F355241

General Info

Members Datasets Scaffolds Average Seq Length
243 132 243 515

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10134171|rootH2_101341712
Length 547
Sequence MPVAQTLADAVDSVSRFVRTLDGWKQLLFTLICGAISAIAFPPLVFTPALLIGFAMLVLMLDGAQWHMKPISVAERAAWFLFGGVLAAFLPDRLLRAFRIGWFFGLGQFAVGLHWVGYAFLVDPSEHLWQLPIGVAGLAMLLAVFPAWGAAAAAWLWRSGPLRIPIFAMCYAMAEWLRGHVLTGFPWNLPGYGWGMFLQIFQSTALFGIYGLTFLTVLFGASLAALFDTEHRTRWLFPAGMLGLFVIMWSAGSLRQTFTPIGSVPDVSLRIVQPNIPQNEKYLPQYVARNWDRLIDLSNAKGPKPTITIWPESAPPFLLQREPEAVDQISLLTRGKAVLITGAVRSEQLSDGSHRYFNSLFIFGHAAQLIAVYDKFHLVPFGEYLPMEPLLSAIGLTKLVGIGSFASGPGPRTFHIPGAPPVGPLICYEIIFPGAVIGQTRPGWLVNVSDDSWFGPWAGPRQHLLIARVRAIEEGLPVVRGTNTGFSAVIDPLGRLASRLGSGRMGVLDAQLPQALPPTPYARFGDLIFAFMIVVCGAVTLYLRRYF

