F355113

General Info

Members Datasets Scaffolds Average Seq Length
242 189 484 118

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_008440|Ga0500643_008440_2082_2513
Length 143
Sequence MSDTHWLERPSAQPGRTIVTKHRIYGTSFASVYPHYLAKAQKKGRTKEEVDEIILWLTGFDQQSLDAHLAEKSDFETFFALAPEPNPARAEIKGLICGIRVEEVAEPLMREIRYLDKLIDELAKGRPMEKILRGAGSSAGQRR

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
122 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
178 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
187 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
188 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
189 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.83
Nodule 0.83
Rhizoplane 4.55
Rhizosphere 68.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_008440 3300053087 Bacteria 4046
2 JGI24739J22299_10193557 3300001989 Bacteria 597
3 JGI24737J22298_10009433 3300001990 Bacteria 3246
4 rootH1_10072533 3300003316 Bacteria 1943
5 Ga0055536_1001505 3300003781 Bacteria 14002
6 Ga0055536_1002538 3300003781 Bacteria 10216
7 Ga0055530_10003215 3300003791 Bacteria 9564
8 Ga0055530_10015673 3300003791 Bacteria 2462
9 Ga0055531_10000786 3300003794 Bacteria 26370
10 Ga0055531_10002024 3300003794 Bacteria 14020
11 Ga0065165_1000749 3300005262 Bacteria 44604
12 Ga0065165_1046557 3300005262 Bacteria 1257
13 Ga0065712_10792173 3300005290 Bacteria 515
14 Ga0070658_10089483 3300005327 Bacteria 2535
15 Ga0070683_100863370 3300005329 Bacteria 868
16 Ga0070690_101287659 3300005330 Bacteria 585
17 Ga0070670_100062023 3300005331 Bacteria 3209
18 Ga0070670_100124536 3300005331 Bacteria 2224
19 Ga0068868_100642691 3300005338 Bacteria 944
20 Ga0070660_101690618 3300005339 Bacteria 539
21 Ga0070661_100334703 3300005344 Bacteria 1185
22 Ga0070668_100024435 3300005347 Bacteria 4579
23 Ga0070671_100212265 3300005355 Bacteria 1642
24 Ga0070671_100386975 3300005355 Bacteria 1195
25 Ga0070671_101069399 3300005355 Bacteria 708
26 Ga0070673_100514747 3300005364 Bacteria 1084
27 Ga0070659_100012307 3300005366 Bacteria 6341
28 Ga0070663_100373446 3300005455 Bacteria 1160
29 Ga0070678_100064343 3300005456 Bacteria 2718
30 Ga0070662_100103196 3300005457 Bacteria 2162
31 Ga0068867_101663857 3300005459 Bacteria 598
32 Ga0070684_101101703 3300005535 Bacteria 746
33 Ga0068853_100587871 3300005539 Bacteria 1057
34 Ga0070686_100000526 3300005544 Bacteria 22933
35 Ga0070665_101383810 3300005548 Bacteria 713
36 Ga0070664_100169176 3300005564 Bacteria 1938
37 Ga0068857_100091196 3300005577 Bacteria 2727
38 Ga0068859_102532319 3300005617 Bacteria 565
39 Ga0068864_100010466 3300005618 Bacteria 7664
40 Ga0068863_100118673 3300005841 Bacteria 2521
41 Ga0068863_100135812 3300005841 Bacteria 2350
42 Ga0068863_101890281 3300005841 Bacteria 607
43 Ga0068858_101157370 3300005842 Bacteria 760
44 Ga0070717_11604300 3300006028 Bacteria 590
45 Ga0075365_10659078 3300006038 Bacteria 740
46 Ga0075367_10692615 3300006178 Bacteria 648
47 Ga0075369_10020326 3300006186 Bacteria 2719
48 Ga0075369_10216014 3300006186 Bacteria 887
49 Ga0075366_10160777 3300006195 Bacteria 1361
50 Ga0075370_10233794 3300006353 Bacteria 1088
