F355235
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 147 | 487 | 1073 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10000944|JGI25153J46596_100009443 |
| Length | 1187 |
| Sequence | MQDNLNKEFKPTSWAIDNKVSIYVATIIIAFAGILSYISLPKEQFPEVVFPQFYINTLYPGTAPEDMETLVTKPIEKQLGGISGVKEIKSTSLQDYSIITIEFNTDVDIETARQEVREKVDEAKADLPSDLTVNGKEPQIIKIDVSQIPIMNVNLSGDFDLQSLKKYADEMQDRIEALTEITRVDIVGALDREIQINVDKYKMDAARISFDDIINAVGAENRTISGGLVSMDGQKRTLSVKGEYKDASKIGNIVVRGMSGAVVYLRDVAXVVDGFKEQESYARLNGKNVITLNVIKQSGKNLIDASDKIRGIIADMQKSYLPXGLKVDITADQSKSTRVTLHDLINTIIIGFVLVTIILMFFMGAVNAIFVALSVPISMFIAFLILPMFDFTLNMMVLFSFLLALGIVVDDAIVVIENVHRIFHERHDLGIVKAAKIAAGEVFLPVLSGTLTVLAPFVPLLFWPGVIGSFMFFLPVTLIVTLGASLVVAYIINPVFAVDFMDRHEGEEHPKPKFDKKFKILSAVFAVIALIAYANSFGVGNFVVFMYLLIVLERFWLGGVARRFQQHTWPRVQEWYHRRLEWCLKGWRPIGILLATFGLLIFSIILTGMRNPKVVFFPQADPNFIYAYLELPNGTDQKYTDSITHIVEQRITKTVGANNPIVESIISNVAVGAGDPSQMDQSVQPQKGKVTVAFVEFGARKGQSTKDYLGKIRDAVKGIPGADITVEQEQGGPPTGKPVNIEISGDDFNELTLTSMRLKRYLDSLQIGGVEELKSDFESNKPEILVNIDRERANKEGISTGVIGMALRNALYGAEASKFRDPEDDYQIMVRFREDQRNNINTLMNLNITYRDMNMGGAIRQVPLSAVANITYSNTYASVKRIDQKRVVTLYSNVLTGFNTNEVVQKVQSAINQFSKPDSVIVKMTGEQEDQQETMNFLVMAMLGAVGLMFMIMVTQFNSVGRPLVIAMEIVFSIIGVFLGFSVFGMDISIVMXXXGXMALAGVVVRNGIVLVEFIDLLIKQGTPVYDAVVEGGRTRMTPVLLTAIAAILGLIPLAVGLNIDFATLFSEGNPHLFFGGDNVAFWGPLAWTMVFGLIFATFLTLILVPVMYAMNKRSIDVLDHYKLPRGLKYVPFLVLLLKLFSKKETVRRLHDPHYVSNKPYAFFTEAEMAKEDKEHAHSMETNISMN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 78 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 83 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 84 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 85 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 86 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 93 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 94 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 95 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 96 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 97 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 113 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 114 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 115 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 116 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 117 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 119 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 120 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 121 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 122 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 123 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 124 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 125 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 126 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 127 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 128 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 129 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 130 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 131 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 132 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 133 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 134 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 135 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 136 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 137 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 138 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 139 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 140 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 141 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 142 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 143 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 144 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 145 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 146 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 147 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.53 |
