F355067
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 211 | 189 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0104759|Ga0501067_0104759_11_439 |
| Length | 142 |
| Sequence | MVISEMTLHPNDSPTQARIRTPLARVRGLGSAKEGADHFWKQRVTAIANLVLVCILAGIVVHLIGADYATVKKTLAKPLVGILLILLVLSGVHHMRLGMQTIIEDYVTSEGRKIALLMLNSFFAICVALSCIFAVLKLSLGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 2 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 3 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 4 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 5 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 6 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 7 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 8 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 9 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 10 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 11 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 12 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 13 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 14 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 15 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 16 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 17 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 18 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 19 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 20 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 21 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 22 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 23 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 24 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 25 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 26 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 27 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 28 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 29 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 30 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 31 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 32 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 33 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 34 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 35 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 36 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 37 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 38 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 39 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 40 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 41 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 42 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 43 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 44 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 45 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 46 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 47 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 48 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 49 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 50 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 173 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 196 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 197 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 199 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 206 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 207 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 208 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 209 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 210 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 211 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.03 |
| Metatranscriptomes | 2.07 |
| Isolates | 21.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 7.44 |
| Nodule | 11.57 |
| Rhizoplane | 11.57 |
| Rhizosphere | 54.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10080090 | 3300001990 | Unclassified | 972 |
| 2 | JGI25162J39368_1000879 | 3300002737 | Bacteria | 19691 |
| 3 | JGI25165J46597_1001977 | 3300003214 | Bacteria | 7923 |
| 4 | rootH2_10032833 | 3300003320 | Bacteria | 3553 |
