F355235

General Info

Members Datasets Scaffolds Average Seq Length
243 147 487 1073

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10000944|JGI25153J46596_100009443
Length 1187
Sequence MQDNLNKEFKPTSWAIDNKVSIYVATIIIAFAGILSYISLPKEQFPEVVFPQFYINTLYPGTAPEDMETLVTKPIEKQLGGISGVKEIKSTSLQDYSIITIEFNTDVDIETARQEVREKVDEAKADLPSDLTVNGKEPQIIKIDVSQIPIMNVNLSGDFDLQSLKKYADEMQDRIEALTEITRVDIVGALDREIQINVDKYKMDAARISFDDIINAVGAENRTISGGLVSMDGQKRTLSVKGEYKDASKIGNIVVRGMSGAVVYLRDVAXVVDGFKEQESYARLNGKNVITLNVIKQSGKNLIDASDKIRGIIADMQKSYLPXGLKVDITADQSKSTRVTLHDLINTIIIGFVLVTIILMFFMGAVNAIFVALSVPISMFIAFLILPMFDFTLNMMVLFSFLLALGIVVDDAIVVIENVHRIFHERHDLGIVKAAKIAAGEVFLPVLSGTLTVLAPFVPLLFWPGVIGSFMFFLPVTLIVTLGASLVVAYIINPVFAVDFMDRHEGEEHPKPKFDKKFKILSAVFAVIALIAYANSFGVGNFVVFMYLLIVLERFWLGGVARRFQQHTWPRVQEWYHRRLEWCLKGWRPIGILLATFGLLIFSIILTGMRNPKVVFFPQADPNFIYAYLELPNGTDQKYTDSITHIVEQRITKTVGANNPIVESIISNVAVGAGDPSQMDQSVQPQKGKVTVAFVEFGARKGQSTKDYLGKIRDAVKGIPGADITVEQEQGGPPTGKPVNIEISGDDFNELTLTSMRLKRYLDSLQIGGVEELKSDFESNKPEILVNIDRERANKEGISTGVIGMALRNALYGAEASKFRDPEDDYQIMVRFREDQRNNINTLMNLNITYRDMNMGGAIRQVPLSAVANITYSNTYASVKRIDQKRVVTLYSNVLTGFNTNEVVQKVQSAINQFSKPDSVIVKMTGEQEDQQETMNFLVMAMLGAVGLMFMIMVTQFNSVGRPLVIAMEIVFSIIGVFLGFSVFGMDISIVMXXXGXMALAGVVVRNGIVLVEFIDLLIKQGTPVYDAVVEGGRTRMTPVLLTAIAAILGLIPLAVGLNIDFATLFSEGNPHLFFGGDNVAFWGPLAWTMVFGLIFATFLTLILVPVMYAMNKRSIDVLDHYKLPRGLKYVPFLVLLLKLFSKKETVRRLHDPHYVSNKPYAFFTEAEMAKEDKEHAHSMETNISMN

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
114 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
115 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
119 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
120 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
121 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
125 2738541284 Pedobacter sp. YR016 Isolate Unclassified
126 2738543023 Pedobacter sp. OK628 Isolate Unclassified
127 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
128 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
129 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
130 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
131 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
132 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
133 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
134 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
135 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
136 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
137 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
138 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
139 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
140 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
141 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
142 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
143 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
144 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
145 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
146 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
147 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.53
Metatranscriptomes 0
Isolates 9.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.7