| Metatranscriptomes | 0 |
| Isolates | 9.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.7 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 67.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000944 | 3300003215 | Bacteria | 17659 |
| 2 | JGI24739J22299_10000639 | 3300001989 | Bacteria | 12605 |
| 3 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 4 | JGI25162J39368_1000012 | 3300002737 | Bacteria | 373191 |
| 5 | JGI25162J39368_1001638 | 3300002737 | Bacteria | 11156 |
| 6 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 7 | rootH1_10037097 | 3300003316 | Bacteria | 5919 |
| 8 | rootH1_10037640 | 3300003316 | Bacteria | 23355 |
| 9 | rootH1_10042150 | 3300003316 | Bacteria | 4226 |
| 10 | rootH1_10046461 | 3300003316 | Bacteria | 7693 |
| 11 | rootH2_10005719 | 3300003320 | Bacteria | 108734 |
| 12 | rootH2_10095792 | 3300003320 | Bacteria | 19085 |
| 13 | rootL2_10059915 | 3300003322 | Bacteria | 10520 |
| 14 | rootL2_10064221 | 3300003322 | Bacteria | 11580 |
| 15 | rootH1_10000935 | 3300003316 | Bacteria | 20388 |
| 16 | rootH1_10000935 | 3300003323 | Bacteria | 13271 |
| 17 | rootH1_10012862 | 3300003323 | Bacteria | 52977 |
| 18 | Ga0055535_1000989 | 3300003761 | Bacteria | 18372 |
| 19 | Ga0055528_1000435 | 3300003790 | Bacteria | 33496 |
| 20 | Ga0055530_10001968 | 3300003791 | Bacteria | 13984 |
| 21 | Ga0055531_10000015 | 3300003794 | Bacteria | 182104 |
| 22 | Ga0055531_10000478 | 3300003794 | Bacteria | 37002 |
| 23 | Ga0065165_1000358 | 3300005262 | Bacteria | 75013 |
| 24 | Ga0065165_1002056 | 3300005262 | Bacteria | 18603 |
| 25 | Ga0065704_10000226 | 3300005289 | Bacteria | 67111 |
| 26 | Ga0065704_10075371 | 3300005289 | Bacteria | 5626 |
| 27 | Ga0065704_10077078 | 3300005289 | Bacteria | 4862 |
| 28 | Ga0065715_10001010 | 3300005293 | Bacteria | 9635 |
| 29 | Ga0070658_10002941 | 3300005327 | Bacteria | 14122 |
| 30 | Ga0068868_100004737 | 3300005338 | Bacteria | 9554 |
| 31 | Ga0070659_100000743 | 3300005366 | Bacteria | 23664 |
| 32 | Ga0070662_100000032 | 3300005457 | Bacteria | 78824 |
| 33 | Ga0070681_10004715 | 3300005458 | Bacteria | 13051 |
| 34 | Ga0068867_100000449 | 3300005459 | Bacteria | 27332 |
| 35 | Ga0070679_100002121 | 3300005530 | Bacteria | 17871 |
| 36 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 37 | Ga0068855_100000508 | 3300005563 | Bacteria | 48055 |
| 38 | Ga0068852_100000638 | 3300005616 | Bacteria | 22897 |
| 39 | Ga0068851_10000066 | 3300005834 | Bacteria | 58581 |
| 40 | Ga0075366_10000500 | 3300006195 | Bacteria | 18172 |
| 41 | Ga0075366_10001107 | 3300006195 | Bacteria | 13252 |
| 42 | Ga0097621_100001344 | 3300006237 | Bacteria | 16907 |
| 43 | Ga0068871_100000018 | 3300006358 | Bacteria | 89690 |
| 44 | Ga0075428_100029179 | 3300006844 | Bacteria | 6104 |
| 45 | Ga0068865_100000147 | 3300006881 | Bacteria | 37863 |
| 46 | Ga0105240_10000757 | 3300009093 | Bacteria | 58956 |
| 47 | Ga0105240_10005954 | 3300009093 | Bacteria | 18040 |
| 48 | Ga0105240_10027973 | 3300009093 | Bacteria | 7373 |
| 49 | Ga0111539_10005368 | 3300009094 | Bacteria | 16572 |