| 5 | Ga0055526_1000528 | 3300003771 | Bacteria | 30285 |
| 6 | Ga0058692_1008528 | 3300003856 | Bacteria | 2642 |
| 7 | Ga0070690_100957223 | 3300005330 | Unclassified | 672 |
| 8 | Ga0070670_100000183 | 3300005331 | Bacteria | 57446 |
| 9 | Ga0070682_100627334 | 3300005337 | Bacteria | 852 |
| 10 | Ga0070660_100277108 | 3300005339 | Bacteria | 1372 |
| 11 | Ga0070691_10365543 | 3300005341 | Bacteria | 805 |
| 12 | Ga0070661_101215619 | 3300005344 | Bacteria | 630 |
| 13 | Ga0070668_100199832 | 3300005347 | Bacteria | 1641 |
| 14 | Ga0070673_101595244 | 3300005364 | Bacteria | 616 |
| 15 | Ga0070659_100034072 | 3300005366 | Bacteria | 3960 |
| 16 | Ga0070709_10079021 | 3300005434 | Bacteria | 2142 |
| 17 | Ga0070701_10592031 | 3300005438 | Bacteria | 733 |
| 18 | Ga0070711_101439618 | 3300005439 | Bacteria | 600 |
| 19 | Ga0070705_100366466 | 3300005440 | Bacteria | 1056 |
| 20 | Ga0070663_100000240 | 3300005455 | Bacteria | 27751 |
| 21 | Ga0068867_102059765 | 3300005459 | Bacteria | 540 |
| 22 | Ga0070679_100337678 | 3300005530 | Bacteria | 1455 |
| 23 | Ga0068853_100004963 | 3300005539 | Bacteria | 10369 |
| 24 | Ga0070695_100042122 | 3300005545 | Bacteria | 2897 |
| 25 | Ga0070696_100102088 | 3300005546 | Bacteria | 2056 |
| 26 | Ga0070693_100572313 | 3300005547 | Bacteria | 812 |
| 27 | Ga0070665_101030908 | 3300005548 | Bacteria | 835 |
| 28 | Ga0070665_101467519 | 3300005548 | Bacteria | 691 |
| 29 | Ga0070665_101797051 | 3300005548 | Bacteria | 620 |
| 30 | Ga0070704_100989986 | 3300005549 | Bacteria | 760 |
| 31 | Ga0068855_100417755 | 3300005563 | Bacteria | 1467 |
| 32 | Ga0068857_100012507 | 3300005577 | Bacteria | 7390 |
| 33 | Ga0068856_100014117 | 3300005614 | Bacteria | 7725 |
| 34 | Ga0068856_100430772 | 3300005614 | Bacteria | 1339 |
| 35 | Ga0068852_101765257 | 3300005616 | Bacteria | 641 |
| 36 | Ga0068864_100292958 | 3300005618 | Bacteria | 1521 |
| 37 | Ga0068870_10504645 | 3300005840 | Bacteria | 807 |
| 38 | Ga0068858_100184171 | 3300005842 | Bacteria | 1972 |
| 39 | Ga0068860_101200907 | 3300005843 | Bacteria | 779 |
| 40 | Ga0068862_100937465 | 3300005844 | Bacteria | 853 |
| 41 | Ga0081455_10000371 | 3300005937 | Bacteria | 59407 |
| 42 | Ga0075369_10144601 | 3300006186 | Bacteria | 1085 |
| 43 | Ga0075370_10870955 | 3300006353 | Bacteria | 550 |
| 44 | Ga0068865_100391258 | 3300006881 | Bacteria | 1136 |
| 45 | Ga0099826_10030104 | 3300006948 | Bacteria | 3947 |
| 46 | Ga0105244_10164819 | 3300009036 | Bacteria | 1057 |
| 47 | Ga0105240_11255408 | 3300009093 | Bacteria | 783 |
| 48 | Ga0105247_10910504 | 3300009101 | Unclassified | 680 |
| 49 | Ga0105241_10062697 | 3300009174 | Bacteria | 2867 |
| 50 | Ga0105238_10032342 | 3300009551 | Bacteria | 5323 |
| 51 | Ga0105239_10633940 | 3300010375 | Bacteria | 1220 |
| 52 | Ga0105246_10283931 | 3300011119 | Bacteria | 1329 |
| 53 | Ga0157370_10292918 | 3300013104 | Bacteria | 1503 |
| 54 | Ga0157369_10054912 | 3300013105 | Bacteria | 4300 |
| 55 | Ga0157369_10087123 | 3300013105 | Bacteria | 3335 |
| 56 | Ga0157374_11763165 | 3300013296 | Bacteria | 644 |
| 57 | Ga0157378_10607300 | 3300013297 | Bacteria | 1106 |
| 58 | Ga0157372_10166293 | 3300013307 | Bacteria | 2551 |
| 59 | Ga0157372_12224639 | 3300013307 | Bacteria | 630 |
| 60 | Ga0157375_10495624 | 3300013308 | Bacteria | 1386 |
| 61 | Ga0182008_10919883 | 3300014497 | Bacteria | 516 |
| 62 | Ga0213876_10740605 | 3300021384 | Unclassified | 523 |
| 63 | Ga0209563_102664 | 3300025230 | Bacteria | 3946 |
| 64 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 65 | Ga0209148_1007754 | 3300025254 | Bacteria | 2202 |
| 66 | Ga0209759_1014622 | 3300025256 | Bacteria | 2065 |
| 67 | Ga0209233_1000134 | 3300025261 | Bacteria | 202535 |
| 68 | Ga0209455_1010448 | 3300025272 | Bacteria | 2359 |
| 69 | Ga0209025_1042368 | 3300025294 | Bacteria | 1935 |
| 70 | Ga0209564_1000752 | 3300025295 | Bacteria | 45914 |
| 71 | Ga0207653_10281211 | 3300025885 | Bacteria | 642 |
| 72 | Ga0207647_10090822 | 3300025904 | Bacteria | 1821 |
| 73 | Ga0207705_10693446 | 3300025909 | Bacteria | 792 |
| 74 | Ga0207654_10042128 | 3300025911 | Bacteria | 2582 |
| 75 | Ga0207707_10087376 | 3300025912 | Bacteria | 2724 |
| 76 | Ga0207671_10184159 | 3300025914 | Bacteria | 1626 |
