bacteria 2937084907 2937086382 121
39 iso_pu_bacteria 2941499720 2941501254 121
40 iso_pu_bacteria 2957437181 2957439754 121
41 iso_pu_bacteria 2960591022 2960594977 121
42 iso_pu_bacteria 2967728569 2967731930 121
43 iso_pu_bacteria 2970026789 2970029926 121
44 iso_pu_bacteria 2970122695 2970125856 121
45 iso_pu_bacteria 2970143518 2970143721 121
46 iso_pu_bacteria 2977530762 2977534677 121
47 iso_pu_bacteria 2978969890 2978972546 121
48 iso_pu_bacteria 2984587000 2984590799 121
49 iso_pu_bacteria 3005416602 3005421685 121
50 iso_pu_bacteria 8003999396 8004002960 121
51 iso_pu_bacteria 8005314921 8005319611 121
52 iso_pu_bacteria 8005484373 8005490233 121
53 iso_pu_bacteria 8005645114 8005646890 121
54 iso_pu_bacteria 8005682033 8005688048 121
55 iso_pu_bacteria 8024486573 8024490789 121
56 iso_pu_bacteria 8054460903 8054463708 121
57 iso_pu_bacteria 2511231027 2511389019 122
58 iso_pu_bacteria 2757320392 2757570290 122
59 iso_pu_bacteria 2842871566 2842873950 122
60 3300001990 JGI24737J22298_10080090 JGI24737J22298_100800902 123
61 3300002737 JGI25162J39368_1000879 JGI25162J39368_100087923 123
62 3300003214 JGI25165J46597_1001977 JGI25165J46597_10019772 123
63 3300003320 rootH2_10032833 rootH2_100328335 123
64 3300003771 Ga0055526_1000528 Ga0055526_100052831 123
65 3300003856 Ga0058692_1008528 Ga0058692_10085284 123
66 3300005330 Ga0070690_100957223 Ga0070690_1009572231 123
67 3300005331 Ga0070670_100000183 Ga0070670_10000018333 123
68 3300005337 Ga0070682_100627334 Ga0070682_1006273342 123
69 3300005339 Ga0070660_100277108 Ga0070660_1002771082 123
70 3300005341 Ga0070691_10365543 Ga0070691_103655432 123
71 3300005344 Ga0070661_101215619 Ga0070661_1012156192 123
72 3300005347 Ga0070668_100199832 Ga0070668_1001998322 123
73 3300005364 Ga0070673_101595244 Ga0070673_1015952442 123
74 3300005366 Ga0070659_100034072 Ga0070659_1000340724 123
75 3300005438 Ga0070701_10592031 Ga0070701_105920311 123
76 3300005439 Ga0070711_101439618 Ga0070711_1014396181 123
77 3300005440 Ga0070705_100366466 Ga0070705_1003664662 123
78 3300005455 Ga0070663_100000240 Ga0070663_1000002404 123
79 3300005459 Ga0068867_102059765 Ga0068867_1020597652 123
80 3300005530 Ga0070679_100337678 Ga0070679_1003376782 123
81 3300005539 Ga0068853_100004963 Ga0068853_1000049633 123
82 3300005545 Ga0070695_100042122 Ga0070695_1000421223 123
83 3300005546 Ga0070696_100102088 Ga0070696_1001020883 123
84 3300005547 Ga0070693_100572313 Ga0070693_1005723132 123
85 3300005548 Ga0070665_101030908 Ga0070665_1010309082 123
86 3300005548 Ga0070665_101467519 Ga0070665_1014675192 123
87 3300005548 Ga0070665_101797051 Ga0070665_1017970511 123
88 3300005549 Ga0070704_100989986 Ga0070704_1009899861 123
89 3300005563 Ga0068855_100417755 Ga0068855_1004177552 123
90 3300005577 Ga0068857_100012507 Ga0068857_1000125072 123
91 3300005614 Ga0068856_100014117 Ga0068856_1000141177 123
92 3300005614 Ga0068856_100430772 Ga0068856_1004307722 123
93 3300005616 Ga0068852_101765257 Ga0068852_1017652572 123
94 3300005618 Ga0068864_100292958 Ga0068864_1002929583 123
95 3300005840 Ga0068870_10504645 Ga0068870_105046452 123
96 3300005842 Ga0068858_100184171 Ga0068858_1001841713 123
97 3300005843 Ga0068860_101200907 Ga0068860_1012009072 123
98 3300005844 Ga0068862_100937465 Ga0068862_1009374652 123
99 3300005937 Ga0081455_10000371 Ga0081455_100003714 123
100 3300006186 Ga0075369_10144601 Ga0075369_101446013 123