51 Ga0068871_100286993 3300006358 Bacteria 1441
52 Ga0068865_100042631 3300006881 Bacteria 3095
53 Ga0097620_102532907 3300006931 Bacteria 565
54 Ga0079104_1006809 3300006946 Bacteria 4241
55 Ga0105240_10526028 3300009093 Bacteria 1312
56 Ga0105242_10148097 3300009176 Bacteria 2044
57 Ga0105248_10040919 3300009177 Bacteria 5196
58 Ga0105248_10506469 3300009177 Bacteria 1361
59 Ga0105248_10806134 3300009177 Bacteria 1060
60 Ga0105238_13000923 3300009551 Bacteria 507
61 Ga0105246_10024202 3300011119 Bacteria 3942
62 Ga0157371_10072013 3300013102 Bacteria 2447
63 Ga0157374_12914029 3300013296 Bacteria 506
64 Ga0157378_10824652 3300013297 Bacteria 955
65 Ga0163162_10116662 3300013306 Bacteria 2771
66 Ga0163162_12087849 3300013306 Bacteria 650
67 Ga0157372_11205668 3300013307 Bacteria 874
68 Ga0157375_10077586 3300013308 Bacteria 3353
69 Ga0157375_10382308 3300013308 Bacteria 1574
70 Ga0157375_11464092 3300013308 Bacteria 805
71 Ga0163163_10040546 3300014325 Bacteria 4547
72 Ga0163163_11420028 3300014325 Bacteria 756
73 Ga0157377_10464344 3300014745 Bacteria 877
74 Ga0157377_11376284 3300014745 Bacteria 555
75 Ga0157379_10538824 3300014968 Bacteria 1085
76 Ga0163161_11026652 3300017792 Bacteria 705
77 Ga0163161_11053930 3300017792 Bacteria 697
78 Ga0213876_10133439 3300021384 Bacteria 1320
79 Ga0209026_1011694 3300025250 Bacteria 1563
80 Ga0209673_1050964 3300025273 Bacteria 1096
81 Ga0209676_1000099 3300025292 Bacteria 230048
82 Ga0209676_1000150 3300025292 Bacteria 167474
83 Ga0209564_1001613 3300025295 Bacteria 21895
84 Ga0209758_1001753 3300025297 Bacteria 24107
85 Ga0209050_1000249 3300025298 Bacteria 116136
86 Ga0209050_1001509 3300025298 Bacteria 24592
87 Ga0209051_1003855 3300025303 Bacteria 9590
88 Ga0209257_1000203 3300025304 Bacteria 146148
89 Ga0209257_1001466 3300025304 Bacteria 27822
90 Ga0209257_1004337 3300025304 Bacteria 11087
91 Ga0207680_10356999 3300025903 Bacteria 1027
92 Ga0207647_10070444 3300025904 Bacteria 2112
93 Ga0207647_10352676 3300025904 Bacteria 833
94 Ga0207643_10028166 3300025908 Bacteria 3119
95 Ga0207705_10279062 3300025909 Bacteria 1279
96 Ga0207695_10913845 3300025913 Bacteria 757
97 Ga0207657_10078742 3300025919 Bacteria 2774
98 Ga0207657_11416026 3300025919 Bacteria 522
99 Ga0207649_10446356 3300025920 Bacteria 975
100 Ga0207652_11155779 3300025921 Bacteria 675
101 Ga0207681_10148269 3300025923 Bacteria 1755
102 Ga0207694_10827988 3300025924 Bacteria 782
103 Ga0207650_10097514 3300025925 Bacteria 2257
104 Ga0207650_10447884 3300025925 Bacteria 1074
105 Ga0207644_10101968 3300025931 Bacteria 2158
106 Ga0207644_10176177 3300025931 Bacteria 1673
107 Ga0207690_10012989 3300025932 Bacteria 4993
108 Ga0207706_10362879 3300025933 Bacteria 1258
109 Ga0207686_10027148 3300025934 Bacteria 3350
110 Ga0207704_10001415 3300025938 Bacteria 10726
111 Ga0207711_10691778 3300025941 Bacteria 951
112 Ga0207661_10316256 3300025944 Bacteria 1403
113 Ga0207679_10211729 3300025945 Bacteria 1626
114 Ga0207667_11604146 3300025949 Bacteria 619
115 Ga0207712_11794015 3300025961 Bacteria 550
116 Ga0207668_10003586 3300025972 Bacteria 9121
117 Ga0207658_11313613 3300025986 Bacteria 661