| 77 | Ga0207657_10090785 | 3300025919 | Bacteria | 2549 |
| 78 | Ga0207652_10568868 | 3300025921 | Bacteria | 1018 |
| 79 | Ga0207694_10273439 | 3300025924 | Bacteria | 1386 |
| 80 | Ga0207650_10000151 | 3300025925 | Bacteria | 83229 |
| 81 | Ga0207690_10624607 | 3300025932 | Bacteria | 881 |
| 82 | Ga0207704_11374360 | 3300025938 | Bacteria | 605 |
| 83 | Ga0207679_10314138 | 3300025945 | Bacteria | 1355 |
| 84 | Ga0207667_10222078 | 3300025949 | Bacteria | 1936 |
| 85 | Ga0207677_10236816 | 3300026023 | Bacteria | 1474 |
| 86 | Ga0207703_10401506 | 3300026035 | Bacteria | 1272 |
| 87 | Ga0207639_10124178 | 3300026041 | Bacteria | 2126 |
| 88 | Ga0207639_11337174 | 3300026041 | Bacteria | 672 |
| 89 | Ga0207678_10000440 | 3300026067 | Bacteria | 37762 |
| 90 | Ga0207702_10014459 | 3300026078 | Bacteria | 6553 |
| 91 | Ga0207702_10377901 | 3300026078 | Bacteria | 1362 |
| 92 | Ga0207641_11048645 | 3300026088 | Bacteria | 813 |
| 93 | Ga0207676_10153518 | 3300026095 | Bacteria | 1986 |
| 94 | Ga0207674_10266529 | 3300026116 | Bacteria | 1660 |
| 95 | Ga0207675_100975722 | 3300026118 | Bacteria | 865 |
| 96 | Ga0207698_10398227 | 3300026142 | Bacteria | 1315 |
| 97 | Ga0209371_1001857 | 3300027312 | Bacteria | 12997 |
| 98 | Ga0209371_1005149 | 3300027312 | Bacteria | 5340 |
| 99 | Ga0209282_1039116 | 3300027666 | Bacteria | 2833 |
| 100 | Ga0268266_11465530 | 3300028379 | Bacteria | 658 |
| 101 | Ga0268265_10634945 | 3300028380 | Bacteria | 1025 |
| 102 | Ga0268264_10906056 | 3300028381 | Bacteria | 885 |
| 103 | Ga0268256_1008786 | 3300030500 | Bacteria | 3431 |
| 104 | Ga0268256_1020398 | 3300030500 | Bacteria | 1787 |
| 105 | Ga0307408_101378257 | 3300031548 | Bacteria | 663 |
| 106 | Ga0307408_101394494 | 3300031548 | Bacteria | 660 |
| 107 | Ga0307516_10332797 | 3300031730 | Bacteria | 1187 |
| 108 | Ga0373936_0065935 | 3300035113 | Bacteria | 1486 |
| 109 | Ga0373935_0354836 | 3300035692 | Bacteria | 1046 |
| 110 | Ga0316582_0302039 | 3300036647 | Bacteria | 1100 |
| 111 | Ga0395899_0000124 | 3300037312 | Bacteria | 122011 |
| 112 | Ga0395900_0000086 | 3300037418 | Bacteria | 171749 |
| 113 | Ga0395900_0047566 | 3300037418 | Bacteria | 4417 |
| 114 | Ga0395900_0100158 | 3300037418 | Bacteria | 2976 |
| 115 | Ga0395898_0000285 | 3300037466 | Bacteria | 122279 |
| 116 | Ga0395898_0525522 | 3300037466 | Bacteria | 1125 |
| 117 | Ga0395905_0000133 | 3300037471 | Bacteria | 123500 |
| 118 | Ga0395901_0000092 | 3300038443 | Bacteria | 121976 |
| 119 | Ga0436365_0513625 | 3300039437 | Bacteria | 1647 |
| 120 | Ga0436365_0610273 | 3300039437 | Bacteria | 554 |
| 121 | Ga0451837_0998999 | 3300041494 | Bacteria | 702 |
| 122 | Ga0466963_0078708 | 3300044694 | Bacteria | 2229 |
| 123 | Ga0451576_0281274 | 3300045051 | Bacteria | 1740 |
| 124 | Ga0495606_0645099 | 3300046507 | Bacteria | 513 |
| 125 | Ga0495602_0250931 | 3300048088 | Bacteria | 1319 |
| 126 | Ga0496100_0091138 | 3300048903 | Bacteria | 2080 |
| 127 | Ga0496101_0124953 | 3300048904 | Bacteria | 1949 |
| 128 | Ga0496101_1038792 | 3300048904 | Bacteria | 644 |
| 129 | Ga0496102_0045861 | 3300048905 | Bacteria | 3968 |
| 130 | Ga0496102_0125301 | 3300048905 | Bacteria | 2401 |
| 131 | Ga0496102_0134429 | 3300048905 | Bacteria | 2317 |
| 132 | Ga0496102_0275919 | 3300048905 | Bacteria | 1584 |
| 133 | Ga0496104_0002253 | 3300048907 | Bacteria | 16633 |
| 134 | Ga0496104_0165263 | 3300048907 | Bacteria | 2122 |
| 135 | Ga0496105_0069186 | 3300048908 | Bacteria | 2917 |
| 136 | Ga0496106_0027734 | 3300048909 | Bacteria | 4219 |
| 137 | Ga0496106_0105151 | 3300048909 | Bacteria | 2193 |
| 138 | Ga0496106_0217690 | 3300048909 | Bacteria | 1522 |
| 139 | Ga0496107_0006452 | 3300048910 | Bacteria | 8068 |
| 140 | Ga0496107_0377722 | 3300048910 | Bacteria | 1054 |
| 141 | Ga0496108_0073643 | 3300048911 | Bacteria | 2883 |
| 142 | Ga0496108_0302043 | 3300048911 | Bacteria | 1394 |
| 143 | Ga0496108_0393083 | 3300048911 | Bacteria | 1211 |
| 144 | Ga0496109_0052808 | 3300048912 | Bacteria | 3705 |
| 145 | Ga0496109_1288860 | 3300048912 | Bacteria | 667 |
| 146 | Ga0496110_0024773 | 3300048913 | Bacteria | 5119 |
| 147 | Ga0496110_0276724 | 3300048913 | Bacteria | 1528 |
| 148 | Ga0496112_0078918 | 3300048915 | Bacteria | 3255 |