101 3300006353 Ga0075370_10870955 Ga0075370_108709552 123
102 3300006881 Ga0068865_100391258 Ga0068865_1003912581 123
103 3300006948 Ga0099826_10030104 Ga0099826_100301046 123
104 3300009036 Ga0105244_10164819 Ga0105244_101648192 123
105 3300009093 Ga0105240_11255408 Ga0105240_112554082 123
106 3300009101 Ga0105247_10910504 Ga0105247_109105042 123
107 3300009174 Ga0105241_10062697 Ga0105241_100626972 123
108 3300009551 Ga0105238_10032342 Ga0105238_100323424 123
109 3300010375 Ga0105239_10633940 Ga0105239_106339402 123
110 3300011119 Ga0105246_10283931 Ga0105246_102839312 123
111 3300013104 Ga0157370_10292918 Ga0157370_102929182 123
112 3300013105 Ga0157369_10054912 Ga0157369_100549123 123
113 3300013105 Ga0157369_10087123 Ga0157369_100871232 123
114 3300013296 Ga0157374_11763165 Ga0157374_117631651 123
115 3300013297 Ga0157378_10607300 Ga0157378_106073002 123
116 3300013307 Ga0157372_10166293 Ga0157372_101662932 123
117 3300013307 Ga0157372_12224639 Ga0157372_122246392 123
118 3300013308 Ga0157375_10495624 Ga0157375_104956242 123
119 3300014497 Ga0182008_10919883 Ga0182008_109198832 123
120 3300021384 Ga0213876_10740605 Ga0213876_107406051 123
121 3300025230 Ga0209563_102664 Ga0209563_1026648 123
122 3300025233 Ga0209437_100057 Ga0209437_100057153 123
123 3300025254 Ga0209148_1007754 Ga0209148_10077542 123
124 3300025256 Ga0209759_1014622 Ga0209759_10146223 123
125 3300025261 Ga0209233_1000134 Ga0209233_1000134153 123
126 3300025272 Ga0209455_1010448 Ga0209455_10104482 123
127 3300025294 Ga0209025_1042368 Ga0209025_10423682 123
128 3300025295 Ga0209564_1000752 Ga0209564_10007522 123
129 3300025885 Ga0207653_10281211 Ga0207653_102812112 123
130 3300025904 Ga0207647_10090822 Ga0207647_100908222 123
131 3300025909 Ga0207705_10693446 Ga0207705_106934462 123
132 3300025911 Ga0207654_10042128 Ga0207654_100421284 123
133 3300025912 Ga0207707_10087376 Ga0207707_100873764 123
134 3300025914 Ga0207671_10184159 Ga0207671_101841592 123
135 3300025919 Ga0207657_10090785 Ga0207657_100907852 123
136 3300025921 Ga0207652_10568868 Ga0207652_105688682 123
137 3300025924 Ga0207694_10273439 Ga0207694_102734392 123
138 3300025925 Ga0207650_10000151 Ga0207650_1000015137 123
139 3300025932 Ga0207690_10624607 Ga0207690_106246072 123
140 3300025938 Ga0207704_11374360 Ga0207704_113743601 123
141 3300025945 Ga0207679_10314138 Ga0207679_103141382 123
142 3300025949 Ga0207667_10222078 Ga0207667_102220783 123
143 3300026023 Ga0207677_10236816 Ga0207677_102368162 123
144 3300026035 Ga0207703_10401506 Ga0207703_104015062 123
145 3300026041 Ga0207639_10124178 Ga0207639_101241783 123
146 3300026067 Ga0207678_10000440 Ga0207678_1000044043 123
147 3300026078 Ga0207702_10014459 Ga0207702_100144597 123
148 3300026078 Ga0207702_10377901 Ga0207702_103779013 123
149 3300026088 Ga0207641_11048645 Ga0207641_110486451 123
150 3300026095 Ga0207676_10153518 Ga0207676_101535182 123
151 3300026116 Ga0207674_10266529 Ga0207674_102665293 123
152 3300026118 Ga0207675_100975722 Ga0207675_1009757222 123
153 3300026142 Ga0207698_10398227 Ga0207698_103982272 123
154 3300027312 Ga0209371_1001857 Ga0209371_100185711 123
155 3300027312 Ga0209371_1005149 Ga0209371_10051493 123
156 3300027666 Ga0209282_1039116 Ga0209282_10391166 123
157 3300028379 Ga0268266_11465530 Ga0268266_114655302 123
158 3300028380 Ga0268265_10634945 Ga0268265_106349452 123
159 3300028381 Ga0268264_10906056 Ga0268264_109060562 123