Nodule 0
Rhizoplane 0
Rhizosphere 67.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000944 3300003215 Bacteria 17659
2 JGI24739J22299_10000639 3300001989 Bacteria 12605
3 JGI24735J21928_10000001 3300002067 Bacteria 650042
4 JGI25162J39368_1000012 3300002737 Bacteria 373191
5 JGI25162J39368_1001638 3300002737 Bacteria 11156
6 JGI25154J39366_1000003 3300002738 Bacteria 397627
7 rootH1_10037097 3300003316 Bacteria 5919
8 rootH1_10037640 3300003316 Bacteria 23355
9 rootH1_10042150 3300003316 Bacteria 4226
10 rootH1_10046461 3300003316 Bacteria 7693
11 rootH2_10005719 3300003320 Bacteria 108734
12 rootH2_10095792 3300003320 Bacteria 19085
13 rootL2_10059915 3300003322 Bacteria 10520
14 rootL2_10064221 3300003322 Bacteria 11580
15 rootH1_10000935 3300003316 Bacteria 20388
16 rootH1_10000935 3300003323 Bacteria 13271
17 rootH1_10012862 3300003323 Bacteria 52977
18 Ga0055535_1000989 3300003761 Bacteria 18372
19 Ga0055528_1000435 3300003790 Bacteria 33496
20 Ga0055530_10001968 3300003791 Bacteria 13984
21 Ga0055531_10000015 3300003794 Bacteria 182104
22 Ga0055531_10000478 3300003794 Bacteria 37002
23 Ga0065165_1000358 3300005262 Bacteria 75013
24 Ga0065165_1002056 3300005262 Bacteria 18603
25 Ga0065704_10000226 3300005289 Bacteria 67111
26 Ga0065704_10075371 3300005289 Bacteria 5626
27 Ga0065704_10077078 3300005289 Bacteria 4862
28 Ga0065715_10001010 3300005293 Bacteria 9635
29 Ga0070658_10002941 3300005327 Bacteria 14122
30 Ga0068868_100004737 3300005338 Bacteria 9554
31 Ga0070659_100000743 3300005366 Bacteria 23664
32 Ga0070662_100000032 3300005457 Bacteria 78824
33 Ga0070681_10004715 3300005458 Bacteria 13051
34 Ga0068867_100000449 3300005459 Bacteria 27332
35 Ga0070679_100002121 3300005530 Bacteria 17871
36 Ga0070665_100000003 3300005548 Bacteria 811857
37 Ga0068855_100000508 3300005563 Bacteria 48055
38 Ga0068852_100000638 3300005616 Bacteria 22897
39 Ga0068851_10000066 3300005834 Bacteria 58581
40 Ga0075366_10000500 3300006195 Bacteria 18172
41 Ga0075366_10001107 3300006195 Bacteria 13252
42 Ga0097621_100001344 3300006237 Bacteria 16907
43 Ga0068871_100000018 3300006358 Bacteria 89690
44 Ga0075428_100029179 3300006844 Bacteria 6104
45 Ga0068865_100000147 3300006881 Bacteria 37863
46 Ga0105240_10000757 3300009093 Bacteria 58956
47 Ga0105240_10005954 3300009093 Bacteria 18040
48 Ga0105240_10027973 3300009093 Bacteria 7373
49 Ga0111539_10005368 3300009094 Bacteria 16572
50 Ga0111539_10037083 3300009094 Bacteria 5890
51 Ga0105242_10019561 3300009176 Bacteria 5307
52 Ga0105237_10001604 3300009545 Bacteria 29361
53 Ga0105237_10004576 3300009545 Bacteria 15968
54 Ga0105237_10005108 3300009545 Bacteria 14890
55 Ga0105238_10018806 3300009551 Bacteria 7033
56 Ga0105239_10000005 3300010375 Bacteria 496066
57 Ga0105239_10000010 3300010375 Bacteria 341545
58 Ga0105239_10000117 3300010375 Bacteria 112291
59 Ga0105239_10002040 3300010375 Bacteria 26200
60 Ga0157373_10000075 3300013100 Bacteria 85818
61 Ga0157371_10001207 3300013102 Bacteria 27564
62 Ga0157371_10002808 3300013102 Bacteria 16328
63 Ga0157370_10027263 3300013104 Bacteria 5633
64 Ga0157370_10041888 3300013104 Bacteria 4415