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0
Rhizoplane 0
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10001002 3300003215 Bacteria 17171
3 rootH2_10080367 3300003320 Bacteria 1950
4 rootH2_10134171 3300003320 Bacteria 2220
5 Ga0070658_10008972 3300005327 Bacteria 8036
6 Ga0070658_10130496 3300005327 Bacteria 2094
7 Ga0070676_10005828 3300005328 Bacteria 6571
8 Ga0070690_100049643 3300005330 Bacteria 2675
9 Ga0068869_100002394 3300005334 Bacteria 11301
10 Ga0070666_10006536 3300005335 Bacteria 7162
11 Ga0070666_10009849 3300005335 Bacteria 5967
12 Ga0070680_100001638 3300005336 Bacteria 16359
13 Ga0070660_100023651 3300005339 Bacteria 4553
14 Ga0070691_10000062 3300005341 Bacteria 30042
15 Ga0070667_100054522 3300005367 Bacteria 3376
16 Ga0070709_10000238 3300005434 Bacteria 35500
17 Ga0070714_100031614 3300005435 Bacteria 4418
18 Ga0070713_100000011 3300005436 Bacteria 146314
19 Ga0070710_10023381 3300005437 Bacteria 3248
20 Ga0070711_100007028 3300005439 Bacteria 6829
21 Ga0070711_100011521 3300005439 Bacteria 5495
22 Ga0070711_100088694 3300005439 Bacteria 2223
23 Ga0070678_100015083 3300005456 Bacteria 4899
24 Ga0070684_100017035 3300005535 Bacteria 5955
25 Ga0070684_100132792 3300005535 Bacteria 2246
26 Ga0068853_100071301 3300005539 Bacteria 3025
27 Ga0068853_100078550 3300005539 Bacteria 2885
28 Ga0070665_100020055 3300005548 Bacteria 6713
29 Ga0070665_100022739 3300005548 Bacteria 6311
30 Ga0070665_100091482 3300005548 Bacteria 3047
31 Ga0070665_100111100 3300005548 Bacteria 2743
32 Ga0070665_100112162 3300005548 Bacteria 2729
33 Ga0068855_100014142 3300005563 Bacteria 9615
34 Ga0068855_100034763 3300005563 Bacteria 6006
35 Ga0068855_100092020 3300005563 Bacteria 3498
36 Ga0068855_100178210 3300005563 Bacteria 2404
37 Ga0068857_100038695 3300005577 Bacteria 4223
38 Ga0068854_100131134 3300005578 Bacteria 1914
39 Ga0068852_100011874 3300005616 Bacteria 6585
40 Ga0068852_100044147 3300005616 Bacteria 3783
41 Ga0068863_100040652 3300005841 Bacteria 4421
42 Ga0068858_100007882 3300005842 Bacteria 10269
43 Ga0068858_100019360 3300005842 Bacteria 6365
44 Ga0068858_100028088 3300005842 Bacteria 5228
45 Ga0081455_10125285 3300005937 Bacteria 2017
46 Ga0070716_100013785 3300006173 Bacteria 4128
47 Ga0070712_100000014 3300006175 Bacteria 108668
48 Ga0070712_100000314 3300006175 Bacteria 27319
49 Ga0097621_100001298 3300006237 Bacteria 17188
50 Ga0097621_100011499 3300006237 Bacteria 6521
51 Ga0097621_100028857 3300006237 Bacteria 4377
52 Ga0097621_100099857 3300006237 Bacteria 2440
53 Ga0068871_100000113 3300006358 Bacteria 49481
54 Ga0068871_100026304 3300006358 Bacteria 4539
55 Ga0068871_100028991 3300006358 Bacteria 4345
56 Ga0068871_100033184 3300006358 Bacteria 4085
57 Ga0075434_100076479 3300006871 Bacteria 3343
58 Ga0075436_100000047 3300006914 Bacteria 72907
59 Ga0105240_10000355 3300009093 Bacteria 86025
60 Ga0105240_10009397 3300009093 Bacteria 13845
61 Ga0105240_10028212 3300009093 Bacteria 7335
62 Ga0105240_10033158 3300009093 Bacteria 6675
63 Ga0105240_10040460 3300009093 Bacteria 5960
64 Ga0105240_10054379 3300009093 Bacteria 5017
65 Ga0105240_10088320 3300009093 Bacteria 3794
66 Ga0105240_10099183 3300009093 Bacteria 3546
67 Ga0105240_10215554 3300009093 Bacteria 2240
68 Ga0105245_10139537 3300009098 Bacteria 2281
69 Ga0105243_10006780 3300009148 Bacteria 8830
70 Ga0105241_10008503 3300009174 Bacteria 7546
71 Ga0105241_10049572 3300009174 Bacteria 3198
72 Ga0105248_10011035 3300009177 Bacteria 9965
73 Ga0105248_10049921 3300009177 Bacteria 4691
74 Ga0105237_10014301 3300009545 Bacteria 8307
75 Ga0105237_10015763 3300009545 Bacteria 7860
76 Ga0105237_10181053 3300009545 Bacteria 2108
77 Ga0105237_10201798 3300009545 Bacteria 1989
78 Ga0105237_10232358 3300009545 Bacteria 1845
79 Ga0105238_10003708 3300009551 Bacteria 15199
80 Ga0105238_10043214 3300009551 Bacteria 4560
81 Ga0105238_10058739 3300009551 Bacteria 3855
82 Ga0105238_10065097 3300009551 Bacteria 3646
83 Ga0105238_10081893 3300009551 Bacteria 3217
84 Ga0105238_10096614 3300009551 Bacteria 2940
85 Ga0105239_10004849 3300010375 Bacteria 15916
86 Ga0105239_10056381 3300010375 Bacteria 4310
87 Ga0105239_10066929 3300010375 Bacteria 3946
88 Ga0105239_10092249 3300010375 Bacteria 3343
89 Ga0105246_10046526 3300011119 Bacteria 2960
90 Ga0157373_10003426 3300013100 Bacteria 12004
91 Ga0157370_10023739 3300013104 Bacteria 6085