160 3300030500 Ga0268256_1008786 Ga0268256_10087862 123
161 3300030500 Ga0268256_1020398 Ga0268256_10203982 123
162 3300031548 Ga0307408_101394494 Ga0307408_1013944942 123
163 3300031730 Ga0307516_10332797 Ga0307516_103327972 123
164 3300035113 Ga0373936_0065935 Ga0373936_0065935_419_799 123
165 3300035692 Ga0373935_0354836 Ga0373935_0354836_77_457 123
166 3300036647 Ga0316582_0302039 Ga0316582_0302039_408_782 123
167 3300037312 Ga0395899_0000124 Ga0395899_0000124_112068_112463 123
168 3300037418 Ga0395900_0000086 Ga0395900_0000086_59287_59682 123
169 3300037418 Ga0395900_0100158 Ga0395900_0100158_1913_2293 123
170 3300037466 Ga0395898_0000285 Ga0395898_0000285_112068_112463 123
171 3300037466 Ga0395898_0525522 Ga0395898_0525522_198_578 123
172 3300037471 Ga0395905_0000133 Ga0395905_0000133_11038_11433 123
173 3300038443 Ga0395901_0000092 Ga0395901_0000092_9514_9909 123
174 3300039437 Ga0436365_0513625 Ga0436365_0513625_537_917 123
175 3300039437 Ga0436365_0610273 Ga0436365_0610273_100_489 123
176 3300041494 Ga0451837_0998999 Ga0451837_0998999_289_669 123
177 3300045051 Ga0451576_0281274 Ga0451576_0281274_830_1210 123
178 3300046507 Ga0495606_0645099 Ga0495606_0645099_66_446 123
179 3300048088 Ga0495602_0250931 Ga0495602_0250931_541_930 123
180 3300048903 Ga0496100_0091138 Ga0496100_0091138_957_1337 123
181 3300048904 Ga0496101_0124953 Ga0496101_0124953_1107_1487 123
182 3300048904 Ga0496101_1038792 Ga0496101_1038792_255_626 123
183 3300048905 Ga0496102_0045861 Ga0496102_0045861_1489_1872 123
184 3300048905 Ga0496102_0125301 Ga0496102_0125301_1435_1809 123
185 3300048905 Ga0496102_0134429 Ga0496102_0134429_1768_2151 123
186 3300048905 Ga0496102_0275919 Ga0496102_0275919_1161_1544 123
187 3300048907 Ga0496104_0002253 Ga0496104_0002253_1064_1444 123
188 3300048907 Ga0496104_0165263 Ga0496104_0165263_505_876 123
189 3300048908 Ga0496105_0069186 Ga0496105_0069186_2062_2442 123
190 3300048909 Ga0496106_0027734 Ga0496106_0027734_231_611 123
191 3300048909 Ga0496106_0105151 Ga0496106_0105151_1395_1766 123
192 3300048909 Ga0496106_0217690 Ga0496106_0217690_1046_1429 123
193 3300048910 Ga0496107_0006452 Ga0496107_0006452_7392_7775 123
194 3300048910 Ga0496107_0377722 Ga0496107_0377722_654_1025 123
195 3300048911 Ga0496108_0073643 Ga0496108_0073643_989_1360 123
196 3300048911 Ga0496108_0302043 Ga0496108_0302043_375_755 123
197 3300048911 Ga0496108_0393083 Ga0496108_0393083_456_830 123
198 3300048912 Ga0496109_0052808 Ga0496109_0052808_2311_2682 123
199 3300048912 Ga0496109_1288860 Ga0496109_1288860_217_600 123
200 3300048913 Ga0496110_0024773 Ga0496110_0024773_974_1354 123
201 3300048913 Ga0496110_0276724 Ga0496110_0276724_590_961 123
202 3300048915 Ga0496112_0078918 Ga0496112_0078918_540_911 123
203 3300048916 Ga0496113_0043494 Ga0496113_0043494_2311_2682 123
204 3300048917 Ga0496114_0096500 Ga0496114_0096500_1592_1975 123
205 3300048918 Ga0496115_0010949 Ga0496115_0010949_5080_5460 123
206 3300048918 Ga0496115_0016288 Ga0496115_0016288_1355_1738 123
207 3300048919 Ga0496116_0000057 Ga0496116_0000057_275278_275658 123
208 3300048920 Ga0496117_0120579 Ga0496117_0120579_800_1180 123
209 3300048921 Ga0496118_0074368 Ga0496118_0074368_1936_2316 123
210 3300048922 Ga0496119_0138800 Ga0496119_0138800_238_618 123
211 3300048924 Ga0496121_0020154 Ga0496121_0020154_4648_5028 123
212 3300048925 Ga0496122_0096365 Ga0496122_0096365_1133_1513 123