118 Ga0207677_11134030 3300026023 Bacteria 714
119 Ga0207703_11024977 3300026035 Bacteria 792
120 Ga0207678_10626445 3300026067 Bacteria 944
121 Ga0207641_10017108 3300026088 Bacteria 5932
122 Ga0207641_10201027 3300026088 Bacteria 1837
123 Ga0207641_10635179 3300026088 Bacteria 1048
124 Ga0207676_10007835 3300026095 Bacteria 7595
125 Ga0207674_10000082 3300026116 Bacteria 101650
126 Ga0207683_10236092 3300026121 Bacteria 1668
127 Ga0207698_10700812 3300026142 Bacteria 1007
128 Ga0209281_1029076 3300027111 Bacteria 1000
129 Ga0268266_10136589 3300028379 Bacteria 2197
130 Ga0268265_10172128 3300028380 Bacteria 1852
131 Ga0268265_10240551 3300028380 Bacteria 1597
132 Ga0265326_10065964 3300028558 Bacteria 1023
133 Ga0265334_10011806 3300028573 Bacteria 3671
134 Ga0307515_10192568 3300028794 Bacteria 1943
135 Ga0265338_10069471 3300028800 Bacteria 3026
136 Ga0265338_10079624 3300028800 Bacteria 2756
137 Ga0265338_10265449 3300028800 Bacteria 1260
138 Ga0265327_10053836 3300031251 Bacteria 2086
139 Ga0265314_10231567 3300031711 Bacteria 1071
140 Ga0307406_10170079 3300031901 Bacteria 1576
141 Ga0307412_10068702 3300031911 Bacteria 2410
142 Ga0373936_0008405 3300035113 Bacteria 3886
143 Ga0373946_0186275 3300035171 Bacteria 987
144 Ga0373927_0000735 3300035695 Bacteria 24989
145 Ga0373927_0018228 3300035695 Bacteria 4614
146 Ga0373925_0000160 3300037068 Bacteria 72172
147 Ga0373925_0026161 3300037068 Bacteria 4268
148 Ga0395899_0915939 3300037312 Bacteria 534
149 Ga0395900_0200710 3300037418 Bacteria 2018
150 Ga0395905_0002477 3300037471 Bacteria 20432
151 Ga0436364_0138670 3300037853 Bacteria 601
152 Ga0395901_0021774 3300038443 Bacteria 6569
153 Ga0436365_0761047 3300039437 Bacteria 5873
154 Ga0439441_044292 3300042001 Bacteria 900
155 Ga0450890_087138 3300042127 Bacteria 515
156 Ga0495590_0004604 3300046457 Bacteria 5541
157 Ga0495638_0005198 3300046460 Bacteria 9729
158 Ga0495638_0006686 3300046460 Bacteria 8355
159 Ga0495638_0076762 3300046460 Bacteria 2035
160 Ga0495650_0000069 3300046471 Bacteria 261124
161 Ga0495650_0292669 3300046471 Bacteria 546
162 Ga0495606_0393319 3300046507 Bacteria 724
163 Ga0495610_0001211 3300046512 Bacteria 23221
164 Ga0495610_0003215 3300046512 Bacteria 12928
165 Ga0495620_0072570 3300046515 Bacteria 1405
166 Ga0495631_0000827 3300046518 Bacteria 19791
167 Ga0495637_0027620 3300046520 Bacteria 2537
168 Ga0495648_0168837 3300046524 Bacteria 1123
169 Ga0495654_0000024 3300046530 Bacteria 238195
170 Ga0495597_0268323 3300046542 Bacteria 667
171 Ga0495645_0783093 3300046543 Bacteria 573
172 Ga0495668_0000031 3300046616 Bacteria 256576
173 Ga0495668_0155559 3300046616 Bacteria 1252
174 Ga0495611_0304322 3300046648 Bacteria 735
175 Ga0495625_0004432 3300046660 Bacteria 13281
176 Ga0495625_0015845 3300046660 Bacteria 5950
177 Ga0495625_0087062 3300046660 Bacteria 2166
178 Ga0495671_0105229 3300046692 Bacteria 1378
179 Ga0495660_0050012 3300046810 Bacteria 2279
180 Ga0495672_0002995 3300047320 Bacteria 14857
181 Ga0495673_0001615 3300047469 Bacteria 17467
182 Ga0495681_0052613 3300047470 Bacteria 1909
183 Ga0495686_0001958 3300047472 Bacteria 20461