92 Ga0157369_10018966 3300013105 Bacteria 7704
93 Ga0157369_10097715 3300013105 Bacteria 3132
94 Ga0163162_10107122 3300013306 Bacteria 2890
95 Ga0157372_10028043 3300013307 Bacteria 6141
96 Ga0157379_10001288 3300014968 Bacteria 20426
97 Ga0157379_10001360 3300014968 Bacteria 20024
98 Ga0157379_10002345 3300014968 Bacteria 15799
99 Ga0157379_10039617 3300014968 Bacteria 4204
100 Ga0157379_10116166 3300014968 Bacteria 2406
101 Ga0213876_10001741 3300021384 Bacteria 13209
102 Ga0209233_1000006 3300025261 Bacteria 1473685
103 Ga0209233_1002157 3300025261 Bacteria 7381
104 Ga0209758_1000008 3300025297 Bacteria 1215263
105 Ga0207680_10001356 3300025903 Bacteria 11609
106 Ga0207680_10008206 3300025903 Bacteria 5118
107 Ga0207699_10000233 3300025906 Bacteria 31418
108 Ga0207645_10011026 3300025907 Bacteria 6185
109 Ga0207654_10012882 3300025911 Bacteria 4290
110 Ga0207654_10083004 3300025911 Bacteria 1934
111 Ga0207695_10003622 3300025913 Bacteria 21591
112 Ga0207695_10007707 3300025913 Bacteria 13633
113 Ga0207695_10022595 3300025913 Bacteria 7135
114 Ga0207695_10143835 3300025913 Bacteria 2331
115 Ga0207671_10025679 3300025914 Bacteria 4422
116 Ga0207693_10000018 3300025915 Bacteria 138365
117 Ga0207693_10000276 3300025915 Bacteria 47566
118 Ga0207663_10027639 3300025916 Bacteria 3310
119 Ga0207657_10004729 3300025919 Bacteria 14373
120 Ga0207646_10143959 3300025922 Bacteria 2148
121 Ga0207694_10011277 3300025924 Bacteria 6749
122 Ga0207700_10000005 3300025928 Bacteria 394836
123 Ga0207664_10001580 3300025929 Bacteria 14965
124 Ga0207665_10036940 3300025939 Bacteria 3250
125 Ga0207711_10057119 3300025941 Bacteria 3355
126 Ga0207667_10002838 3300025949 Bacteria 21514
127 Ga0207667_10053103 3300025949 Bacteria 4265
128 Ga0207658_10044215 3300025986 Bacteria 3242
129 Ga0207703_10030840 3300026035 Bacteria 4238
130 Ga0207703_10110320 3300026035 Bacteria 2347
131 Ga0207639_10053222 3300026041 Bacteria 3088
132 Ga0207639_10080620 3300026041 Bacteria 2575
133 Ga0207702_10000680 3300026078 Bacteria 36910
134 Ga0207702_10001080 3300026078 Bacteria 27929
135 Ga0207648_10009495 3300026089 Bacteria 9309
136 Ga0207674_10000112 3300026116 Bacteria 94220
137 Ga0207674_10023077 3300026116 Bacteria 6672
138 Ga0207674_10129515 3300026116 Bacteria 2487
139 Ga0207674_10150084 3300026116 Bacteria 2288
140 Ga0207683_10007425 3300026121 Bacteria 9401
141 Ga0268266_10039690 3300028379 Bacteria 4009
142 Ga0268266_10082098 3300028379 Bacteria 2811
143 Ga0268266_10110088 3300028379 Bacteria 2439
144 Ga0268266_10122066 3300028379 Bacteria 2319
145 Ga0268266_10127698 3300028379 Bacteria 2271
146 Ga0268264_10036120 3300028381 Bacteria 4068
147 Ga0265318_10000737 3300028577 Bacteria 21809
148 Ga0265338_10000011 3300028800 Bacteria 433370
149 Ga0265338_10008717 3300028800 Bacteria 12257
150 Ga0265320_10006535 3300031240 Bacteria 7339
151 Ga0265325_10000009 3300031241 Bacteria 184273
152 Ga0265325_10000094 3300031241 Bacteria 62066
153 Ga0265325_10005771 3300031241 Bacteria 7592
154 Ga0265325_10028586 3300031241 Bacteria 3004
155 Ga0265340_10000018 3300031247 Bacteria 90851
156 Ga0265340_10006837 3300031247 Bacteria 6240
157 Ga0265340_10015177 3300031247 Bacteria 4007
158 Ga0265340_10049217 3300031247 Bacteria 2047
159 Ga0265339_10000320 3300031249 Bacteria 38805
160 Ga0265339_10004286 3300031249 Bacteria 9747
161 Ga0265339_10010909 3300031249 Bacteria 5618
162 Ga0265339_10013014 3300031249 Bacteria 5058
163 Ga0265339_10030259 3300031249 Bacteria 3067
164 Ga0265331_10004777 3300031250 Bacteria 8348
165 Ga0265331_10042540 3300031250 Bacteria 2203
166 Ga0265316_10002525 3300031344 Bacteria 18916
167 Ga0265316_10020262 3300031344 Bacteria 5666
168 Ga0265316_10080431 3300031344 Bacteria 2499
169 Ga0307513_10106503 3300031456 Bacteria 2810
170 Ga0265313_10000338 3300031595 Bacteria 50856
171 Ga0265313_10000674 3300031595 Bacteria 35158
172 Ga0265313_10001518 3300031595 Bacteria 21606
173 Ga0265313_10003779 3300031595 Bacteria 12016
174 Ga0265313_10017599 3300031595 Bacteria 4051
175 Ga0265314_10004118 3300031711 Bacteria 13698
176 Ga0265314_10006102 3300031711 Bacteria 10709
177 Ga0265314_10018417 3300031711 Bacteria 5444
178 Ga0265342_10002218 3300031712 Bacteria 17059
179 Ga0265342_10014464 3300031712 Bacteria 5237
180 Ga0373955_0059848 3300035172 Bacteria 2099
181 Ga0373935_0038793 3300035692 Bacteria 2984
182 Ga0373933_0015862 3300035724 Bacteria 4206