| 50 | Ga0111539_10037083 | 3300009094 | Bacteria | 5890 |
| 51 | Ga0105242_10019561 | 3300009176 | Bacteria | 5307 |
| 52 | Ga0105237_10001604 | 3300009545 | Bacteria | 29361 |
| 53 | Ga0105237_10004576 | 3300009545 | Bacteria | 15968 |
| 54 | Ga0105237_10005108 | 3300009545 | Bacteria | 14890 |
| 55 | Ga0105238_10018806 | 3300009551 | Bacteria | 7033 |
| 56 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 57 | Ga0105239_10000010 | 3300010375 | Bacteria | 341545 |
| 58 | Ga0105239_10000117 | 3300010375 | Bacteria | 112291 |
| 59 | Ga0105239_10002040 | 3300010375 | Bacteria | 26200 |
| 60 | Ga0157373_10000075 | 3300013100 | Bacteria | 85818 |
| 61 | Ga0157371_10001207 | 3300013102 | Bacteria | 27564 |
| 62 | Ga0157371_10002808 | 3300013102 | Bacteria | 16328 |
| 63 | Ga0157370_10027263 | 3300013104 | Bacteria | 5633 |
| 64 | Ga0157370_10041888 | 3300013104 | Bacteria | 4415 |
| 65 | Ga0157374_10000348 | 3300013296 | Bacteria | 42744 |
| 66 | Ga0157374_10001067 | 3300013296 | Bacteria | 23793 |
| 67 | Ga0163162_10000031 | 3300013306 | Bacteria | 157666 |
| 68 | Ga0163162_10002966 | 3300013306 | Bacteria | 16195 |
| 69 | Ga0157372_10000118 | 3300013307 | Bacteria | 84096 |
| 70 | Ga0157372_10001588 | 3300013307 | Bacteria | 24735 |
| 71 | Ga0157375_10007127 | 3300013308 | Bacteria | 9768 |
| 72 | Ga0157380_10000719 | 3300014326 | Bacteria | 20659 |
| 73 | Ga0182006_1002029 | 3300015261 | Bacteria | 11368 |
| 74 | Ga0182005_1000294 | 3300015265 | Bacteria | 31099 |
| 75 | Ga0209436_100880 | 3300025208 | Bacteria | 11980 |
| 76 | Ga0209436_101082 | 3300025208 | Bacteria | 10227 |
| 77 | Ga0207427_100085 | 3300025231 | Bacteria | 142561 |
| 78 | Ga0209437_100041 | 3300025233 | Bacteria | 444465 |
| 79 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 80 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 81 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 82 | Ga0209026_1000258 | 3300025250 | Bacteria | 65976 |
| 83 | Ga0209026_1000349 | 3300025250 | Bacteria | 43977 |
| 84 | Ga0209148_1000186 | 3300025254 | Bacteria | 117677 |
| 85 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 86 | Ga0209233_1002585 | 3300025261 | Bacteria | 6581 |
| 87 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 88 | Ga0209564_1011990 | 3300025295 | Bacteria | 3822 |
| 89 | Ga0209050_1000295 | 3300025298 | Bacteria | 104889 |
| 90 | Ga0209050_1002015 | 3300025298 | Bacteria | 18935 |
| 91 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 92 | Ga0207426_1000442 | 3300025302 | Bacteria | 66642 |
| 93 | Ga0207426_1003701 | 3300025302 | Bacteria | 8011 |
| 94 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 95 | Ga0209257_1000233 | 3300025304 | Bacteria | 129948 |
| 96 | Ga0209257_1005100 | 3300025304 | Bacteria | 9525 |
| 97 | Ga0207656_10000554 | 3300025321 | Bacteria | 12378 |
| 98 | Ga0207647_10000042 | 3300025904 | Bacteria | 91917 |
| 99 | Ga0207647_10000543 | 3300025904 | Bacteria | 30114 |
| 100 | Ga0207645_10003042 | 3300025907 | Bacteria | 12907 |
| 101 | Ga0207705_10000040 | 3300025909 | Bacteria | 185735 |
| 102 | Ga0207707_10032184 | 3300025912 | Bacteria | 4591 |
| 103 | Ga0207695_10000058 | 3300025913 | Bacteria | 366582 |
| 104 | Ga0207695_10018297 | 3300025913 | Bacteria | 8105 |
| 105 | Ga0207671_10002208 | 3300025914 | Bacteria | 21121 |
| 106 | Ga0207671_10007087 | 3300025914 | Bacteria | 9803 |
| 107 | Ga0207671_10012092 | 3300025914 | Bacteria | 6969 |
| 108 | Ga0207694_10018841 | 3300025924 | Bacteria | 5217 |
| 109 | Ga0207690_10000424 | 3300025932 | Bacteria | 27614 |
| 110 | Ga0207706_10000058 | 3300025933 | Bacteria | 112367 |
| 111 | Ga0207704_10000081 | 3300025938 | Bacteria | 57180 |
| 112 | Ga0207667_10001659 | 3300025949 | Bacteria | 28049 |
| 113 | Ga0207641_10000850 | 3300026088 | Bacteria | 32370 |
| 114 | Ga0207648_10000175 | 3300026089 | Bacteria | 66839 |
| 115 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 116 | Ga0307515_10000007 | 3300028794 | Bacteria | 719669 |
| 117 | Ga0307515_10000311 | 3300028794 | Bacteria | 120044 |
| 118 | Ga0307515_10003174 | 3300028794 | Bacteria | 34781 |
| 119 | Ga0307515_10055013 | 3300028794 | Bacteria | 5827 |
| 120 | Ga0265338_10030465 | 3300028800 | Bacteria | 5315 |
| 121 | Ga0265327_10000743 | 3300031251 | Bacteria | 50644 |
| 122 | Ga0265327_10006813 | 3300031251 | Bacteria | 9007 |
| 123 | Ga0265327_10010387 | 3300031251 | Bacteria | 6556 |
| 124 | Ga0265314_10010977 | 3300031711 | Bacteria | 7516 |
| 125 | Ga0307405_10017717 | 3300031731 | Bacteria | 3916 |
| 126 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 127 | Ga0307416_100002199 | 3300032002 | Bacteria | 11083 |
| 128 | Ga0307414_10000074 | 3300032004 | Bacteria | 94049 |
| 129 | Ga0307415_100003862 | 3300032126 | Bacteria | 7689 |
| 130 | Ga0307507_10000217 | 3300033179 | Bacteria | 109884 |
| 131 | Ga0307510_10001707 | 3300033180 | Bacteria | 24396 |
| 132 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 133 | Ga0395899_0000037 | 3300037312 | Bacteria | 280224 |
| 134 | Ga0395899_0001818 | 3300037312 | Bacteria | 17665 |
| 135 | Ga0395899_0013060 | 3300037312 | Bacteria | 6353 |
| 136 | Ga0395900_0000501 | 3300037418 | Bacteria | 55054 |
| 137 | Ga0395900_0008738 | 3300037418 | Bacteria | 10404 |
| 138 | Ga0395900_0010255 | 3300037418 | Bacteria | 9582 |
| 139 | Ga0395905_0002241 | 3300037471 | Bacteria | 21758 |
| 140 | Ga0395905_0003805 | 3300037471 | Bacteria | 15958 |
| 141 | Ga0395905_0004862 | 3300037471 | Bacteria | 13848 |
| 142 | Ga0395901_0000857 | 3300038443 | Bacteria | 33486 |
| 143 | Ga0395901_0003246 | 3300038443 | Bacteria | 16363 |
| 144 | Ga0436361_0233487 | 3300039447 | Bacteria | 8484 |
| 145 | Ga0451577_0000037 | 3300042876 | Bacteria | 360162 |
| 146 | Ga0451577_0000299 | 3300042876 | Bacteria | 96341 |
| 147 | Ga0451577_0001296 | 3300042876 | Bacteria | 34405 |
| 148 | Ga0451577_0006107 | 3300042876 | Bacteria | 12102 |
| 149 | Ga0451577_0013469 | 3300042876 | Bacteria | 7650 |
| 150 | Ga0453683_0000021 | 3300044673 | Bacteria | 284502 |
| 151 | Ga0453683_0000085 | 3300044673 | Bacteria | 140003 |
| 152 | Ga0453683_0000587 | 3300044673 | Bacteria | 40366 |
| 153 | Ga0453683_0000885 | 3300044673 | Bacteria | 28764 |
| 154 | Ga0453683_0007614 | 3300044673 | Bacteria | 7334 |
| 155 | Ga0453683_0030507 | 3300044673 | Bacteria | 3407 |
| 156 | Ga0453684_0000110 | 3300044712 | Bacteria | 360542 |
| 157 | Ga0453684_0000616 | 3300044712 | Bacteria | 130153 |
| 158 | Ga0453684_0000766 | 3300044712 | Bacteria | 111429 |
| 159 | Ga0453684_0000911 | 3300044712 | Bacteria | 98351 |
| 160 | Ga0453684_0000935 | 3300044712 | Bacteria | 96528 |
| 161 | Ga0453684_0002074 | 3300044712 | Bacteria | 50909 |
| 162 | Ga0453684_0006570 | 3300044712 | Bacteria | 22006 |
| 163 | Ga0453684_0007214 | 3300044712 | Bacteria | 20610 |
| 164 | Ga0453684_0007730 | 3300044712 | Bacteria | 19633 |
| 165 | Ga0453684_0023854 | 3300044712 | Bacteria | 8978 |
| 166 | Ga0453684_0030884 | 3300044712 | Bacteria | 7552 |
| 167 | Ga0453684_0049470 | 3300044712 | Bacteria | 5543 |
| 168 | Ga0453684_0051954 | 3300044712 | Bacteria | 5365 |
| 169 | Ga0453684_0062042 | 3300044712 | Bacteria | 4792 |
| 170 | Ga0453684_0070766 | 3300044712 | Bacteria | 4415 |
| 171 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 172 | Ga0451576_0000039 | 3300045051 | Bacteria | 360162 |
| 173 | Ga0451576_0000264 | 3300045051 | Bacteria | 128283 |
| 174 | Ga0451576_0000279 | 3300045051 | Bacteria | 125074 |
| 175 | Ga0451576_0000378 | 3300045051 | Bacteria | 104355 |
| 176 | Ga0451576_0000433 | 3300045051 | Bacteria | 96361 |
| 177 | Ga0451576_0001907 | 3300045051 | Bacteria | 33418 |
| 178 | Ga0451576_0003378 | 3300045051 | Bacteria | 22054 |
| 179 | Ga0451576_0004462 | 3300045051 | Bacteria | 18142 |
| 180 | Ga0451576_0020384 | 3300045051 | Bacteria | 7222 |
| 181 | Ga0495627_001289 | 3300046453 | Bacteria | 15384 |
| 182 | Ga0495638_0000006 | 3300046460 | Bacteria | 668846 |
| 183 | Ga0495650_0000013 | 3300046471 | Bacteria | 611135 |
| 184 | Ga0495585_0001310 | 3300046492 | Bacteria | 19822 |
| 185 | Ga0495585_0003092 | 3300046492 | Bacteria | 11440 |
| 186 | Ga0495583_0015026 | 3300046506 | Bacteria | 4234 |
| 187 | Ga0495606_0000010 | 3300046507 | Bacteria | 299893 |
| 188 | Ga0495606_0012808 | 3300046507 | Bacteria | 6683 |
| 189 | Ga0495606_0016020 | 3300046507 | Bacteria | 5741 |
| 190 | Ga0495610_0006519 | 3300046512 | Bacteria | 8008 |
| 191 | Ga0495648_0004562 | 3300046524 | Bacteria | 11802 |
| 192 | Ga0495633_0000056 | 3300046558 | Bacteria | 149334 |
| 193 | Ga0495633_0002101 | 3300046558 | Bacteria | 14319 |
| 194 | Ga0495633_0008072 | 3300046558 | Bacteria | 5981 |
| 195 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 196 | Ga0495625_0000100 | 3300046660 | Bacteria | 139983 |
| 197 | Ga0495625_0001414 | 3300046660 | Bacteria | 29350 |
| 198 | Ga0495625_0003127 | 3300046660 | Bacteria | 16910 |
| 199 | Ga0495661_0003116 | 3300046665 | Bacteria | 12428 |
| 200 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 201 | Ga0495687_000875 | 3300047443 | Bacteria | 31919 |
| 202 | Ga0495686_0000106 | 3300047472 | Bacteria | 175852 |
| 203 | Ga0495686_0004860 | 3300047472 | Bacteria | 10842 |
| 204 | Ga0496121_0000395 | 3300048924 | Bacteria | 88604 |
| 205 | Ga0501257_000510 | 3300049686 | Bacteria | 7713 |
| 206 | Ga0501241_000643 | 3300049758 | Bacteria | 7487 |
| 207 | Ga0501264_000047 | 3300049761 | Bacteria | 17062 |
| 208 | nmdc:mga0k408_1159_c2 | 3300050493 | Bacteria | 10430 |
| 209 | nmdc:mga0k408_7038_c1 | 3300050493 | Bacteria | 6004 |
| 210 | nmdc:mga08y16_10172_c1 | 3300050511 | Bacteria | 9876 |
| 211 | nmdc:mga08y16_38606_c1 | 3300050511 | Bacteria | 5013 |
| 212 | Ga0500651_0000357 | 3300053093 | Bacteria | 25575 |
| 213 | Ga0500608_000415 | 3300053122 | Bacteria | 16270 |
| 214 | Ga0500618_000001 | 3300053125 | Bacteria | 538477 |
| 215 | Ga0500577_0000714 | 3300053142 | Bacteria | 8498 |
| 216 | Ga0500616_0000065 | 3300053153 | Bacteria | 239287 |
| 217 | Ga0500622_0000010 | 3300053156 | Bacteria | 398804 |
| 218 | Ga0500622_0000044 | 3300053156 | Bacteria | 158778 |
| 219 | Ga0500622_0000093 | 3300053156 | Bacteria | 92537 |
| 220 | Ga0500622_0004717 | 3300053156 | Bacteria | 8426 |
| 221 | Ga0500624_000762 | 3300053157 | Bacteria | 7749 |
| 222 | 2738763263 | 2738541284 | Bacteria | 5199923 |
| 223 | 2739301639 | 2738543023 | Bacteria | 6767879 |
| 224 | 2776616131 | 2775506987 | Bacteria | 5373360 |
| 225 | 2819577331 | 2818991442 | Bacteria | 8318214 |
| 226 | 2819676472 | 2818991460 | Bacteria | 7595395 |
| 227 | 2821140636 | 2821136567 | Bacteria | 8080116 |
| 228 | 2840678318 | 2840677318 | Bacteria | 2664183 |
| 229 | 2852627673 | 2852627209 | Bacteria | 5896285 |
| 230 | 2883071254 | 2883068021 | Bacteria | 6192739 |
| 231 | 2884796303 | 2884791551 | Bacteria | 8511252 |
| 232 | 2896086135 | 2896085136 | Bacteria | 6129793 |
| 233 | 2896115290 | 2896109856 | Bacteria | 7140722 |
| 234 | 2904473055 | 2904467357 | Bacteria | 8057758 |
| 235 | 2910250013 | 2910245624 | Bacteria | 6935613 |
| 236 | 2919187837 | 2919186247 | Bacteria | 6244071 |
| 237 | 2929178178 | 2929177148 | Bacteria | 7883697 |
| 238 | 2929240478 | 2929239360 | Bacteria | 7745570 |
| 239 | 2929922320 | 2929921140 | Bacteria | 8649150 |
| 240 | 2939664896 | 2939664404 | Bacteria | 6364494 |
| 241 | 2945980540 | 2945977869 | Bacteria | 7777518 |
| 242 | 2946013598 | 2946013367 | Bacteria | 7766675 |
| 243 | 2977233046 | 2977232053 | Bacteria | 5485925 |
| 244 | 8003156691 | 8003151029 | Bacteria | 8187759 |
| 245 | JGI25153J46596_10000944 | |||
| 246 | JGI24739J22299_10000639 | |||
| 247 | JGI24735J21928_10000001 | |||
| 248 | JGI25162J39368_1000012 | |||
| 249 | JGI25162J39368_1001638 | |||
| 250 | JGI25154J39366_1000003 | |||
| 251 | rootH1_10037097 | |||
| 252 | rootH1_10037640 | |||
| 253 | rootH1_10042150 | |||
| 254 | rootH1_10046461 | |||
| 255 | rootH2_10005719 | |||
| 256 | rootH2_10095792 | |||
| 257 | rootL2_10059915 | |||
| 258 | rootL2_10064221 | |||
| 259 | rootH1_10000935 | |||
| 260 | rootH1_10012862 | |||
| 261 | Ga0055535_1000989 | |||
| 262 | Ga0055528_1000435 | |||
| 263 | Ga0055530_10001968 | |||
| 264 | Ga0055531_10000015 | |||
| 265 | Ga0055531_10000478 | |||
| 266 | Ga0065165_1000358 | |||
| 267 | Ga0065165_1002056 | |||
| 268 | Ga0065704_10000226 | |||
| 269 | Ga0065704_10075371 | |||
| 270 | Ga0065704_10077078 | |||
| 271 | Ga0065715_10001010 | |||
| 272 | Ga0070658_10002941 | |||
| 273 | Ga0068868_100004737 | |||
| 274 | Ga0070659_100000743 | |||
| 275 | Ga0070662_100000032 | |||
| 276 | Ga0070681_10004715 | |||
| 277 | Ga0068867_100000449 | |||
| 278 | Ga0070679_100002121 | |||
| 279 | Ga0070665_100000003 | |||
| 280 | Ga0068855_100000508 | |||
| 281 | Ga0068852_100000638 | |||
| 282 | Ga0068851_10000066 | |||
| 283 | Ga0075366_10000500 | |||
| 284 | Ga0075366_10001107 | |||
| 285 | Ga0097621_100001344 | |||
| 286 | Ga0068871_100000018 | |||
| 287 | Ga0075428_100029179 | |||
| 288 | Ga0068865_100000147 | |||
| 289 | Ga0105240_10000757 | |||
| 290 | Ga0105240_10005954 | |||
| 291 | Ga0105240_10027973 | |||
| 292 | Ga0111539_10005368 | |||
| 293 | Ga0111539_10037083 | |||
| 294 | Ga0105242_10019561 | |||
| 295 | Ga0105237_10001604 | |||
| 296 | Ga0105237_10004576 | |||
| 297 | Ga0105237_10005108 | |||
| 298 | Ga0105238_10018806 | |||
| 299 | Ga0105239_10000005 | |||
| 300 | Ga0105239_10000010 | |||
| 301 | Ga0105239_10000117 | |||
| 302 | Ga0105239_10002040 | |||
| 303 | Ga0157373_10000075 | |||
| 304 | Ga0157371_10001207 | |||
| 305 | Ga0157371_10002808 | |||
| 306 | Ga0157370_10027263 | |||
| 307 | Ga0157370_10041888 | |||
| 308 | Ga0157374_10000348 | |||
| 309 | Ga0157374_10001067 | |||
| 310 | Ga0163162_10000031 | |||
| 311 | Ga0163162_10002966 | |||
| 312 | Ga0157372_10000118 | |||
| 313 | Ga0157372_10001588 | |||
| 314 | Ga0157375_10007127 | |||
| 315 | Ga0157380_10000719 | |||
| 316 | Ga0182006_1002029 | |||
| 317 | Ga0182005_1000294 | |||
| 318 | Ga0209436_100880 | |||
| 319 | Ga0209436_101082 | |||
| 320 | Ga0207427_100085 | |||
| 321 | Ga0209437_100041 | |||
| 322 | Ga0209437_100052 | |||
| 323 | Ga0209258_100032 | |||
| 324 | Ga0209646_1000004 | |||
| 325 | Ga0209026_1000258 | |||
| 326 | Ga0209026_1000349 | |||
| 327 | Ga0209148_1000186 | |||
| 328 | Ga0209233_1000067 | |||
| 329 | Ga0209233_1002585 | |||
| 330 | Ga0209673_1000042 | |||
| 331 | Ga0209564_1011990 | |||
| 332 | Ga0209050_1000295 | |||
| 333 | Ga0209050_1002015 | |||
| 334 | Ga0207426_1000033 | |||
| 335 | Ga0207426_1000442 | |||
| 336 | Ga0207426_1003701 | |||
| 337 | Ga0209257_1000005 | |||
| 338 | Ga0209257_1000233 | |||
| 339 | Ga0209257_1005100 | |||
| 340 | Ga0207656_10000554 | |||
| 341 | Ga0207647_10000042 | |||
| 342 | Ga0207647_10000543 | |||
| 343 | Ga0207645_10003042 | |||
| 344 | Ga0207705_10000040 | |||
| 345 | Ga0207707_10032184 | |||
| 346 | Ga0207695_10000058 | |||
| 347 | Ga0207695_10018297 | |||
| 348 | Ga0207671_10002208 | |||
| 349 | Ga0207671_10007087 | |||
| 350 | Ga0207671_10012092 | |||
| 351 | Ga0207694_10018841 | |||
| 352 | Ga0207690_10000424 | |||
| 353 | Ga0207706_10000058 | |||
| 354 | Ga0207704_10000081 | |||
| 355 | Ga0207667_10001659 | |||
| 356 | Ga0207641_10000850 | |||
| 357 | Ga0207648_10000175 | |||
| 358 | Ga0268266_10000018 | |||
| 359 | Ga0307515_10000007 | |||
| 360 | Ga0307515_10000311 | |||
| 361 | Ga0307515_10003174 | |||
| 362 | Ga0307515_10055013 | |||
| 363 | Ga0265338_10030465 | |||
| 364 | Ga0265327_10000743 | |||
| 365 | Ga0265327_10006813 | |||
| 366 | Ga0265327_10010387 | |||
| 367 | Ga0265314_10010977 | |||
| 368 | Ga0307405_10017717 | |||
| 369 | Ga0307412_10000001 | |||
| 370 | Ga0307416_100002199 | |||
| 371 | Ga0307414_10000074 | |||
| 372 | Ga0307415_100003862 | |||
| 373 | Ga0307507_10000217 | |||
| 374 | Ga0307510_10001707 | |||
| 375 | Ga0395899_0000001 | |||
| 376 | Ga0395899_0000037 | |||
| 377 | Ga0395899_0001818 | |||
| 378 | Ga0395899_0013060 | |||
| 379 | Ga0395900_0000501 | |||
| 380 | Ga0395900_0008738 | |||
| 381 | Ga0395900_0010255 | |||
| 382 | Ga0395905_0002241 | |||
| 383 | Ga0395905_0003805 | |||
| 384 | Ga0395905_0004862 | |||
| 385 | Ga0395901_0000857 | |||
| 386 | Ga0395901_0003246 | |||
| 387 | Ga0436361_0233487 | |||
| 388 | Ga0451577_0000037 | |||
| 389 | Ga0451577_0000299 | |||
| 390 | Ga0451577_0001296 | |||
| 391 | Ga0451577_0006107 | |||
| 392 | Ga0451577_0013469 | |||
| 393 | Ga0453683_0000021 | |||
| 394 | Ga0453683_0000085 | |||
| 395 | Ga0453683_0000587 | |||
| 396 | Ga0453683_0000885 | |||
| 397 | Ga0453683_0007614 | |||
| 398 | Ga0453683_0030507 | |||
| 399 | Ga0453684_0000110 | |||
| 400 | Ga0453684_0000616 | |||
| 401 | Ga0453684_0000766 | |||
| 402 | Ga0453684_0000911 | |||
| 403 | Ga0453684_0000935 | |||
| 404 | Ga0453684_0002074 | |||
| 405 | Ga0453684_0006570 | |||
| 406 | Ga0453684_0007214 | |||
| 407 | Ga0453684_0007730 | |||
| 408 | Ga0453684_0023854 | |||
| 409 | Ga0453684_0030884 | |||
| 410 | Ga0453684_0049470 | |||
| 411 | Ga0453684_0051954 | |||
| 412 | Ga0453684_0062042 | |||
| 413 | Ga0453684_0070766 | |||
| 414 | Ga0451576_0000003 | |||
| 415 | Ga0451576_0000039 | |||
| 416 | Ga0451576_0000264 | |||
| 417 | Ga0451576_0000279 | |||
| 418 | Ga0451576_0000378 | |||
| 419 | Ga0451576_0000433 | |||
| 420 | Ga0451576_0001907 | |||
| 421 | Ga0451576_0003378 | |||
| 422 | Ga0451576_0004462 | |||
| 423 | Ga0451576_0020384 | |||
| 424 | Ga0495627_001289 | |||
| 425 | Ga0495638_0000006 | |||
| 426 | Ga0495650_0000013 | |||
| 427 | Ga0495585_0001310 | |||
| 428 | Ga0495585_0003092 | |||
| 429 | Ga0495583_0015026 | |||
| 430 | Ga0495606_0000010 | |||
| 431 | Ga0495606_0012808 | |||
| 432 | Ga0495606_0016020 | |||
| 433 | Ga0495610_0006519 | |||
| 434 | Ga0495648_0004562 | |||
| 435 | Ga0495633_0000056 | |||
| 436 | Ga0495633_0002101 | |||
| 437 | Ga0495633_0008072 | |||
| 438 | Ga0495668_0000003 | |||
| 439 | Ga0495625_0000100 | |||
| 440 | Ga0495625_0001414 | |||
| 441 | Ga0495625_0003127 | |||
| 442 | Ga0495661_0003116 | |||
| 443 | Ga0495649_0000002 | |||
| 444 | Ga0495687_000875 | |||
| 445 | Ga0495686_0000106 | |||
| 446 | Ga0495686_0004860 | |||
| 447 | Ga0496121_0000395 | |||
| 448 | Ga0501257_000510 | |||
| 449 | Ga0501241_000643 | |||
| 450 | Ga0501264_000047 | |||
| 451 | nmdc:mga0k408_1159_c2 | |||
| 452 | nmdc:mga0k408_7038_c1 | |||
| 453 | nmdc:mga08y16_10172_c1 | |||
| 454 | nmdc:mga08y16_38606_c1 | |||
| 455 | Ga0500651_0000357 | |||
| 456 | Ga0500608_000415 | |||
| 457 | Ga0500618_000001 | |||
| 458 | Ga0500577_0000714 | |||
| 459 | Ga0500616_0000065 | |||
| 460 | Ga0500622_0000010 | |||
| 461 | Ga0500622_0000044 | |||
| 462 | Ga0500622_0000093 | |||
| 463 | Ga0500622_0004717 | |||
| 464 | Ga0500624_000762 | |||
| 465 | 2738763263 | |||
| 466 | 2739301639 | |||
| 467 | 2776616131 | |||
| 468 | 2819577331 | |||
| 469 | 2819676472 | |||
| 470 | 2821140636 | |||
| 471 | 2840678318 | |||
| 472 | 2852627673 | |||
| 473 | 2883071254 | |||
| 474 | 2884796303 | |||
| 475 | 2896086135 | |||
| 476 | 2896115290 | |||
| 477 | 2904473055 | |||
| 478 | 2910250013 | |||
| 479 | 2919187837 | |||
| 480 | 2929178178 | |||
| 481 | 2929240478 | |||
| 482 | 2929922320 | |||
| 483 | 2939664896 | |||
| 484 | 2945980540 | |||
| 485 | 2946013598 | |||
| 486 | 2977233046 | |||
| 487 | 8003156691 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rr7-assembly1.cif.gz_C | multidrug efflux pump subunit acrb | 0.8562 | 16 | 1078 |
| 4k0j-assembly2.cif.gz_E | x-ray crystal structure of a heavy metal efflux pump, crystal form i | 0.8535 | 12 | 1073 |
| 2v50-assembly1.cif.gz_C | the missing part of the bacterial mexab-oprm system: structural determination of the multidrug exporter mexb | 0.8513 | 12 | 1075 |
| 4k0e-assembly1.cif.gz_A | x-ray crystal structure of a heavy metal efflux pump, crystal form ii | 0.8499 | 12 | 1075 |
| 7rr8-assembly1.cif.gz_C | multidrug efflux pump subunit acrb | 0.8498 | 12 | 1078 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38054_46_113_3.30.70.1430 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Multidrug efflux transporter AcrB pore domain | 0.9522 | 54 | 118 | 3.30.70.1430 |
| af_P37637_331_506_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9424 | 333 | 493 | 1.20.1640.10 |
| af_P24177_305_504_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9416 | 304 | 493 | 1.20.1640.10 |
| af_Q2FVZ5_39_104_3.30.70.1430 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Multidrug efflux transporter AcrB pore domain | 0.9355 | 46 | 109 | 3.30.70.1430 |
| 1oyeA01 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.9205 | 329 | 494 | 1.20.1640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J6HG92-F1-model_v4 | Copper transporter | 0.9642 | 1 | 970 |
GO:0005886
GO:0042910 |
| AF-A0A2J6HG92-F1-model_v4 | Copper transporter | 0.9593 | 1 | 970 |
GO:0005886
GO:0042910 |
| AF-A0A6L4YPU5-F1-model_v4 | Cation/multidrug efflux pump | 0.9226 | 160 | 517 |
GO:0005886
GO:0042910 |
| AF-A0A6L8EIF7-F1-model_v4 | Efflux RND transporter permease subunit | 0.9172 | 14 | 118 |
GO:0005886
GO:0042910 |
| AF-A0A2M7NVZ3-F1-model_v4 | SSD domain-containing protein | 0.9109 | 136 | 930 |
GO:0005886
GO:0042910 |