184 Ga0495686_0005770 3300047472 Bacteria 9672
185 Ga0496100_0270159 3300048903 Bacteria 1264
186 Ga0496102_0914325 3300048905 Bacteria 799
187 Ga0496104_0783659 3300048907 Bacteria 860
188 Ga0496106_1015317 3300048909 Bacteria 652
189 Ga0496108_0256920 3300048911 Bacteria 1520
190 Ga0496109_0050290 3300048912 Bacteria 3796
191 Ga0496111_0209252 3300048914 Bacteria 1449
192 Ga0496112_0282651 3300048915 Bacteria 1606
193 Ga0496113_0356880 3300048916 Bacteria 1173
194 Ga0496113_1518311 3300048916 Bacteria 517
195 Ga0496115_0942056 3300048918 Bacteria 663
196 Ga0496123_0368159 3300048926 Bacteria 663
197 Ga0496124_0369319 3300048927 Bacteria 1008
198 Ga0496125_0016301 3300048928 Bacteria 7141
199 Ga0496125_0186929 3300048928 Bacteria 1373
200 Ga0496126_0006322 3300048929 Bacteria 13223
201 Ga0496126_0472365 3300048929 Bacteria 1006
202 Ga0495678_001041 3300049459 Bacteria 23510
203 Ga0501034_0011712 3300049571 Bacteria 9072
204 Ga0501034_0055953 3300049571 Bacteria 3970
205 Ga0501037_0095694 3300049573 Bacteria 2146
206 Ga0501038_0227942 3300049574 Bacteria 1484
207 Ga0501043_0405044 3300049579 Bacteria 1030
208 Ga0501047_0135567 3300049581 Bacteria 2342
209 Ga0501068_0750349 3300049584 Bacteria 639
210 Ga0501073_0279964 3300049589 Bacteria 1151
211 Ga0501238_001934 3300049671 Bacteria 2425
212 Ga0501035_0046254 3300049822 Bacteria 3914
213 Ga0501044_0002366 3300049823 Bacteria 21482
214 Ga0501044_0082818 3300049823 Bacteria 3245
215 Ga0501044_1170580 3300049823 Bacteria 637
216 nmdc:mga03n38_472906_c1 3300050490 Bacteria 700
217 nmdc:mga0k408_158730_c1 3300050493 Bacteria 1347
218 nmdc:mga06z11_301217_c1 3300050494 Bacteria 953
219 nmdc:mga0sz30_15486_c1 3300050516 Bacteria 3014
220 nmdc:mga0sz30_422335_c1 3300050516 Bacteria 598
221 Ga0500641_0116945 3300053096 Bacteria 1148
222 Ga0500641_0286779 3300053096 Bacteria 680
223 Ga0500555_034694 3300053103 Bacteria 1420
224 Ga0500556_0001003 3300053104 Bacteria 14903
225 Ga0500562_000770 3300053108 Bacteria 7798
226 Ga0500594_0000456 3300053118 Bacteria 9009
227 Ga0500594_0298600 3300053118 Bacteria 540
228 Ga0500655_014144 3300053133 Bacteria 1459
229 Ga0500559_0123472 3300053136 Bacteria 1205
230 Ga0500577_0364730 3300053142 Bacteria 632
231 Ga0500616_0167006 3300053153 Bacteria 1003
232 Ga0500622_0001059 3300053156 Bacteria 22916
233 Ga0500622_0115728 3300053156 Bacteria 1305
234 Ga0500627_0052524 3300053158 Bacteria 1779
235 Ga0500627_0369123 3300053158 Bacteria 616
236 Ga0500645_013024 3300053730 Bacteria 2677
237 Ga0500645_086891 3300053730 Bacteria 889
238 Ga0501082_0039312 3300060353 Bacteria 4081
239 2643749338 2643221545 Bacteria 5083237
240 2644352466 2643221663 Bacteria 3425771
241 2644508888 2643221691 Bacteria 5093099
242 2932405365 2932401849 Bacteria 4262978
243 Ga0500643_008440
244 JGI24739J22299_10193557
245 JGI24737J22298_10009433
246 rootH1_10072533
247 Ga0055536_1001505
248 Ga0055536_1002538
249 Ga0055530_10003215
250 Ga0055530_10015673
251 Ga0055531_10000786
252 Ga0055531_10002024
253 Ga0065165_1000749
254 Ga0065165_1046557
255 Ga0065712_10792173
256 Ga0070658_10089483
257 Ga0070683_100863370