| 149 | Ga0496113_0043494 | 3300048916 | Bacteria | 3324 |
| 150 | Ga0496114_0096500 | 3300048917 | Bacteria | 2517 |
| 151 | Ga0496115_0010949 | 3300048918 | Bacteria | 6791 |
| 152 | Ga0496115_0016288 | 3300048918 | Bacteria | 5657 |
| 153 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 154 | Ga0496117_0120579 | 3300048920 | Bacteria | 1612 |
| 155 | Ga0496118_0074368 | 3300048921 | Bacteria | 2429 |
| 156 | Ga0496119_0138800 | 3300048922 | Bacteria | 1315 |
| 157 | Ga0496121_0020154 | 3300048924 | Bacteria | 6620 |
| 158 | Ga0496122_0096365 | 3300048925 | Bacteria | 1995 |
| 159 | Ga0496124_0104853 | 3300048927 | Bacteria | 2285 |
| 160 | Ga0496126_0002222 | 3300048929 | Bacteria | 26858 |
| 161 | Ga0496126_0609847 | 3300048929 | Bacteria | 859 |
| 162 | Ga0501032_0151241 | 3300049569 | Bacteria | 1526 |
| 163 | Ga0501033_0000518 | 3300049570 | Bacteria | 36156 |
| 164 | Ga0501034_0069806 | 3300049571 | Bacteria | 3524 |
| 165 | Ga0501036_1203601 | 3300049572 | Bacteria | 617 |
| 166 | Ga0501042_0570199 | 3300049578 | Bacteria | 823 |
| 167 | Ga0501042_0618115 | 3300049578 | Bacteria | 788 |
| 168 | Ga0501047_0573047 | 3300049581 | Bacteria | 952 |
| 169 | Ga0501048_0000508 | 3300049582 | Bacteria | 27268 |
| 170 | Ga0501067_0104759 | 3300049583 | Bacteria | 1572 |
| 171 | Ga0501070_0659319 | 3300049586 | Bacteria | 830 |
| 172 | Ga0501077_0181741 | 3300049593 | Bacteria | 1337 |
| 173 | Ga0501035_0000316 | 3300049822 | Bacteria | 55833 |
| 174 | Ga0501035_0149490 | 3300049822 | Bacteria | 2028 |
| 175 | Ga0501035_1433821 | 3300049822 | Unclassified | 528 |
| 176 | Ga0501044_0643599 | 3300049823 | Bacteria | 950 |
| 177 | Ga0501045_0548254 | 3300049824 | Bacteria | 858 |
| 178 | nmdc:mga03n38_413705_c1 | 3300050490 | Bacteria | 744 |
| 179 | nmdc:mga00v17_147288_c1 | 3300050491 | Bacteria | 1511 |
| 180 | nmdc:mga0k408_677049_c1 | 3300050493 | Bacteria | 605 |
| 181 | nmdc:mga0sz30_213487_c1 | 3300050516 | Bacteria | 858 |
| 182 | Ga0500595_115555 | 3300053119 | Bacteria | 760 |
| 183 | Ga0500608_101911 | 3300053122 | Bacteria | 1329 |
| 184 | Ga0587090_000170 | 3300059510 | Bacteria | 4514 |
| 185 | Ga0587091_006705 | 3300059511 | Bacteria | 1629 |
| 186 | Ga0587067_006768 | 3300059640 | Bacteria | 1613 |
| 187 | Ga0587072_001139 | 3300059643 | Bacteria | 3152 |
| 188 | Ga0587108_002703 | 3300059653 | Bacteria | 1207 |
| 189 | Ga0501082_0444262 | 3300060353 | Bacteria | 1133 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0047566 | Ga0395900_0047566_384_779 | 103 |
| 2 | 3300031548 | Ga0307408_101378257 | Ga0307408_1013782572 | 108 |
| 3 | 3300049571 | Ga0501034_0069806 | Ga0501034_0069806_610_993 | 111 |
| 4 | 3300049582 | Ga0501048_0000508 | Ga0501048_0000508_5307_5690 | 113 |
| 5 | 3300005434 | Ga0070709_10079021 | Ga0070709_100790211 | 114 |
| 6 | 3300026041 | Ga0207639_11337174 | Ga0207639_113371741 | 114 |
| 7 | 3300044694 | Ga0466963_0078708 | Ga0466963_0078708_1080_1496 | 115 |
| 8 | 3300050493 | nmdc:mga0k408_677049_c1 | nmdc:mga0k408_677049_c1_155_514 | 118 |
| 9 | iso_pu_bacteria | 2512875026 | 2512973697 | 121 |
| 10 | iso_pu_bacteria | 2513237160 | 2514003631 | 121 |
| 11 | iso_pu_bacteria | 2537561587 | 2537876649 | 121 |
| 12 | iso_pu_bacteria | 2615840698 | 2616557643 | 121 |
| 13 | iso_pu_bacteria | 2643221568 | 2643855022 | 121 |
| 14 | iso_pu_bacteria | 2643221618 | 2644110058 | 121 |
| 15 | iso_pu_bacteria | 2643221626 | 2644150334 | 121 |
| 16 | iso_pu_bacteria | 2643221655 | 2644312938 | 121 |
| 17 | iso_pu_bacteria | 2643221659 | 2644336486 | 121 |
| 18 | iso_pu_bacteria | 2643221698 | 2644546132 | 121 |
| 19 | iso_pu_bacteria | 2643221712 | 2644618668 | 121 |
| 20 | iso_pu_bacteria | 2667528174 | 2671113537 | 121 |
| 21 | iso_pu_bacteria | 2775507266 | 2778173690 | 121 |
| 22 | iso_pu_bacteria | 2802428858 | 2802717333 | 121 |
| 23 | iso_pu_bacteria | 2802428862 | 2802743181 | 121 |
| 24 | iso_pu_bacteria | 2802428863 | 2802749693 | 121 |
| 25 | iso_pu_bacteria | 2818991448 | 2819611180 | 121 |
| 26 | iso_pu_bacteria | 2838029111 | 2838030873 | 121 |
| 27 | iso_pu_bacteria | 2838074704 | 2838078270 | 121 |
| 28 | iso_pu_bacteria | 2841859092 | 2841863161 | 121 |