183 Ga0373937_0000823 3300036401 Bacteria 26584
184 Ga0373937_0014935 3300036401 Bacteria 6858
185 Ga0373937_0119993 3300036401 Bacteria 2450
186 Ga0395899_0021125 3300037312 Bacteria 4937
187 Ga0395900_0054391 3300037418 Bacteria 4122
188 Ga0395898_0071456 3300037466 Bacteria 3353
189 Ga0395901_0055241 3300038443 Bacteria 4129
190 Ga0436365_1048976 3300039437 Bacteria 7066
191 Ga0436365_1373922 3300039437 Bacteria 27022
192 Ga0495629_0049687 3300046459 Bacteria 2939
193 Ga0495582_0077235 3300046473 Bacteria 1847
194 Ga0495587_0037907 3300046536 Bacteria 2892
195 Ga0495645_0006785 3300046543 Bacteria 7955
196 Ga0495622_0008394 3300046557 Bacteria 4783
197 Ga0495658_0000382 3300046683 Bacteria 24861
198 Ga0495581_0023871 3300047315 Bacteria 3544
199 Ga0495602_0061554 3300048088 Bacteria 3263
200 Ga0496126_0000653 3300048929 Bacteria 64292
201 Ga0501033_0019126 3300049570 Bacteria 5179
202 Ga0501033_0036364 3300049570 Bacteria 3690
203 Ga0501033_0060627 3300049570 Bacteria 2790
204 Ga0501034_0131680 3300049571 Bacteria 2484
205 Ga0501036_0015993 3300049572 Bacteria 6267
206 Ga0501038_0090967 3300049574 Bacteria 2557
207 Ga0501046_0008029 3300049580 Bacteria 9225
208 Ga0501047_0000872 3300049581 Bacteria 30782
209 Ga0501047_0017890 3300049581 Bacteria 6792
210 Ga0501047_0050156 3300049581 Bacteria 4030
211 Ga0501047_0115945 3300049581 Bacteria 2560
212 Ga0501067_0008086 3300049583 Bacteria 5843
213 Ga0501070_0098424 3300049586 Bacteria 2419
214 Ga0501072_0000844 3300049588 Bacteria 22545
215 Ga0501073_0007445 3300049589 Bacteria 8136
216 Ga0501073_0051649 3300049589 Bacteria 2879
217 Ga0501074_0065895 3300049590 Bacteria 2606
218 Ga0501079_0003964 3300049741 Bacteria 10936
219 Ga0501080_0030727 3300049742 Bacteria 5005
220 Ga0501080_0151570 3300049742 Bacteria 2142
221 Ga0501035_0002619 3300049822 Bacteria 17542
222 Ga0501035_0011486 3300049822 Bacteria 8206
223 Ga0501035_0016319 3300049822 Bacteria 6851
224 Ga0501035_0040845 3300049822 Bacteria 4190
225 Ga0501035_0117753 3300049822 Bacteria 2324
226 Ga0501044_0021522 3300049823 Bacteria 6878
227 Ga0501044_0022013 3300049823 Bacteria 6796
228 Ga0501044_0027825 3300049823 Bacteria 5968
229 Ga0501044_0036651 3300049823 Bacteria 5129
230 Ga0501044_0082038 3300049823 Bacteria 3263
231 Ga0501044_0174484 3300049823 Bacteria 2119
232 nmdc:mga0n895_47114_c1 3300050512 Bacteria 4214
233 nmdc:mga0n895_90600_c1 3300050512 Bacteria 3060
234 nmdc:mga0rr50_18568_c1 3300050513 Bacteria 4674
235 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
236 Ga0500643_000027 3300053087 Bacteria 251062
237 Ga0500641_0005383 3300053096 Bacteria 4537
238 Ga0500595_000824 3300053119 Bacteria 17755
239 Ga0500595_003775 3300053119 Bacteria 6971
240 Ga0500573_0000032 3300053140 Bacteria 131098
241 Ga0500645_008850 3300053730 Bacteria 3410
242 Ga0501084_0013829 3300054114 Bacteria 6681
243 Ga0501082_0013215 3300060353 Bacteria 7101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0038793 Ga0373935_0038793_20_1324 428
2 3300049581 Ga0501047_0115945 Ga0501047_0115945_1191_2546 442
3 3300049586 Ga0501070_0098424 Ga0501070_0098424_1023_2378 442
4 3300025922 Ga0207646_10143959 Ga0207646_101439592 446
5 3300006237 Ga0097621_100011499 Ga0097621_1000114996 467
6 3300006358 Ga0068871_100026304 Ga0068871_1000263046 467
7 3300031249 Ga0265339_10013014 Ga0265339_100130144 471
8 3300031247 Ga0265340_10015177 Ga0265340_100151775 475
9 3300035172 Ga0373955_0059848 Ga0373955_0059848_123_1676 475
10 3300036401 Ga0373937_0014935 Ga0373937_0014935_1268_2821 475
11 3300006237 Ga0097621_100028857 Ga0097621_1000288572 477
12 3300005456 Ga0070678_100015083 Ga0070678_1000150832 486
13 3300026121 Ga0207683_10007425 Ga0207683_1000742510 486
14 3300039437 Ga0436365_1048976 Ga0436365_1048976_138_1694 488
15 3300049570 Ga0501033_0060627 Ga0501033_0060627_1196_2719 488
16 3300006237 Ga0097621_100099857 Ga0097621_1000998573 489
17 3300009551 Ga0105238_10043214 Ga0105238_100432142 489
18 3300013104 Ga0157370_10023739 Ga0157370_100237397 491
19 3300054114 Ga0501084_0013829 Ga0501084_0013829_2794_4347 492
20 3300060353 Ga0501082_0013215 Ga0501082_0013215_1138_2691 492
21 3300035724 Ga0373933_0015862 Ga0373933_0015862_572_2113 493
22 3300036401 Ga0373937_0000823 Ga0373937_0000823_3473_5014 493
23 3300031250 Ga0265331_10042540 Ga0265331_100425402 495
24 3300031344 Ga0265316_10080431 Ga0265316_100804312 495
25 3300005439 Ga0070711_100011521 Ga0070711_1000115212 496
26 3300025916 Ga0207663_10027639 Ga0207663_100276392 496
27 3300028381 Ga0268264_10036120 Ga0268264_100361202 497
28 3300046557 Ga0495622_0008394 Ga0495622_0008394_2806_4371 498
29 3300049822 Ga0501035_0016319 Ga0501035_0016319_970_2481 498
30 3300049823 Ga0501044_0174484 Ga0501044_0174484_363_1874 498
31 3300005563 Ga0068855_100092020 Ga0068855_1000920202 499
32 3300025911 Ga0207654_10083004 Ga0207654_100830042 499
33 3300005330 Ga0070690_100049643 Ga0070690_1000496433 500
34 3300005335 Ga0070666_10006536 Ga0070666_100065369 500
35 3300005535 Ga0070684_100132792 Ga0070684_1001327922 500
36 3300005539 Ga0068853_100078550 Ga0068853_1000785502 500
37 3300005548 Ga0070665_100112162 Ga0070665_1001121623 500
38 3300005563 Ga0068855_100178210 Ga0068855_1001782102 500
39 3300005578 Ga0068854_100131134 Ga0068854_1001311341 500
40 3300005616 Ga0068852_100044147 Ga0068852_1000441475 500
41 3300005842 Ga0068858_100028088 Ga0068858_1000280887 500
42 3300009093 Ga0105240_10088320 Ga0105240_100883203 500
43 3300009098 Ga0105245_10139537 Ga0105245_101395372 500
44 3300009551 Ga0105238_10081893 Ga0105238_100818932 500
45 3300011119 Ga0105246_10046526 Ga0105246_100465262 500
46 3300013306 Ga0163162_10107122 Ga0163162_101071222 500
47 3300013307 Ga0157372_10028043 Ga0157372_100280435 500
48 3300014968 Ga0157379_10116166 Ga0157379_101161663 500
49 3300025913 Ga0207695_10143835 Ga0207695_101438352 500
50 3300025986 Ga0207658_10044215 Ga0207658_100442153 500
51 3300026041 Ga0207639_10053222 Ga0207639_100532222 500
52 3300049580 Ga0501046_0008029 Ga0501046_0008029_2747_4270 500
53 3300049581 Ga0501047_0000872 Ga0501047_0000872_429_1952 500
54 3300049823 Ga0501044_0082038 Ga0501044_0082038_1008_2531 500
55 3300006175 Ga0070712_100000314 Ga0070712_1000003144 502
56 3300014968 Ga0157379_10039617 Ga0157379_100396174 502
57 3300025915 Ga0207693_10000276 Ga0207693_1000027628 502
58 3300028577 Ga0265318_10000737 Ga0265318_1000073724 502
59 3300031241 Ga0265325_10028586 Ga0265325_100285862 502
60 3300031250 Ga0265331_10004777 Ga0265331_100047778 502
61 3300031595 Ga0265313_10000338 Ga0265313_1000033849 502
62 3300031595 Ga0265313_10000674 Ga0265313_100006744 502
63 3300031711 Ga0265314_10006102 Ga0265314_1000610215 502
64 3300031711 Ga0265314_10018417 Ga0265314_100184175 502
65 3300049822 Ga0501035_0117753 Ga0501035_0117753_630_2216 502
66 3300049823 Ga0501044_0027825 Ga0501044_0027825_2333_3904 502
67 3300021384 Ga0213876_10001741 Ga0213876_100017419 504
68 3300039437 Ga0436365_1373922 Ga0436365_1373922_22431_23981 504
69 3300048929 Ga0496126_0000653 Ga0496126_0000653_27899_29449 504
70 3300049570 Ga0501033_0036364 Ga0501033_0036364_1577_3118 504
71 3300049574 Ga0501038_0090967 Ga0501038_0090967_616_2178 504
72 3300049583 Ga0501067_0008086 Ga0501067_0008086_1597_3156 504
73 3300049588 Ga0501072_0000844 Ga0501072_0000844_18480_20039 504
74 3300049589 Ga0501073_0007445 Ga0501073_0007445_2350_3909 504
75 3300049822 Ga0501035_0011486 Ga0501035_0011486_5799_7340 504
76 3300049823 Ga0501044_0036651 Ga0501044_0036651_1221_2762 504
77 3300003320 rootH2_10080367 rootH2_100803671 505
78 3300005327 Ga0070658_10130496 Ga0070658_101304962 505
79 3300005336 Ga0070680_100001638 Ga0070680_1000016383 505
80 3300005367 Ga0070667_100054522 Ga0070667_1000545224 505
81 3300005548 Ga0070665_100022739 Ga0070665_1000227393 505
82 3300005548 Ga0070665_100111100 Ga0070665_1001111004 505
83 3300005841 Ga0068863_100040652 Ga0068863_1000406526 505
84 3300005937 Ga0081455_10125285 Ga0081455_101252852 505
85 3300009093 Ga0105240_10009397 Ga0105240_1000939715 505
86 3300009093 Ga0105240_10099183 Ga0105240_100991832 505
87 3300009177 Ga0105248_10011035 Ga0105248_100110355 505
88 3300009177 Ga0105248_10049921 Ga0105248_100499215 505
89 3300009545 Ga0105237_10015763 Ga0105237_100157639 505
90 3300010375 Ga0105239_10066929 Ga0105239_100669293 505
91 3300025903 Ga0207680_10001356 Ga0207680_1000135612 505
92 3300025913 Ga0207695_10007707 Ga0207695_100077073 505
93 3300025941 Ga0207711_10057119 Ga0207711_100571192 505
94 3300025949 Ga0207667_10053103 Ga0207667_100531034 505
95 3300026035 Ga0207703_10030840 Ga0207703_100308402 505
96 3300026116 Ga0207674_10150084 Ga0207674_101500842 505
97 3300028379 Ga0268266_10110088 Ga0268266_101100881 505
98 3300031249 Ga0265339_10010909 Ga0265339_100109095 505