213 3300048927 Ga0496124_0104853 Ga0496124_0104853_1046_1426 123
214 3300048929 Ga0496126_0002222 Ga0496126_0002222_24969_25349 123
215 3300048929 Ga0496126_0609847 Ga0496126_0609847_470_844 123
216 3300049569 Ga0501032_0151241 Ga0501032_0151241_181_555 123
217 3300049570 Ga0501033_0000518 Ga0501033_0000518_7378_7752 123
218 3300049572 Ga0501036_1203601 Ga0501036_1203601_37_432 123
219 3300049578 Ga0501042_0570199 Ga0501042_0570199_290_661 123
220 3300049578 Ga0501042_0618115 Ga0501042_0618115_173_553 123
221 3300049581 Ga0501047_0573047 Ga0501047_0573047_215_598 123
222 3300049583 Ga0501067_0104759 Ga0501067_0104759_11_439 123
223 3300049586 Ga0501070_0659319 Ga0501070_0659319_296_676 123
224 3300049593 Ga0501077_0181741 Ga0501077_0181741_545_916 123
225 3300049822 Ga0501035_0000316 Ga0501035_0000316_26347_26721 123
226 3300049822 Ga0501035_0149490 Ga0501035_0149490_912_1292 123
227 3300049822 Ga0501035_1433821 Ga0501035_1433821_109_480 123
228 3300049823 Ga0501044_0643599 Ga0501044_0643599_319_699 123
229 3300049824 Ga0501045_0548254 Ga0501045_0548254_56_427 123
230 3300050490 nmdc:mga03n38_413705_c1 nmdc:mga03n38_413705_c1_354_734 123
231 3300050491 nmdc:mga00v17_147288_c1 nmdc:mga00v17_147288_c1_393_773 123
232 3300050516 nmdc:mga0sz30_213487_c1 nmdc:mga0sz30_213487_c1_285_665 123
233 3300053119 Ga0500595_115555 Ga0500595_115555_319_702 123
234 3300053122 Ga0500608_101911 Ga0500608_101911_30_410 123
235 3300059510 Ga0587090_000170 Ga0587090_000170_3631_4011 123
236 3300059511 Ga0587091_006705 Ga0587091_006705_694_1074 123
237 3300059640 Ga0587067_006768 Ga0587067_006768_530_910 123
238 3300059643 Ga0587072_001139 Ga0587072_001139_482_862 123
239 3300059653 Ga0587108_002703 Ga0587108_002703_196_576 123
240 3300060353 Ga0501082_0444262 Ga0501082_0444262_425_796 123
241 iso_pu_bacteria 2643221564 2643836717 123
242 iso_pu_bacteria 3004334049 3004336869 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

17

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.9011 17 118
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.8492 17 118
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.8202 17 118
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.8145 20 123
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.8133 17 118
ID Description Score Start End Superfamily
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9011 17 118 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8936 17 118 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8698 17 118 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8627 17 118 1.20.1300.10
af_P0AC44_1_115_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8571 17 118 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A251WMT3-F1-model_v4 deleted 0.9811 26 123
AF-A0A537NV84-F1-model_v4 Succinate dehydrogenase, hydrophobic membrane anchor protein 0.9801 30 123 GO:0006099
GO:0016020
GO:0020037
AF-A0A537NCS2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9758 16 123 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E4I3Q9-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.973 24 120 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A6J4L7T2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9727 27 120 GO:0006099
GO:0016020
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.74 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map