| 29 | iso_pu_bacteria | 2842475841 | 2842477605 | 121 |
| 30 | iso_pu_bacteria | 2842502639 | 2842504522 | 121 |
| 31 | iso_pu_bacteria | 2842515876 | 2842520101 | 121 |
| 32 | iso_pu_bacteria | 2844163670 | 2844164257 | 121 |
| 33 | iso_pu_bacteria | 2899792073 | 2899795260 | 121 |
| 34 | iso_pu_bacteria | 2919166419 | 2919170644 | 121 |
| 35 | iso_pu_bacteria | 2919408235 | 2919411005 | 121 |
| 36 | iso_pu_bacteria | 2933011516 | 2933015639 | 121 |
| 37 | iso_pu_bacteria | 2937036028 | 2937036093 | 121 |
| 38 | iso_pu_bacteria | 2937084907 | 2937086382 | 121 |
| 39 | iso_pu_bacteria | 2941499720 | 2941501254 | 121 |
| 40 | iso_pu_bacteria | 2957437181 | 2957439754 | 121 |
| 41 | iso_pu_bacteria | 2960591022 | 2960594977 | 121 |
| 42 | iso_pu_bacteria | 2967728569 | 2967731930 | 121 |
| 43 | iso_pu_bacteria | 2970026789 | 2970029926 | 121 |
| 44 | iso_pu_bacteria | 2970122695 | 2970125856 | 121 |
| 45 | iso_pu_bacteria | 2970143518 | 2970143721 | 121 |
| 46 | iso_pu_bacteria | 2977530762 | 2977534677 | 121 |
| 47 | iso_pu_bacteria | 2978969890 | 2978972546 | 121 |
| 48 | iso_pu_bacteria | 2984587000 | 2984590799 | 121 |
| 49 | iso_pu_bacteria | 3005416602 | 3005421685 | 121 |
| 50 | iso_pu_bacteria | 8003999396 | 8004002960 | 121 |
| 51 | iso_pu_bacteria | 8005314921 | 8005319611 | 121 |
| 52 | iso_pu_bacteria | 8005484373 | 8005490233 | 121 |
| 53 | iso_pu_bacteria | 8005645114 | 8005646890 | 121 |
| 54 | iso_pu_bacteria | 8005682033 | 8005688048 | 121 |
| 55 | iso_pu_bacteria | 8024486573 | 8024490789 | 121 |
| 56 | iso_pu_bacteria | 8054460903 | 8054463708 | 121 |
| 57 | iso_pu_bacteria | 2511231027 | 2511389019 | 122 |
| 58 | iso_pu_bacteria | 2757320392 | 2757570290 | 122 |
| 59 | iso_pu_bacteria | 2842871566 | 2842873950 | 122 |
| 60 | 3300001990 | JGI24737J22298_10080090 | JGI24737J22298_100800902 | 123 |
| 61 | 3300002737 | JGI25162J39368_1000879 | JGI25162J39368_100087923 | 123 |
| 62 | 3300003214 | JGI25165J46597_1001977 | JGI25165J46597_10019772 | 123 |
| 63 | 3300003320 | rootH2_10032833 | rootH2_100328335 | 123 |
| 64 | 3300003771 | Ga0055526_1000528 | Ga0055526_100052831 | 123 |
| 65 | 3300003856 | Ga0058692_1008528 | Ga0058692_10085284 | 123 |
| 66 | 3300005330 | Ga0070690_100957223 | Ga0070690_1009572231 | 123 |
| 67 | 3300005331 | Ga0070670_100000183 | Ga0070670_10000018333 | 123 |
| 68 | 3300005337 | Ga0070682_100627334 | Ga0070682_1006273342 | 123 |
| 69 | 3300005339 | Ga0070660_100277108 | Ga0070660_1002771082 | 123 |
| 70 | 3300005341 | Ga0070691_10365543 | Ga0070691_103655432 | 123 |
| 71 | 3300005344 | Ga0070661_101215619 | Ga0070661_1012156192 | 123 |
| 72 | 3300005347 | Ga0070668_100199832 | Ga0070668_1001998322 | 123 |
| 73 | 3300005364 | Ga0070673_101595244 | Ga0070673_1015952442 | 123 |
| 74 | 3300005366 | Ga0070659_100034072 | Ga0070659_1000340724 | 123 |
| 75 | 3300005438 | Ga0070701_10592031 | Ga0070701_105920311 | 123 |
| 76 | 3300005439 | Ga0070711_101439618 | Ga0070711_1014396181 | 123 |
| 77 | 3300005440 | Ga0070705_100366466 | Ga0070705_1003664662 | 123 |
| 78 | 3300005455 | Ga0070663_100000240 | Ga0070663_1000002404 | 123 |
| 79 | 3300005459 | Ga0068867_102059765 | Ga0068867_1020597652 | 123 |
| 80 | 3300005530 | Ga0070679_100337678 | Ga0070679_1003376782 | 123 |
| 81 | 3300005539 | Ga0068853_100004963 | Ga0068853_1000049633 | 123 |
| 82 | 3300005545 | Ga0070695_100042122 | Ga0070695_1000421223 | 123 |
| 83 | 3300005546 | Ga0070696_100102088 | Ga0070696_1001020883 | 123 |
| 84 | 3300005547 | Ga0070693_100572313 | Ga0070693_1005723132 | 123 |
| 85 | 3300005548 | Ga0070665_101030908 | Ga0070665_1010309082 | 123 |
| 86 | 3300005548 | Ga0070665_101467519 | Ga0070665_1014675192 | 123 |
| 87 | 3300005548 | Ga0070665_101797051 | Ga0070665_1017970511 | 123 |
| 88 | 3300005549 | Ga0070704_100989986 | Ga0070704_1009899861 | 123 |
| 89 | 3300005563 | Ga0068855_100417755 | Ga0068855_1004177552 | 123 |
| 90 | 3300005577 | Ga0068857_100012507 | Ga0068857_1000125072 | 123 |
| 91 | 3300005614 | Ga0068856_100014117 | Ga0068856_1000141177 | 123 |
| 92 | 3300005614 | Ga0068856_100430772 | Ga0068856_1004307722 | 123 |
| 93 | 3300005616 | Ga0068852_101765257 | Ga0068852_1017652572 | 123 |
| 94 | 3300005618 | Ga0068864_100292958 | Ga0068864_1002929583 | 123 |