65 Ga0157374_10000348 3300013296 Bacteria 42744
66 Ga0157374_10001067 3300013296 Bacteria 23793
67 Ga0163162_10000031 3300013306 Bacteria 157666
68 Ga0163162_10002966 3300013306 Bacteria 16195
69 Ga0157372_10000118 3300013307 Bacteria 84096
70 Ga0157372_10001588 3300013307 Bacteria 24735
71 Ga0157375_10007127 3300013308 Bacteria 9768
72 Ga0157380_10000719 3300014326 Bacteria 20659
73 Ga0182006_1002029 3300015261 Bacteria 11368
74 Ga0182005_1000294 3300015265 Bacteria 31099
75 Ga0209436_100880 3300025208 Bacteria 11980
76 Ga0209436_101082 3300025208 Bacteria 10227
77 Ga0207427_100085 3300025231 Bacteria 142561
78 Ga0209437_100041 3300025233 Bacteria 444465
79 Ga0209437_100052 3300025233 Bacteria 380548
80 Ga0209258_100032 3300025242 Bacteria 452764
81 Ga0209646_1000004 3300025246 Bacteria 786587
82 Ga0209026_1000258 3300025250 Bacteria 65976
83 Ga0209026_1000349 3300025250 Bacteria 43977
84 Ga0209148_1000186 3300025254 Bacteria 117677
85 Ga0209233_1000067 3300025261 Bacteria 380554
86 Ga0209233_1002585 3300025261 Bacteria 6581
87 Ga0209673_1000042 3300025273 Bacteria 300704
88 Ga0209564_1011990 3300025295 Bacteria 3822
89 Ga0209050_1000295 3300025298 Bacteria 104889
90 Ga0209050_1002015 3300025298 Bacteria 18935
91 Ga0207426_1000033 3300025302 Bacteria 455976
92 Ga0207426_1000442 3300025302 Bacteria 66642
93 Ga0207426_1003701 3300025302 Bacteria 8011
94 Ga0209257_1000005 3300025304 Bacteria 1592528
95 Ga0209257_1000233 3300025304 Bacteria 129948
96 Ga0209257_1005100 3300025304 Bacteria 9525
97 Ga0207656_10000554 3300025321 Bacteria 12378
98 Ga0207647_10000042 3300025904 Bacteria 91917
99 Ga0207647_10000543 3300025904 Bacteria 30114
100 Ga0207645_10003042 3300025907 Bacteria 12907
101 Ga0207705_10000040 3300025909 Bacteria 185735
102 Ga0207707_10032184 3300025912 Bacteria 4591
103 Ga0207695_10000058 3300025913 Bacteria 366582
104 Ga0207695_10018297 3300025913 Bacteria 8105
105 Ga0207671_10002208 3300025914 Bacteria 21121
106 Ga0207671_10007087 3300025914 Bacteria 9803
107 Ga0207671_10012092 3300025914 Bacteria 6969
108 Ga0207694_10018841 3300025924 Bacteria 5217
109 Ga0207690_10000424 3300025932 Bacteria 27614
110 Ga0207706_10000058 3300025933 Bacteria 112367
111 Ga0207704_10000081 3300025938 Bacteria 57180
112 Ga0207667_10001659 3300025949 Bacteria 28049
113 Ga0207641_10000850 3300026088 Bacteria 32370
114 Ga0207648_10000175 3300026089 Bacteria 66839
115 Ga0268266_10000018 3300028379 Bacteria 569141
116 Ga0307515_10000007 3300028794 Bacteria 719669
117 Ga0307515_10000311 3300028794 Bacteria 120044
118 Ga0307515_10003174 3300028794 Bacteria 34781
119 Ga0307515_10055013 3300028794 Bacteria 5827
120 Ga0265338_10030465 3300028800 Bacteria 5315
121 Ga0265327_10000743 3300031251 Bacteria 50644
122 Ga0265327_10006813 3300031251 Bacteria 9007
123 Ga0265327_10010387 3300031251 Bacteria 6556
124 Ga0265314_10010977 3300031711 Bacteria 7516
125 Ga0307405_10017717 3300031731 Bacteria 3916
126 Ga0307412_10000001 3300031911 Bacteria 822691
127 Ga0307416_100002199 3300032002 Bacteria 11083
128 Ga0307414_10000074 3300032004 Bacteria 94049
129 Ga0307415_100003862 3300032126 Bacteria 7689
130 Ga0307507_10000217 3300033179 Bacteria 109884
131 Ga0307510_10001707 3300033180 Bacteria 24396
132 Ga0395899_0000001 3300037312 Bacteria 1750322
133 Ga0395899_0000037 3300037312 Bacteria 280224
134 Ga0395899_0001818 3300037312 Bacteria 17665
135 Ga0395899_0013060 3300037312 Bacteria 6353
136 Ga0395900_0000501 3300037418 Bacteria 55054
137 Ga0395900_0008738 3300037418 Bacteria 10404
138 Ga0395900_0010255 3300037418 Bacteria 9582
139 Ga0395905_0002241 3300037471 Bacteria 21758
140 Ga0395905_0003805 3300037471 Bacteria 15958
141 Ga0395905_0004862 3300037471 Bacteria 13848
142 Ga0395901_0000857 3300038443 Bacteria 33486
143 Ga0395901_0003246 3300038443 Bacteria 16363
144 Ga0436361_0233487 3300039447 Bacteria 8484
145 Ga0451577_0000037 3300042876 Bacteria 360162
146 Ga0451577_0000299 3300042876 Bacteria 96341
147 Ga0451577_0001296 3300042876 Bacteria 34405
148 Ga0451577_0006107 3300042876 Bacteria 12102
149 Ga0451577_0013469 3300042876 Bacteria 7650
150 Ga0453683_0000021 3300044673 Bacteria 284502
151 Ga0453683_0000085 3300044673 Bacteria 140003
152 Ga0453683_0000587 3300044673 Bacteria 40366
153 Ga0453683_0000885 3300044673 Bacteria 28764
154 Ga0453683_0007614 3300044673 Bacteria 7334
155 Ga0453683_0030507 3300044673 Bacteria 3407
156 Ga0453684_0000110 3300044712 Bacteria 360542
157 Ga0453684_0000616 3300044712 Bacteria 130153
158 Ga0453684_0000766 3300044712 Bacteria 111429
159 Ga0453684_0000911 3300044712 Bacteria 98351
160 Ga0453684_0000935 3300044712 Bacteria 96528
161 Ga0453684_0002074 3300044712 Bacteria 50909
162 Ga0453684_0006570 3300044712 Bacteria 22006
163 Ga0453684_0007214 3300044712 Bacteria 20610
164 Ga0453684_0007730 3300044712 Bacteria 19633
165 Ga0453684_0023854 3300044712 Bacteria 8978
166 Ga0453684_0030884 3300044712 Bacteria 7552
167 Ga0453684_0049470 3300044712 Bacteria 5543
168 Ga0453684_0051954 3300044712 Bacteria 5365
169 Ga0453684_0062042 3300044712 Bacteria 4792
170 Ga0453684_0070766 3300044712 Bacteria 4415
171 Ga0451576_0000003 3300045051 Bacteria 1550573
172 Ga0451576_0000039 3300045051 Bacteria 360162
173 Ga0451576_0000264 3300045051 Bacteria 128283
174 Ga0451576_0000279 3300045051 Bacteria 125074
175 Ga0451576_0000378 3300045051 Bacteria 104355
176 Ga0451576_0000433 3300045051 Bacteria 96361
177 Ga0451576_0001907 3300045051 Bacteria 33418
178 Ga0451576_0003378 3300045051 Bacteria 22054
179 Ga0451576_0004462 3300045051 Bacteria 18142
180 Ga0451576_0020384 3300045051 Bacteria 7222
181 Ga0495627_001289 3300046453 Bacteria 15384
182 Ga0495638_0000006 3300046460 Bacteria 668846
183 Ga0495650_0000013 3300046471 Bacteria 611135
184 Ga0495585_0001310 3300046492 Bacteria 19822
185 Ga0495585_0003092 3300046492 Bacteria 11440
186 Ga0495583_0015026 3300046506 Bacteria 4234
187 Ga0495606_0000010 3300046507 Bacteria 299893
188 Ga0495606_0012808 3300046507 Bacteria 6683
189 Ga0495606_0016020 3300046507 Bacteria 5741
190 Ga0495610_0006519 3300046512 Bacteria 8008
191 Ga0495648_0004562 3300046524 Bacteria 11802
192 Ga0495633_0000056 3300046558 Bacteria 149334
193 Ga0495633_0002101 3300046558 Bacteria 14319
194 Ga0495633_0008072 3300046558 Bacteria 5981