99 3300046459 Ga0495629_0049687 Ga0495629_0049687_64_1761 505
100 3300046473 Ga0495582_0077235 Ga0495582_0077235_39_1736 505
101 3300046683 Ga0495658_0000382 Ga0495658_0000382_20014_21711 505
102 3300047315 Ga0495581_0023871 Ga0495581_0023871_1444_3141 505
103 3300049590 Ga0501074_0065895 Ga0501074_0065895_622_2181 505
104 3300003320 rootH2_10134171 rootH2_101341712 506
105 3300005328 Ga0070676_10005828 Ga0070676_100058286 506
106 3300005334 Ga0068869_100002394 Ga0068869_10000239411 506
107 3300005341 Ga0070691_10000062 Ga0070691_1000006211 506
108 3300005434 Ga0070709_10000238 Ga0070709_1000023823 506
109 3300005435 Ga0070714_100031614 Ga0070714_1000316142 506
110 3300005436 Ga0070713_100000011 Ga0070713_10000001165 506
111 3300005437 Ga0070710_10023381 Ga0070710_100233814 506
112 3300005439 Ga0070711_100007028 Ga0070711_1000070284 506
113 3300005439 Ga0070711_100088694 Ga0070711_1000886942 506
114 3300005548 Ga0070665_100091482 Ga0070665_1000914823 506
115 3300005563 Ga0068855_100014142 Ga0068855_1000141425 506
116 3300005577 Ga0068857_100038695 Ga0068857_1000386955 506
117 3300005616 Ga0068852_100011874 Ga0068852_1000118744 506
118 3300005842 Ga0068858_100007882 Ga0068858_1000078828 506
119 3300006173 Ga0070716_100013785 Ga0070716_1000137853 506
120 3300006175 Ga0070712_100000014 Ga0070712_10000001498 506
121 3300006871 Ga0075434_100076479 Ga0075434_1000764794 506
122 3300006914 Ga0075436_100000047 Ga0075436_10000004731 506
123 3300009093 Ga0105240_10000355 Ga0105240_1000035523 506
124 3300009093 Ga0105240_10028212 Ga0105240_1002821210 506
125 3300009093 Ga0105240_10033158 Ga0105240_100331582 506
126 3300009093 Ga0105240_10054379 Ga0105240_100543794 506
127 3300009093 Ga0105240_10215554 Ga0105240_102155542 506
128 3300009148 Ga0105243_10006780 Ga0105243_100067801 506
129 3300009174 Ga0105241_10008503 Ga0105241_100085031 506
130 3300009174 Ga0105241_10049572 Ga0105241_100495723 506
131 3300009545 Ga0105237_10014301 Ga0105237_100143013 506
132 3300009545 Ga0105237_10181053 Ga0105237_101810532 506
133 3300009545 Ga0105237_10201798 Ga0105237_102017982 506
134 3300009551 Ga0105238_10003708 Ga0105238_1000370810 506
135 3300009551 Ga0105238_10058739 Ga0105238_100587392 506
136 3300009551 Ga0105238_10065097 Ga0105238_100650972 506
137 3300009551 Ga0105238_10096614 Ga0105238_100966144 506
138 3300010375 Ga0105239_10004849 Ga0105239_100048496 506
139 3300010375 Ga0105239_10056381 Ga0105239_100563814 506
140 3300010375 Ga0105239_10092249 Ga0105239_100922494 506
141 3300013100 Ga0157373_10003426 Ga0157373_100034266 506
142 3300013105 Ga0157369_10018966 Ga0157369_100189666 506
143 3300014968 Ga0157379_10001288 Ga0157379_1000128820 506
144 3300014968 Ga0157379_10001360 Ga0157379_1000136020 506
145 3300014968 Ga0157379_10002345 Ga0157379_1000234511 506
146 3300025906 Ga0207699_10000233 Ga0207699_1000023320 506
147 3300025907 Ga0207645_10011026 Ga0207645_100110263 506
148 3300025911 Ga0207654_10012882 Ga0207654_100128824 506
149 3300025913 Ga0207695_10003622 Ga0207695_1000362212 506
150 3300025913 Ga0207695_10022595 Ga0207695_100225952 506
151 3300025914 Ga0207671_10025679 Ga0207671_100256794 506
152 3300025915 Ga0207693_10000018 Ga0207693_1000001851 506
153 3300025924 Ga0207694_10011277 Ga0207694_100112775 506
154 3300025928 Ga0207700_10000005 Ga0207700_1000000530 506
155 3300025929 Ga0207664_10001580 Ga0207664_100015805 506
156 3300025939 Ga0207665_10036940 Ga0207665_100369404 506
157 3300025949 Ga0207667_10002838 Ga0207667_1000283818 506
158 3300026035 Ga0207703_10110320 Ga0207703_101103202 506
159 3300026078 Ga0207702_10000680 Ga0207702_1000068030 506
160 3300026078 Ga0207702_10001080 Ga0207702_100010802 506
161 3300026089 Ga0207648_10009495 Ga0207648_100094954 506
162 3300026116 Ga0207674_10000112 Ga0207674_1000011255 506
163 3300026116 Ga0207674_10023077 Ga0207674_100230774 506
164 3300028379 Ga0268266_10122066 Ga0268266_101220661 506
165 3300028379 Ga0268266_10127698 Ga0268266_101276982 506
166 3300028800 Ga0265338_10000011 Ga0265338_10000011248 506
167 3300028800 Ga0265338_10008717 Ga0265338_1000871714 506
168 3300031241 Ga0265325_10000009 Ga0265325_10000009127 506
169 3300031241 Ga0265325_10000094 Ga0265325_1000009445 506
170 3300031247 Ga0265340_10000018 Ga0265340_1000001888 506
171 3300031247 Ga0265340_10006837 Ga0265340_100068374 506
172 3300031247 Ga0265340_10049217 Ga0265340_100492172 506
173 3300031249 Ga0265339_10000320 Ga0265339_1000032029 506
174 3300031249 Ga0265339_10004286 Ga0265339_100042864 506
175 3300031249 Ga0265339_10030259 Ga0265339_100302592 506
176 3300031344 Ga0265316_10002525 Ga0265316_1000252510 506
177 3300031344 Ga0265316_10020262 Ga0265316_100202624 506
178 3300031456 Ga0307513_10106503 Ga0307513_101065034 506
179 3300031595 Ga0265313_10001518 Ga0265313_1000151824 506
180 3300031595 Ga0265313_10003779 Ga0265313_1000377910 506
181 3300031595 Ga0265313_10017599 Ga0265313_100175994 506
182 3300031711 Ga0265314_10004118 Ga0265314_1000411812 506
183 3300031712 Ga0265342_10002218 Ga0265342_1000221813 506
184 3300031712 Ga0265342_10014464 Ga0265342_100144642 506
185 3300036401 Ga0373937_0119993 Ga0373937_0119993_291_1844 506
186 3300037312 Ga0395899_0021125 Ga0395899_0021125_305_1849 506
187 3300037418 Ga0395900_0054391 Ga0395900_0054391_1710_3254 506
188 3300037466 Ga0395898_0071456 Ga0395898_0071456_776_2320 506
189 3300038443 Ga0395901_0055241 Ga0395901_0055241_502_2046 506
190 3300046536 Ga0495587_0037907 Ga0495587_0037907_532_2085 506
191 3300046543 Ga0495645_0006785 Ga0495645_0006785_1022_2590 506
192 3300048088 Ga0495602_0061554 Ga0495602_0061554_981_2534 506
193 3300049572 Ga0501036_0015993 Ga0501036_0015993_1138_2706 506
194 3300049589 Ga0501073_0051649 Ga0501073_0051649_57_1625 506
195 3300049741 Ga0501079_0003964 Ga0501079_0003964_899_2461 506
196 3300049742 Ga0501080_0151570 Ga0501080_0151570_539_2107 506
197 3300049822 Ga0501035_0002619 Ga0501035_0002619_8875_10443 506
198 3300049823 Ga0501044_0022013 Ga0501044_0022013_3928_5496 506
199 3300050512 nmdc:mga0n895_47114_c1 nmdc:mga0n895_47114_c1_233_1786 506
200 3300050512 nmdc:mga0n895_90600_c1 nmdc:mga0n895_90600_c1_424_1977 506
201 3300050513 nmdc:mga0rr50_18568_c1 nmdc:mga0rr50_18568_c1_81_1634 506
202 3300050514 nmdc:mga08x19_62_c1 nmdc:mga08x19_62_c1_88693_90246 506
203 3300053119 Ga0500595_000824 Ga0500595_000824_6841_8406 506
204 3300053140 Ga0500573_0000032 Ga0500573_0000032_9086_10633 506
205 3300005327 Ga0070658_10008972 Ga0070658_100089724 507
206 3300005335 Ga0070666_10009849 Ga0070666_100098496 507
207 3300005339 Ga0070660_100023651 Ga0070660_1000236514 507
208 3300005548 Ga0070665_100020055 Ga0070665_1000200557 507
209 3300006237 Ga0097621_100001298 Ga0097621_1000012982 507
210 3300006358 Ga0068871_100000113 Ga0068871_1000001135 507
211 3300006358 Ga0068871_100028991 Ga0068871_1000289912 507
212 3300006358 Ga0068871_100033184 Ga0068871_1000331846 507
213 3300025903 Ga0207680_10008206 Ga0207680_100082064 507
214 3300025919 Ga0207657_10004729 Ga0207657_1000472914 507
215 3300028379 Ga0268266_10039690 Ga0268266_100396901 507
216 3300028379 Ga0268266_10082098 Ga0268266_100820981 507
217 3300031240 Ga0265320_10006535 Ga0265320_100065355 507
218 3300031241 Ga0265325_10005771 Ga0265325_100057716 507
219 3300049571 Ga0501034_0131680 Ga0501034_0131680_79_1650 507
220 3300049581 Ga0501047_0050156 Ga0501047_0050156_2235_3806 507
221 3300053119 Ga0500595_003775 Ga0500595_003775_866_2431 507
222 3300053730 Ga0500645_008850 Ga0500645_008850_839_2389 507
223 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035199 508
224 3300003215 JGI25153J46596_10001002 JGI25153J46596_1000100216 508
225 3300005535 Ga0070684_100017035 Ga0070684_1000170353 508
226 3300005539 Ga0068853_100071301 Ga0068853_1000713014 508
227 3300005563 Ga0068855_100034763 Ga0068855_1000347635 508
228 3300005842 Ga0068858_100019360 Ga0068858_1000193604 508
229 3300009093 Ga0105240_10040460 Ga0105240_100404603 508
230 3300009545 Ga0105237_10232358 Ga0105237_102323582 508
231 3300013105 Ga0157369_10097715 Ga0157369_100977152 508
232 3300025261 Ga0209233_1000006 Ga0209233_1000006693 508
233 3300025261 Ga0209233_1002157 Ga0209233_100215710 508
234 3300025297 Ga0209758_1000008 Ga0209758_1000008241 508
235 3300026041 Ga0207639_10080620 Ga0207639_100806203 508
236 3300026116 Ga0207674_10129515 Ga0207674_101295153 508
237 3300049570 Ga0501033_0019126 Ga0501033_0019126_2942_4531 508
238 3300049581 Ga0501047_0017890 Ga0501047_0017890_2667_4250 508
239 3300049742 Ga0501080_0030727 Ga0501080_0030727_3326_4921 508
240 3300049822 Ga0501035_0040845 Ga0501035_0040845_2118_3707 508
241 3300049823 Ga0501044_0021522 Ga0501044_0021522_1386_2975 508
242 3300053087 Ga0500643_000027 Ga0500643_000027_85957_87510 508
243 3300053096 Ga0500641_0005383 Ga0500641_0005383_2536_4089 508