| 95 | 3300005840 | Ga0068870_10504645 | Ga0068870_105046452 | 123 |
| 96 | 3300005842 | Ga0068858_100184171 | Ga0068858_1001841713 | 123 |
| 97 | 3300005843 | Ga0068860_101200907 | Ga0068860_1012009072 | 123 |
| 98 | 3300005844 | Ga0068862_100937465 | Ga0068862_1009374652 | 123 |
| 99 | 3300005937 | Ga0081455_10000371 | Ga0081455_100003714 | 123 |
| 100 | 3300006186 | Ga0075369_10144601 | Ga0075369_101446013 | 123 |
| 101 | 3300006353 | Ga0075370_10870955 | Ga0075370_108709552 | 123 |
| 102 | 3300006881 | Ga0068865_100391258 | Ga0068865_1003912581 | 123 |
| 103 | 3300006948 | Ga0099826_10030104 | Ga0099826_100301046 | 123 |
| 104 | 3300009036 | Ga0105244_10164819 | Ga0105244_101648192 | 123 |
| 105 | 3300009093 | Ga0105240_11255408 | Ga0105240_112554082 | 123 |
| 106 | 3300009101 | Ga0105247_10910504 | Ga0105247_109105042 | 123 |
| 107 | 3300009174 | Ga0105241_10062697 | Ga0105241_100626972 | 123 |
| 108 | 3300009551 | Ga0105238_10032342 | Ga0105238_100323424 | 123 |
| 109 | 3300010375 | Ga0105239_10633940 | Ga0105239_106339402 | 123 |
| 110 | 3300011119 | Ga0105246_10283931 | Ga0105246_102839312 | 123 |
| 111 | 3300013104 | Ga0157370_10292918 | Ga0157370_102929182 | 123 |
| 112 | 3300013105 | Ga0157369_10054912 | Ga0157369_100549123 | 123 |
| 113 | 3300013105 | Ga0157369_10087123 | Ga0157369_100871232 | 123 |
| 114 | 3300013296 | Ga0157374_11763165 | Ga0157374_117631651 | 123 |
| 115 | 3300013297 | Ga0157378_10607300 | Ga0157378_106073002 | 123 |
| 116 | 3300013307 | Ga0157372_10166293 | Ga0157372_101662932 | 123 |
| 117 | 3300013307 | Ga0157372_12224639 | Ga0157372_122246392 | 123 |
| 118 | 3300013308 | Ga0157375_10495624 | Ga0157375_104956242 | 123 |
| 119 | 3300014497 | Ga0182008_10919883 | Ga0182008_109198832 | 123 |
| 120 | 3300021384 | Ga0213876_10740605 | Ga0213876_107406051 | 123 |
| 121 | 3300025230 | Ga0209563_102664 | Ga0209563_1026648 | 123 |
| 122 | 3300025233 | Ga0209437_100057 | Ga0209437_100057153 | 123 |
| 123 | 3300025254 | Ga0209148_1007754 | Ga0209148_10077542 | 123 |
| 124 | 3300025256 | Ga0209759_1014622 | Ga0209759_10146223 | 123 |
| 125 | 3300025261 | Ga0209233_1000134 | Ga0209233_1000134153 | 123 |
| 126 | 3300025272 | Ga0209455_1010448 | Ga0209455_10104482 | 123 |
| 127 | 3300025294 | Ga0209025_1042368 | Ga0209025_10423682 | 123 |
| 128 | 3300025295 | Ga0209564_1000752 | Ga0209564_10007522 | 123 |
| 129 | 3300025885 | Ga0207653_10281211 | Ga0207653_102812112 | 123 |
| 130 | 3300025904 | Ga0207647_10090822 | Ga0207647_100908222 | 123 |
| 131 | 3300025909 | Ga0207705_10693446 | Ga0207705_106934462 | 123 |
| 132 | 3300025911 | Ga0207654_10042128 | Ga0207654_100421284 | 123 |
| 133 | 3300025912 | Ga0207707_10087376 | Ga0207707_100873764 | 123 |
| 134 | 3300025914 | Ga0207671_10184159 | Ga0207671_101841592 | 123 |
| 135 | 3300025919 | Ga0207657_10090785 | Ga0207657_100907852 | 123 |
| 136 | 3300025921 | Ga0207652_10568868 | Ga0207652_105688682 | 123 |
| 137 | 3300025924 | Ga0207694_10273439 | Ga0207694_102734392 | 123 |
| 138 | 3300025925 | Ga0207650_10000151 | Ga0207650_1000015137 | 123 |
| 139 | 3300025932 | Ga0207690_10624607 | Ga0207690_106246072 | 123 |
| 140 | 3300025938 | Ga0207704_11374360 | Ga0207704_113743601 | 123 |
| 141 | 3300025945 | Ga0207679_10314138 | Ga0207679_103141382 | 123 |
| 142 | 3300025949 | Ga0207667_10222078 | Ga0207667_102220783 | 123 |
| 143 | 3300026023 | Ga0207677_10236816 | Ga0207677_102368162 | 123 |
| 144 | 3300026035 | Ga0207703_10401506 | Ga0207703_104015062 | 123 |
| 145 | 3300026041 | Ga0207639_10124178 | Ga0207639_101241783 | 123 |
| 146 | 3300026067 | Ga0207678_10000440 | Ga0207678_1000044043 | 123 |
| 147 | 3300026078 | Ga0207702_10014459 | Ga0207702_100144597 | 123 |
| 148 | 3300026078 | Ga0207702_10377901 | Ga0207702_103779013 | 123 |
| 149 | 3300026088 | Ga0207641_11048645 | Ga0207641_110486451 | 123 |
| 150 | 3300026095 | Ga0207676_10153518 | Ga0207676_101535182 | 123 |
| 151 | 3300026116 | Ga0207674_10266529 | Ga0207674_102665293 | 123 |
| 152 | 3300026118 | Ga0207675_100975722 | Ga0207675_1009757222 | 123 |
| 153 | 3300026142 | Ga0207698_10398227 | Ga0207698_103982272 | 123 |
| 154 | 3300027312 | Ga0209371_1001857 | Ga0209371_100185711 | 123 |
| 155 | 3300027312 | Ga0209371_1005149 | Ga0209371_10051493 | 123 |