195 Ga0495668_0000003 3300046616 Bacteria 695023
196 Ga0495625_0000100 3300046660 Bacteria 139983
197 Ga0495625_0001414 3300046660 Bacteria 29350
198 Ga0495625_0003127 3300046660 Bacteria 16910
199 Ga0495661_0003116 3300046665 Bacteria 12428
200 Ga0495649_0000002 3300046694 Bacteria 1093458
201 Ga0495687_000875 3300047443 Bacteria 31919
202 Ga0495686_0000106 3300047472 Bacteria 175852
203 Ga0495686_0004860 3300047472 Bacteria 10842
204 Ga0496121_0000395 3300048924 Bacteria 88604
205 Ga0501257_000510 3300049686 Bacteria 7713
206 Ga0501241_000643 3300049758 Bacteria 7487
207 Ga0501264_000047 3300049761 Bacteria 17062
208 nmdc:mga0k408_1159_c2 3300050493 Bacteria 10430
209 nmdc:mga0k408_7038_c1 3300050493 Bacteria 6004
210 nmdc:mga08y16_10172_c1 3300050511 Bacteria 9876
211 nmdc:mga08y16_38606_c1 3300050511 Bacteria 5013
212 Ga0500651_0000357 3300053093 Bacteria 25575
213 Ga0500608_000415 3300053122 Bacteria 16270
214 Ga0500618_000001 3300053125 Bacteria 538477
215 Ga0500577_0000714 3300053142 Bacteria 8498
216 Ga0500616_0000065 3300053153 Bacteria 239287
217 Ga0500622_0000010 3300053156 Bacteria 398804
218 Ga0500622_0000044 3300053156 Bacteria 158778
219 Ga0500622_0000093 3300053156 Bacteria 92537
220 Ga0500622_0004717 3300053156 Bacteria 8426
221 Ga0500624_000762 3300053157 Bacteria 7749
222 2738763263 2738541284 Bacteria 5199923
223 2739301639 2738543023 Bacteria 6767879
224 2776616131 2775506987 Bacteria 5373360
225 2819577331 2818991442 Bacteria 8318214
226 2819676472 2818991460 Bacteria 7595395
227 2821140636 2821136567 Bacteria 8080116
228 2840678318 2840677318 Bacteria 2664183
229 2852627673 2852627209 Bacteria 5896285
230 2883071254 2883068021 Bacteria 6192739
231 2884796303 2884791551 Bacteria 8511252
232 2896086135 2896085136 Bacteria 6129793
233 2896115290 2896109856 Bacteria 7140722
234 2904473055 2904467357 Bacteria 8057758
235 2910250013 2910245624 Bacteria 6935613
236 2919187837 2919186247 Bacteria 6244071
237 2929178178 2929177148 Bacteria 7883697
238 2929240478 2929239360 Bacteria 7745570
239 2929922320 2929921140 Bacteria 8649150
240 2939664896 2939664404 Bacteria 6364494
241 2945980540 2945977869 Bacteria 7777518
242 2946013598 2946013367 Bacteria 7766675
243 2977233046 2977232053 Bacteria 5485925
244 8003156691 8003151029 Bacteria 8187759
245 JGI25153J46596_10000944
246 JGI24739J22299_10000639
247 JGI24735J21928_10000001
248 JGI25162J39368_1000012
249 JGI25162J39368_1001638
250 JGI25154J39366_1000003
251 rootH1_10037097
252 rootH1_10037640
253 rootH1_10042150
254 rootH1_10046461
255 rootH2_10005719
256 rootH2_10095792
257 rootL2_10059915
258 rootL2_10064221
259 rootH1_10000935
260 rootH1_10012862
261 Ga0055535_1000989
262 Ga0055528_1000435
263 Ga0055530_10001968
264 Ga0055531_10000015
265 Ga0055531_10000478
266 Ga0065165_1000358
267 Ga0065165_1002056
268 Ga0065704_10000226
269 Ga0065704_10075371
270 Ga0065704_10077078
271 Ga0065715_10001010
272 Ga0070658_10002941
273 Ga0068868_100004737
274 Ga0070659_100000743
275 Ga0070662_100000032
276 Ga0070681_10004715
277 Ga0068867_100000449
278 Ga0070679_100002121
279 Ga0070665_100000003
280 Ga0068855_100000508