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

268

520

0.83

PF20154

LNT_N

Apolipoprotein N-acyltransferase N-terminal domain

69

222

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n6l-assembly2.cif.gz_B structure of the membrane integral lipoprotein n-acyltransferase lnt c387a mutant from e. coli 0.8881 15 506
5vrh-assembly1.cif.gz_A apolipoprotein n-acyltransferase c387s active site mutant 0.8867 15 506
5n6h-assembly1.cif.gz_A structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli 0.884 15 506
7aci-assembly1.cif.gz_A in meso structure of apolipoprotein n-acyltransferase, lnt, from escherichia coli in 9.8 monoacylglycerol 0.8823 15 506
5vrg-assembly1.cif.gz_A structural insights into lipoprotein n-acylation by escherichia coli apolipoprotein n-acyltransferase 0.8813 15 506
ID Description Score Start End Superfamily
af_P23930_215_482_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9007 229 481 3.60.110.10
af_P23930_215_482_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8501 229 481 3.60.110.10
af_O53493_232_506_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8104 220 479 3.60.110.10
af_O53493_232_506_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7673 220 479 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7417 229 474 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A354U0S1-F1-model_v4 deleted 0.9681 2 190
AF-A0A3B0S9W0-F1-model_v4 Apolipoprotein N-acyltransferase / Copper homeostasis protein CutE 0.9612 2 508 GO:0005886
GO:0016410
GO:0042158
AF-A0A160U2R2-F1-model_v4 deleted 0.9585 2 508
AF-A0A353YC07-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9582 2 507 GO:0005886
GO:0016410
GO:0042158
AF-A0A7X3MRF8-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9577 4 507 GO:0005886
GO:0016410
GO:0042158

Feature Viewer

pLDDT pTM Quality
90.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map