258 Ga0070690_101287659
259 Ga0070670_100062023
260 Ga0070670_100124536
261 Ga0068868_100642691
262 Ga0070660_101690618
263 Ga0070661_100334703
264 Ga0070668_100024435
265 Ga0070671_100212265
266 Ga0070671_100386975
267 Ga0070671_101069399
268 Ga0070673_100514747
269 Ga0070659_100012307
270 Ga0070663_100373446
271 Ga0070678_100064343
272 Ga0070662_100103196
273 Ga0068867_101663857
274 Ga0070684_101101703
275 Ga0068853_100587871
276 Ga0070686_100000526
277 Ga0070665_101383810
278 Ga0070664_100169176
279 Ga0068857_100091196
280 Ga0068859_102532319
281 Ga0068864_100010466
282 Ga0068863_100118673
283 Ga0068863_100135812
284 Ga0068863_101890281
285 Ga0068858_101157370
286 Ga0070717_11604300
287 Ga0075365_10659078
288 Ga0075367_10692615
289 Ga0075369_10020326
290 Ga0075369_10216014
291 Ga0075366_10160777
292 Ga0075370_10233794
293 Ga0068871_100286993
294 Ga0068865_100042631
295 Ga0097620_102532907
296 Ga0079104_1006809
297 Ga0105240_10526028
298 Ga0105242_10148097
299 Ga0105248_10040919
300 Ga0105248_10506469
301 Ga0105248_10806134
302 Ga0105238_13000923
303 Ga0105246_10024202
304 Ga0157371_10072013
305 Ga0157374_12914029
306 Ga0157378_10824652
307 Ga0163162_10116662
308 Ga0163162_12087849
309 Ga0157372_11205668
310 Ga0157375_10077586
311 Ga0157375_10382308
312 Ga0157375_11464092
313 Ga0163163_10040546
314 Ga0163163_11420028
315 Ga0157377_10464344
316 Ga0157377_11376284
317 Ga0157379_10538824
318 Ga0163161_11026652
319 Ga0163161_11053930
320 Ga0213876_10133439
321 Ga0209026_1011694
322 Ga0209673_1050964
323 Ga0209676_1000099
324 Ga0209676_1000150
325 Ga0209564_1001613
326 Ga0209758_1001753
327 Ga0209050_1000249
328 Ga0209050_1001509
329 Ga0209051_1003855
330 Ga0209257_1000203
331 Ga0209257_1001466
332 Ga0209257_1004337
333 Ga0207680_10356999
334 Ga0207647_10070444
335 Ga0207647_10352676
336 Ga0207643_10028166
337 Ga0207705_10279062
338 Ga0207695_10913845
339 Ga0207657_10078742
340 Ga0207657_11416026
341 Ga0207649_10446356
342 Ga0207652_11155779
343 Ga0207681_10148269
344 Ga0207694_10827988
345 Ga0207650_10097514
346 Ga0207650_10447884
347 Ga0207644_10101968
348 Ga0207644_10176177
349 Ga0207690_10012989
350 Ga0207706_10362879
351 Ga0207686_10027148
352 Ga0207704_10001415
353 Ga0207711_10691778
354 Ga0207661_10316256
355 Ga0207679_10211729
356 Ga0207667_11604146
357 Ga0207712_11794015
358 Ga0207668_10003586
359 Ga0207658_11313613
360 Ga0207677_11134030
361 Ga0207703_11024977
362 Ga0207678_10626445
363 Ga0207641_10017108
364 Ga0207641_10201027
365 Ga0207641_10635179
366 Ga0207676_10007835
367 Ga0207674_10000082
368 Ga0207683_10236092
369 Ga0207698_10700812
370 Ga0209281_1029076
371 Ga0268266_10136589
372 Ga0268265_10172128
373 Ga0268265_10240551
374 Ga0265326_10065964
375 Ga0265334_10011806
376 Ga0307515_10192568
377 Ga0265338_10069471
378 Ga0265338_10079624
379 Ga0265338_10265449
380 Ga0265327_10053836
381 Ga0265314_10231567
382 Ga0307406_10170079
383 Ga0307412_10068702
384 Ga0373936_0008405
385 Ga0373946_0186275
386 Ga0373927_0000735
387 Ga0373927_0018228
388 Ga0373925_0000160
389 Ga0373925_0026161
390 Ga0395899_0915939
391 Ga0395900_0200710
392 Ga0395905_0002477
393 Ga0436364_0138670