281 Ga0068852_100000638
282 Ga0068851_10000066
283 Ga0075366_10000500
284 Ga0075366_10001107
285 Ga0097621_100001344
286 Ga0068871_100000018
287 Ga0075428_100029179
288 Ga0068865_100000147
289 Ga0105240_10000757
290 Ga0105240_10005954
291 Ga0105240_10027973
292 Ga0111539_10005368
293 Ga0111539_10037083
294 Ga0105242_10019561
295 Ga0105237_10001604
296 Ga0105237_10004576
297 Ga0105237_10005108
298 Ga0105238_10018806
299 Ga0105239_10000005
300 Ga0105239_10000010
301 Ga0105239_10000117
302 Ga0105239_10002040
303 Ga0157373_10000075
304 Ga0157371_10001207
305 Ga0157371_10002808
306 Ga0157370_10027263
307 Ga0157370_10041888
308 Ga0157374_10000348
309 Ga0157374_10001067
310 Ga0163162_10000031
311 Ga0163162_10002966
312 Ga0157372_10000118
313 Ga0157372_10001588
314 Ga0157375_10007127
315 Ga0157380_10000719
316 Ga0182006_1002029
317 Ga0182005_1000294
318 Ga0209436_100880
319 Ga0209436_101082
320 Ga0207427_100085
321 Ga0209437_100041
322 Ga0209437_100052
323 Ga0209258_100032
324 Ga0209646_1000004
325 Ga0209026_1000258
326 Ga0209026_1000349
327 Ga0209148_1000186
328 Ga0209233_1000067
329 Ga0209233_1002585
330 Ga0209673_1000042
331 Ga0209564_1011990
332 Ga0209050_1000295
333 Ga0209050_1002015
334 Ga0207426_1000033
335 Ga0207426_1000442
336 Ga0207426_1003701
337 Ga0209257_1000005
338 Ga0209257_1000233
339 Ga0209257_1005100
340 Ga0207656_10000554
341 Ga0207647_10000042
342 Ga0207647_10000543
343 Ga0207645_10003042
344 Ga0207705_10000040
345 Ga0207707_10032184
346 Ga0207695_10000058
347 Ga0207695_10018297
348 Ga0207671_10002208
349 Ga0207671_10007087
350 Ga0207671_10012092
351 Ga0207694_10018841
352 Ga0207690_10000424
353 Ga0207706_10000058
354 Ga0207704_10000081
355 Ga0207667_10001659
356 Ga0207641_10000850
357 Ga0207648_10000175
358 Ga0268266_10000018
359 Ga0307515_10000007
360 Ga0307515_10000311
361 Ga0307515_10003174
362 Ga0307515_10055013
363 Ga0265338_10030465
364 Ga0265327_10000743
365 Ga0265327_10006813
366 Ga0265327_10010387
367 Ga0265314_10010977
368 Ga0307405_10017717
369 Ga0307412_10000001
370 Ga0307416_100002199
371 Ga0307414_10000074
372 Ga0307415_100003862
373 Ga0307507_10000217
374 Ga0307510_10001707
375 Ga0395899_0000001
376 Ga0395899_0000037
377 Ga0395899_0001818
378 Ga0395899_0013060
379 Ga0395900_0000501
380 Ga0395900_0008738
381 Ga0395900_0010255
382 Ga0395905_0002241
383 Ga0395905_0003805
384 Ga0395905_0004862
385 Ga0395901_0000857
386 Ga0395901_0003246
387 Ga0436361_0233487
388 Ga0451577_0000037
389 Ga0451577_0000299
390 Ga0451577_0001296
391 Ga0451577_0006107
392 Ga0451577_0013469
393 Ga0453683_0000021
394 Ga0453683_0000085
395 Ga0453683_0000587
396 Ga0453683_0000885
397 Ga0453683_0007614
398 Ga0453683_0030507
399 Ga0453684_0000110
400 Ga0453684_0000616
401 Ga0453684_0000766
402 Ga0453684_0000911
403 Ga0453684_0000935
404 Ga0453684_0002074
405 Ga0453684_0006570
406 Ga0453684_0007214
407 Ga0453684_0007730
408 Ga0453684_0023854
409 Ga0453684_0030884
410 Ga0453684_0049470
411 Ga0453684_0051954
412 Ga0453684_0062042
413 Ga0453684_0070766
414 Ga0451576_0000003
415 Ga0451576_0000039
416 Ga0451576_0000264
417 Ga0451576_0000279
418 Ga0451576_0000378
419 Ga0451576_0000433
420 Ga0451576_0001907
421 Ga0451576_0003378
422 Ga0451576_0004462
423 Ga0451576_0020384
424 Ga0495627_001289
425 Ga0495638_0000006
426 Ga0495650_0000013
427 Ga0495585_0001310
428 Ga0495585_0003092
429 Ga0495583_0015026
430 Ga0495606_0000010
431 Ga0495606_0012808
432 Ga0495606_0016020
433 Ga0495610_0006519
434 Ga0495648_0004562
435 Ga0495633_0000056
436 Ga0495633_0002101
437 Ga0495633_0008072
438 Ga0495668_0000003
439 Ga0495625_0000100
440 Ga0495625_0001414
441 Ga0495625_0003127
442 Ga0495661_0003116
443 Ga0495649_0000002
444 Ga0495687_000875
445 Ga0495686_0000106
446 Ga0495686_0004860
447 Ga0496121_0000395
448 Ga0501257_000510
449 Ga0501241_000643
450 Ga0501264_000047
451 nmdc:mga0k408_1159_c2
452 nmdc:mga0k408_7038_c1
453 nmdc:mga08y16_10172_c1
454 nmdc:mga08y16_38606_c1
455 Ga0500651_0000357
456 Ga0500608_000415
457 Ga0500618_000001
458 Ga0500577_0000714
459 Ga0500616_0000065
460 Ga0500622_0000010
461 Ga0500622_0000044
462 Ga0500622_0000093
463 Ga0500622_0004717
464 Ga0500624_000762
465 2738763263
466 2739301639
467 2776616131
468 2819577331
469 2819676472
470 2821140636
471 2840678318
472 2852627673
473 2883071254
474 2884796303
475 2896086135
476 2896115290
477 2904473055
478 2910250013
479 2919187837
480 2929178178
481 2929240478
482 2929922320
483 2939664896
484 2945980540
485 2946013598
486 2977233046
487 8003156691

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00873

ACR_tran

AcrB/AcrD/AcrF family

11

1113

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rr7-assembly1.cif.gz_C multidrug efflux pump subunit acrb 0.8562 16 1078
4k0j-assembly2.cif.gz_E x-ray crystal structure of a heavy metal efflux pump, crystal form i 0.8535 12 1073
2v50-assembly1.cif.gz_C the missing part of the bacterial mexab-oprm system: structural determination of the multidrug exporter mexb 0.8513 12 1075
4k0e-assembly1.cif.gz_A x-ray crystal structure of a heavy metal efflux pump, crystal form ii 0.8499 12 1075
7rr8-assembly1.cif.gz_C multidrug efflux pump subunit acrb 0.8498 12 1078
ID Description Score Start End Superfamily
af_P38054_46_113_3.30.70.1430 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Multidrug efflux transporter AcrB pore domain 0.9522 54 118 3.30.70.1430
af_P37637_331_506_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9424 333 493 1.20.1640.10
af_P24177_305_504_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9416 304 493 1.20.1640.10
af_Q2FVZ5_39_104_3.30.70.1430 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Multidrug efflux transporter AcrB pore domain 0.9355 46 109 3.30.70.1430
1oyeA01 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.9205 329 494 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A2J6HG92-F1-model_v4 Copper transporter 0.9642 1 970 GO:0005886
GO:0042910
AF-A0A2J6HG92-F1-model_v4 Copper transporter 0.9593 1 970 GO:0005886
GO:0042910
AF-A0A6L4YPU5-F1-model_v4 Cation/multidrug efflux pump 0.9226 160 517 GO:0005886
GO:0042910
AF-A0A6L8EIF7-F1-model_v4 Efflux RND transporter permease subunit 0.9172 14 118 GO:0005886
GO:0042910
AF-A0A2M7NVZ3-F1-model_v4 SSD domain-containing protein 0.9109 136 930 GO:0005886
GO:0042910

Map