| 156 | 3300027666 | Ga0209282_1039116 | Ga0209282_10391166 | 123 |
| 157 | 3300028379 | Ga0268266_11465530 | Ga0268266_114655302 | 123 |
| 158 | 3300028380 | Ga0268265_10634945 | Ga0268265_106349452 | 123 |
| 159 | 3300028381 | Ga0268264_10906056 | Ga0268264_109060562 | 123 |
| 160 | 3300030500 | Ga0268256_1008786 | Ga0268256_10087862 | 123 |
| 161 | 3300030500 | Ga0268256_1020398 | Ga0268256_10203982 | 123 |
| 162 | 3300031548 | Ga0307408_101394494 | Ga0307408_1013944942 | 123 |
| 163 | 3300031730 | Ga0307516_10332797 | Ga0307516_103327972 | 123 |
| 164 | 3300035113 | Ga0373936_0065935 | Ga0373936_0065935_419_799 | 123 |
| 165 | 3300035692 | Ga0373935_0354836 | Ga0373935_0354836_77_457 | 123 |
| 166 | 3300036647 | Ga0316582_0302039 | Ga0316582_0302039_408_782 | 123 |
| 167 | 3300037312 | Ga0395899_0000124 | Ga0395899_0000124_112068_112463 | 123 |
| 168 | 3300037418 | Ga0395900_0000086 | Ga0395900_0000086_59287_59682 | 123 |
| 169 | 3300037418 | Ga0395900_0100158 | Ga0395900_0100158_1913_2293 | 123 |
| 170 | 3300037466 | Ga0395898_0000285 | Ga0395898_0000285_112068_112463 | 123 |
| 171 | 3300037466 | Ga0395898_0525522 | Ga0395898_0525522_198_578 | 123 |
| 172 | 3300037471 | Ga0395905_0000133 | Ga0395905_0000133_11038_11433 | 123 |
| 173 | 3300038443 | Ga0395901_0000092 | Ga0395901_0000092_9514_9909 | 123 |
| 174 | 3300039437 | Ga0436365_0513625 | Ga0436365_0513625_537_917 | 123 |
| 175 | 3300039437 | Ga0436365_0610273 | Ga0436365_0610273_100_489 | 123 |
| 176 | 3300041494 | Ga0451837_0998999 | Ga0451837_0998999_289_669 | 123 |
| 177 | 3300045051 | Ga0451576_0281274 | Ga0451576_0281274_830_1210 | 123 |
| 178 | 3300046507 | Ga0495606_0645099 | Ga0495606_0645099_66_446 | 123 |
| 179 | 3300048088 | Ga0495602_0250931 | Ga0495602_0250931_541_930 | 123 |
| 180 | 3300048903 | Ga0496100_0091138 | Ga0496100_0091138_957_1337 | 123 |
| 181 | 3300048904 | Ga0496101_0124953 | Ga0496101_0124953_1107_1487 | 123 |
| 182 | 3300048904 | Ga0496101_1038792 | Ga0496101_1038792_255_626 | 123 |
| 183 | 3300048905 | Ga0496102_0045861 | Ga0496102_0045861_1489_1872 | 123 |
| 184 | 3300048905 | Ga0496102_0125301 | Ga0496102_0125301_1435_1809 | 123 |
| 185 | 3300048905 | Ga0496102_0134429 | Ga0496102_0134429_1768_2151 | 123 |
| 186 | 3300048905 | Ga0496102_0275919 | Ga0496102_0275919_1161_1544 | 123 |
| 187 | 3300048907 | Ga0496104_0002253 | Ga0496104_0002253_1064_1444 | 123 |
| 188 | 3300048907 | Ga0496104_0165263 | Ga0496104_0165263_505_876 | 123 |
| 189 | 3300048908 | Ga0496105_0069186 | Ga0496105_0069186_2062_2442 | 123 |
| 190 | 3300048909 | Ga0496106_0027734 | Ga0496106_0027734_231_611 | 123 |
| 191 | 3300048909 | Ga0496106_0105151 | Ga0496106_0105151_1395_1766 | 123 |
| 192 | 3300048909 | Ga0496106_0217690 | Ga0496106_0217690_1046_1429 | 123 |
| 193 | 3300048910 | Ga0496107_0006452 | Ga0496107_0006452_7392_7775 | 123 |
| 194 | 3300048910 | Ga0496107_0377722 | Ga0496107_0377722_654_1025 | 123 |
| 195 | 3300048911 | Ga0496108_0073643 | Ga0496108_0073643_989_1360 | 123 |
| 196 | 3300048911 | Ga0496108_0302043 | Ga0496108_0302043_375_755 | 123 |
| 197 | 3300048911 | Ga0496108_0393083 | Ga0496108_0393083_456_830 | 123 |
| 198 | 3300048912 | Ga0496109_0052808 | Ga0496109_0052808_2311_2682 | 123 |
| 199 | 3300048912 | Ga0496109_1288860 | Ga0496109_1288860_217_600 | 123 |
| 200 | 3300048913 | Ga0496110_0024773 | Ga0496110_0024773_974_1354 | 123 |
| 201 | 3300048913 | Ga0496110_0276724 | Ga0496110_0276724_590_961 | 123 |
| 202 | 3300048915 | Ga0496112_0078918 | Ga0496112_0078918_540_911 | 123 |
| 203 | 3300048916 | Ga0496113_0043494 | Ga0496113_0043494_2311_2682 | 123 |
| 204 | 3300048917 | Ga0496114_0096500 | Ga0496114_0096500_1592_1975 | 123 |
| 205 | 3300048918 | Ga0496115_0010949 | Ga0496115_0010949_5080_5460 | 123 |
| 206 | 3300048918 | Ga0496115_0016288 | Ga0496115_0016288_1355_1738 | 123 |
| 207 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_275278_275658 | 123 |
| 208 | 3300048920 | Ga0496117_0120579 | Ga0496117_0120579_800_1180 | 123 |
| 209 | 3300048921 | Ga0496118_0074368 | Ga0496118_0074368_1936_2316 | 123 |
| 210 | 3300048922 | Ga0496119_0138800 | Ga0496119_0138800_238_618 | 123 |
| 211 | 3300048924 | Ga0496121_0020154 | Ga0496121_0020154_4648_5028 | 123 |