394 Ga0395901_0021774
395 Ga0436365_0761047
396 Ga0439441_044292
397 Ga0450890_087138
398 Ga0495590_0004604
399 Ga0495638_0005198
400 Ga0495638_0006686
401 Ga0495638_0076762
402 Ga0495650_0000069
403 Ga0495650_0292669
404 Ga0495606_0393319
405 Ga0495610_0001211
406 Ga0495610_0003215
407 Ga0495620_0072570
408 Ga0495631_0000827
409 Ga0495637_0027620
410 Ga0495648_0168837
411 Ga0495654_0000024
412 Ga0495597_0268323
413 Ga0495645_0783093
414 Ga0495668_0000031
415 Ga0495668_0155559
416 Ga0495611_0304322
417 Ga0495625_0004432
418 Ga0495625_0015845
419 Ga0495625_0087062
420 Ga0495671_0105229
421 Ga0495660_0050012
422 Ga0495672_0002995
423 Ga0495673_0001615
424 Ga0495681_0052613
425 Ga0495686_0001958
426 Ga0495686_0005770
427 Ga0496100_0270159
428 Ga0496102_0914325
429 Ga0496104_0783659
430 Ga0496106_1015317
431 Ga0496108_0256920
432 Ga0496109_0050290
433 Ga0496111_0209252
434 Ga0496112_0282651
435 Ga0496113_0356880
436 Ga0496113_1518311
437 Ga0496115_0942056
438 Ga0496123_0368159
439 Ga0496124_0369319
440 Ga0496125_0016301
441 Ga0496125_0186929
442 Ga0496126_0006322
443 Ga0496126_0472365
444 Ga0495678_001041
445 Ga0501034_0011712
446 Ga0501034_0055953
447 Ga0501037_0095694
448 Ga0501038_0227942
449 Ga0501043_0405044
450 Ga0501047_0135567
451 Ga0501068_0750349
452 Ga0501073_0279964
453 Ga0501238_001934
454 Ga0501035_0046254
455 Ga0501044_0002366
456 Ga0501044_0082818
457 Ga0501044_1170580
458 nmdc:mga03n38_472906_c1
459 nmdc:mga0k408_158730_c1
460 nmdc:mga06z11_301217_c1
461 nmdc:mga0sz30_15486_c1
462 nmdc:mga0sz30_422335_c1
463 Ga0500641_0116945
464 Ga0500641_0286779
465 Ga0500555_034694
466 Ga0500556_0001003
467 Ga0500562_000770
468 Ga0500594_0000456
469 Ga0500594_0298600
470 Ga0500655_014144
471 Ga0500559_0123472
472 Ga0500577_0364730
473 Ga0500616_0167006
474 Ga0500622_0001059
475 Ga0500622_0115728
476 Ga0500627_0052524
477 Ga0500627_0369123
478 Ga0500645_013024
479 Ga0500645_086891
480 Ga0501082_0039312
481 2643749338
482 2644352466
483 2644508888
484 2932405365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

23

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.932 1 114
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9168 1 114
2r63-assembly1.cif.gz_A structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures 0.3964 13 107
2r63-assembly1.cif.gz_A structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures 0.3902 13 107
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.3749 28 114
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9398 4 114 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8857 4 114 1.10.8.290
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.796 8 114 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7924 8 114 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7651 8 114 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A1W6VMU7-F1-model_v4 deleted 1.006 32 115
AF-A0A4R9K0F8-F1-model_v4 DUF2200 family protein 1.004 2 115
AF-A0A7Y7HHU7-F1-model_v4 deleted 1.003 3 115
AF-S0K083-F1-model_v4 DUF2200 domain-containing protein 1.002 4 115
AF-A0A6B3C8S0-F1-model_v4 DUF2200 domain-containing protein 1.002 2 104

Map