| 212 | 3300048925 | Ga0496122_0096365 | Ga0496122_0096365_1133_1513 | 123 |
| 213 | 3300048927 | Ga0496124_0104853 | Ga0496124_0104853_1046_1426 | 123 |
| 214 | 3300048929 | Ga0496126_0002222 | Ga0496126_0002222_24969_25349 | 123 |
| 215 | 3300048929 | Ga0496126_0609847 | Ga0496126_0609847_470_844 | 123 |
| 216 | 3300049569 | Ga0501032_0151241 | Ga0501032_0151241_181_555 | 123 |
| 217 | 3300049570 | Ga0501033_0000518 | Ga0501033_0000518_7378_7752 | 123 |
| 218 | 3300049572 | Ga0501036_1203601 | Ga0501036_1203601_37_432 | 123 |
| 219 | 3300049578 | Ga0501042_0570199 | Ga0501042_0570199_290_661 | 123 |
| 220 | 3300049578 | Ga0501042_0618115 | Ga0501042_0618115_173_553 | 123 |
| 221 | 3300049581 | Ga0501047_0573047 | Ga0501047_0573047_215_598 | 123 |
| 222 | 3300049583 | Ga0501067_0104759 | Ga0501067_0104759_11_439 | 123 |
| 223 | 3300049586 | Ga0501070_0659319 | Ga0501070_0659319_296_676 | 123 |
| 224 | 3300049593 | Ga0501077_0181741 | Ga0501077_0181741_545_916 | 123 |
| 225 | 3300049822 | Ga0501035_0000316 | Ga0501035_0000316_26347_26721 | 123 |
| 226 | 3300049822 | Ga0501035_0149490 | Ga0501035_0149490_912_1292 | 123 |
| 227 | 3300049822 | Ga0501035_1433821 | Ga0501035_1433821_109_480 | 123 |
| 228 | 3300049823 | Ga0501044_0643599 | Ga0501044_0643599_319_699 | 123 |
| 229 | 3300049824 | Ga0501045_0548254 | Ga0501045_0548254_56_427 | 123 |
| 230 | 3300050490 | nmdc:mga03n38_413705_c1 | nmdc:mga03n38_413705_c1_354_734 | 123 |
| 231 | 3300050491 | nmdc:mga00v17_147288_c1 | nmdc:mga00v17_147288_c1_393_773 | 123 |
| 232 | 3300050516 | nmdc:mga0sz30_213487_c1 | nmdc:mga0sz30_213487_c1_285_665 | 123 |
| 233 | 3300053119 | Ga0500595_115555 | Ga0500595_115555_319_702 | 123 |
| 234 | 3300053122 | Ga0500608_101911 | Ga0500608_101911_30_410 | 123 |
| 235 | 3300059510 | Ga0587090_000170 | Ga0587090_000170_3631_4011 | 123 |
| 236 | 3300059511 | Ga0587091_006705 | Ga0587091_006705_694_1074 | 123 |
| 237 | 3300059640 | Ga0587067_006768 | Ga0587067_006768_530_910 | 123 |
| 238 | 3300059643 | Ga0587072_001139 | Ga0587072_001139_482_862 | 123 |
| 239 | 3300059653 | Ga0587108_002703 | Ga0587108_002703_196_576 | 123 |
| 240 | 3300060353 | Ga0501082_0444262 | Ga0501082_0444262_425_796 | 123 |
| 241 | iso_pu_bacteria | 2643221564 | 2643836717 | 123 |
| 242 | iso_pu_bacteria | 3004334049 | 3004336869 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2acz-assembly1.cif.gz_D | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.9011 | 17 | 118 |
| 2wu5-assembly1.cif.gz_H | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant | 0.8492 | 17 | 118 |
| 2wu5-assembly1.cif.gz_H | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant | 0.8202 | 17 | 118 |
| 7jz2-assembly1.cif.gz_D | succinate: quinone oxidoreductase sqr from e.coli k12 | 0.8145 | 20 | 123 |
| 2acz-assembly1.cif.gz_D | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.8133 | 17 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2aczD01 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.9011 | 17 | 118 | 1.20.1300.10 |
| 2ws3H00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8936 | 17 | 118 | 1.20.1300.10 |
| 2aczD01 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8698 | 17 | 118 | 1.20.1300.10 |
| 2ws3H00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8627 | 17 | 118 | 1.20.1300.10 |
| af_P0AC44_1_115_1.20.1300.10 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.8571 | 17 | 118 | 1.20.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A251WMT3-F1-model_v4 | deleted | 0.9811 | 26 | 123 |
|
| AF-A0A537NV84-F1-model_v4 | Succinate dehydrogenase, hydrophobic membrane anchor protein | 0.9801 | 30 | 123 |
GO:0006099
GO:0016020 GO:0020037 |
| AF-A0A537NCS2-F1-model_v4 | Succinate dehydrogenase hydrophobic membrane anchor subunit | 0.9758 | 16 | 123 |
GO:0006099
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A2E4I3Q9-F1-model_v4 | Succinate dehydrogenase hydrophobic membrane anchor subunit | 0.973 | 24 | 120 |
GO:0006099
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A6J4L7T2-F1-model_v4 | Succinate dehydrogenase hydrophobic membrane anchor subunit | 0.9727 | 27 | 120 |
GO:0006099
GO:0016020 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar