F355278

General Info

Members Datasets Scaffolds Average Seq Length
243 143 238 263

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000008|Ga0070658_10000008305
Length 274
Sequence MSLLLAIMKPEEFYHQFHIWLVANGQNYIFGVLVFIAGFLAIRFIKMRLRARMARQQVHSSLRPFFQSLTITGLYVLLILSVFKIIGFELTVFSTIIGAFSVAAGLALSGTFQNFAGGVLILLLKPFELNDNIVAQGQDGIVTSIQLFYTVLRTFDNRTIIIPNGKLFNEVIVNVTREGKRRVDFELKLGYIVDVDQVKGIIDNAIKATPHIIHKPAPLVGVIALEIDGIKFTVRVWTKADDYLDIKIALQERIVKDLRNADVKLPTHHLLPGT

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
140 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
143 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0.82
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 0
Rhizoplane 0.41
Rhizosphere 82.72
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013665 3300001989 Bacteria 2960
2 JGI24737J22298_10007477 3300001990 Bacteria 3687
3 JGI24735J21928_10000007 3300002067 Bacteria 333510
4 JGI25162J39368_1000016 3300002737 Bacteria 288734
5 JGI25162J39368_1004944 3300002737 Bacteria 2831
6 JGI25164J39214_1001942 3300002772 Bacteria 3793
7 JGI25165J46597_1000426 3300003214 Bacteria 43457
8 rootH1_10065981 3300003316 Bacteria 3729
9 rootH2_10002517 3300003320 Bacteria 2467
10 rootH2_10062482 3300003320 Bacteria 1820
11 rootH2_10144980 3300003320 Bacteria 2378
12 rootH2_10223023 3300003320 Bacteria 1275
13 rootH2_10301812 3300003320 Bacteria 1261
14 rootL2_10156444 3300003322 Bacteria 8320
15 rootH1_10050749 3300003323 Bacteria 18676
16 rootH1_10216290 3300003323 Bacteria 3065
17 rootH1_10220125 3300003323 Bacteria 1326
18 rootH1_10220126 3300003323 Bacteria 1201
19 Ga0065714_10191731 3300005288 Unclassified 925
20 Ga0070658_10000008 3300005327 Bacteria 319912
21 Ga0070658_10012179 3300005327 Bacteria 6904
22 Ga0070676_10000065 3300005328 Bacteria 35089
23 Ga0070683_100005282 3300005329 Bacteria 10755
24 Ga0070680_100007953 3300005336 Bacteria 8093
25 Ga0068868_100064413 3300005338 Bacteria 2909
26 Ga0070660_100121324 3300005339 Bacteria 2086
27 Ga0070660_100308544 3300005339 Bacteria 1298
28 Ga0070673_100012207 3300005364 Bacteria 5891
29 Ga0070688_100194672 3300005365 Bacteria 1414
30 Ga0070659_100594786 3300005366 Bacteria 950
31 Ga0070663_100002213 3300005455 Bacteria 10879
32 Ga0070678_100124205 3300005456 Bacteria 2040
33 Ga0070662_100000389 3300005457 Bacteria 26186
34 Ga0070681_10071653 3300005458 Bacteria 3430
35 Ga0068867_100002558 3300005459 Bacteria 12824
36 Ga0070679_100028154 3300005530 Bacteria 5538
37 Ga0068853_100075193 3300005539 Bacteria 2948
38 Ga0070665_100000061 3300005548 Bacteria 222138
39 Ga0068855_100004951 3300005563 Bacteria 16243
40 Ga0068855_100393741 3300005563 Bacteria 1519
41 Ga0068855_100396216 3300005563 Bacteria 1514
42 Ga0068857_100174627 3300005577 Bacteria 1954
43 Ga0068854_100015039 3300005578 Bacteria 5116
44 Ga0068856_100000668 3300005614 Bacteria 37241
45 Ga0068856_100049127 3300005614 Bacteria 4158
46 Ga0068856_100112317 3300005614 Bacteria 2722
47 Ga0068856_100121703 3300005614 Bacteria 2611
48 Ga0068852_100005051 3300005616 Bacteria 9387
49 Ga0068870_10120221 3300005840 Bacteria 1512
50 Ga0068860_100465555 3300005843 Bacteria 1258
51 Ga0097621_100000016 3300006237 Bacteria 91785
52 Ga0068871_100000494 3300006358 Bacteria 26958
53 Ga0068865_100000063 3300006881 Bacteria 56994
54 Ga0105240_10000082 3300009093 Bacteria 195184
55 Ga0105240_10006072 3300009093 Bacteria 17838
56 Ga0105240_10012288 3300009093 Bacteria 11832
57 Ga0105240_10204915 3300009093 Bacteria 2309
58 Ga0105240_10267581 3300009093 Bacteria 1969
59 Ga0105240_10291801 3300009093 Bacteria 1869
60 Ga0105240_10395688 3300009093 Bacteria 1557
61 Ga0105241_10002710 3300009174 Bacteria 13277
62 Ga0105241_10057888 3300009174 Bacteria 2975
63 Ga0105241_10095444 3300009174 Bacteria 2354
64 Ga0105241_10203510 3300009174 Bacteria 1655
65 Ga0105242_10069975 3300009176 Bacteria 2908
66 Ga0105237_10000801 3300009545 Bacteria 42937
67 Ga0105237_10001478 3300009545 Bacteria 30966
68 Ga0105237_10001495 3300009545 Bacteria 30789
69 Ga0105237_10050332 3300009545 Bacteria 4186
70 Ga0105237_10056542 3300009545 Bacteria 3927
71 Ga0105237_10382594 3300009545 Bacteria 1412
72 Ga0105238_10045849 3300009551 Bacteria 4416
73 Ga0105239_10000049 3300010375 Bacteria 177578
74 Ga0105239_10002742 3300010375 Bacteria 22124
75 Ga0105239_10003605 3300010375 Bacteria 18919
76 Ga0105239_10156199 3300010375 Bacteria 2547
77 Ga0105239_10279154 3300010375 Bacteria 1880
78 Ga0157373_10000271 3300013100 Bacteria 41646
79 Ga0157373_10032042 3300013100 Bacteria 3784
80 Ga0157373_10053681 3300013100 Bacteria 2865
81 Ga0157371_10002522 3300013102 Bacteria 17403
82 Ga0157370_10042792 3300013104 Bacteria 4362
83 Ga0157370_10075501 3300013104 Bacteria 3177
84 Ga0157369_10001079 3300013105 Bacteria 34142
85 Ga0157369_10176909 3300013105 Bacteria 2246
86 Ga0157374_10003346 3300013296 Bacteria 13464
87 Ga0157374_10350419 3300013296 Bacteria 1467
88 Ga0157374_10378955 3300013296 Bacteria 1409
89 Ga0157374_10728339 3300013296 Bacteria 1006
90 Ga0157378_10013502 3300013297 Bacteria 7143
91 Ga0157378_10214927 3300013297 Bacteria 1825
92 Ga0163162_10000012 3300013306 Bacteria 292674
93 Ga0163162_10256935 3300013306 Bacteria 1879
94 Ga0157372_10000039 3300013307 Bacteria 165839
95 Ga0157372_10000241 3300013307 Bacteria 60488
96 Ga0157372_10001854 3300013307 Bacteria 22916
97 Ga0157372_10015511 3300013307 Bacteria 8169
98 Ga0157372_10338308 3300013307 Bacteria 1753
99 Ga0157372_10504996 3300013307 Unclassified 1410
100 Ga0157375_10014001 3300013308 Bacteria 7153
101 Ga0157375_10446246 3300013308 Bacteria 1459
102 Ga0157376_10165330 3300014969 Bacteria 2010
103 Ga0163161_10057199 3300017792 Bacteria 2833
104 Ga0154015_1564482 3300020610 Bacteria 1023
105 Ga0224712_10170353 3300022467 Bacteria 976
106 Ga0207427_100204 3300025231 Bacteria 54529
107 Ga0209437_100048 3300025233 Bacteria 405107
108 Ga0209437_100119 3300025233 Bacteria 206549
109 Ga0209233_1000029 3300025261 Bacteria 641642
110 Ga0209233_1001300 3300025261 Bacteria 9976
111 Ga0209233_1001404 3300025261 Bacteria 9519
112 Ga0207647_10000572 3300025904 Bacteria 28706
113 Ga0207647_10047468 3300025904 Bacteria 2671
114 Ga0207645_10000289 3300025907 Bacteria 42106
115 Ga0207705_10000035 3300025909 Bacteria 201649
116 Ga0207705_10128737 3300025909 Bacteria 1883
117 Ga0207654_10029822 3300025911 Bacteria 2990
118 Ga0207654_10280479 3300025911 Bacteria 1127
119 Ga0207707_10287350 3300025912 Bacteria 1423
120 Ga0207695_10000053 3300025913 Bacteria 396740
121 Ga0207695_10020433 3300025913 Bacteria 7584
122 Ga0207695_10021485 3300025913 Bacteria 7362
123 Ga0207695_10050585 3300025913 Bacteria 4369
124 Ga0207695_10207965 3300025913 Bacteria 1869
125 Ga0207695_10523829 3300025913 Bacteria 1067
126 Ga0207671_10001012 3300025914 Bacteria 34397
127 Ga0207671_10001124 3300025914 Bacteria 32186
128 Ga0207671_10007390 3300025914 Bacteria 9541
129 Ga0207671_10009740 3300025914 Bacteria 7997
130 Ga0207671_10029705 3300025914 Bacteria 4080
131 Ga0207671_10233474 3300025914 Bacteria 1443
132 Ga0207660_10003999 3300025917 Bacteria 9609
133 Ga0207657_10256402 3300025919 Bacteria 1393
134 Ga0207657_10329149 3300025919 Bacteria 1207
135 Ga0207652_10008964 3300025921 Bacteria 8062
136 Ga0207694_10110600 3300025924 Bacteria 2185
137 Ga0207644_10051440 3300025931 Bacteria 2957
138 Ga0207690_10008864 3300025932 Bacteria 5970
139 Ga0207706_10000013 3300025933 Bacteria 188236
140 Ga0207686_10039775 3300025934 Bacteria 2855
141 Ga0207704_10000180 3300025938 Bacteria 33319
142 Ga0207661_10050947 3300025944 Bacteria 3301
143 Ga0207667_10000039 3300025949 Bacteria 278843
144 Ga0207667_10131020 3300025949 Bacteria 2583
145 Ga0207667_10848862 3300025949 Bacteria 907
146 Ga0207651_10006270 3300025960 Bacteria 6202
147 Ga0207640_10013216 3300025981 Bacteria 4726
148 Ga0207677_10124020 3300026023 Bacteria 1949
149 Ga0207639_10008565 3300026041 Bacteria 7020
150 Ga0207639_10046094 3300026041 Bacteria 3288
151 Ga0207639_10099715 3300026041 Bacteria 2344
152 Ga0207639_10162106 3300026041 Bacteria 1885
153 Ga0207678_10063496 3300026067 Bacteria 3173
154 Ga0207702_10000861 3300026078 Bacteria 31674
155 Ga0207702_10070845 3300026078 Bacteria 2999
156 Ga0207702_10198174 3300026078 Bacteria 1860
157 Ga0207702_10393780 3300026078 Bacteria 1334
158 Ga0207648_10000081 3300026089 Bacteria 90676
159 Ga0207674_10308593 3300026116 Bacteria 1531
160 Ga0207683_10021139 3300026121 Bacteria 5569
161 Ga0207698_10009413 3300026142 Bacteria 6230
162 Ga0268266_10000053 3300028379 Bacteria 295181
163 Ga0307517_10000447 3300028786 Bacteria 70799
164 Ga0307515_10000747 3300028794 Bacteria 75231
165 Ga0307515_10012758 3300028794 Bacteria 15776
166 Ga0307515_10306009 3300028794 Bacteria 1269
167 Ga0265338_10240123 3300028800 Bacteria 1342
168 Ga0307509_10090113 3300031507 Bacteria 3143
169 Ga0307507_10002469 3300033179 Bacteria 38697
170 Ga0307510_10060386 3300033180 Bacteria 3902
171 Ga0373941_0003155 3300035115 Bacteria 3704
172 Ga0316582_0075947 3300036647 Bacteria 2184
173 Ga0395899_0000027 3300037312 Bacteria 337387
174 Ga0395899_0019998 3300037312 Bacteria 5080
175 Ga0395899_0064925 3300037312 Bacteria 2683
176 Ga0395899_0094204 3300037312 Bacteria 2167
177 Ga0395900_0002655 3300037418 Bacteria 19541
178 Ga0395900_0002728 3300037418 Bacteria 19289
179 Ga0395900_0007947 3300037418 Bacteria 10918
180 Ga0395900_0248306 3300037418 Bacteria 1782
181 Ga0395898_0018665 3300037466 Bacteria 7070
182 Ga0395898_0234600 3300037466 Unclassified 1750
183 Ga0395905_0001588 3300037471 Bacteria 27060
184 Ga0395905_0006592 3300037471 Bacteria 11652
185 Ga0395905_0414766 3300037471 Bacteria 1242
186 Ga0395901_0000565 3300038443 Bacteria 42982
187 Ga0395901_0016976 3300038443 Bacteria 7419
188 Ga0395901_0025856 3300038443 Bacteria 6028
189 Ga0436361_1026784 3300039447 Bacteria 12771
190 Ga0439448_0042268 3300042005 Bacteria 1477
191 Ga0466966_0002402 3300044684 Bacteria 12225
192 Ga0466958_0004917 3300045836 Bacteria 7124
193 Ga0495638_0209671 3300046460 Bacteria 1095
194 Ga0495650_0000081 3300046471 Bacteria 240957
195 Ga0495585_0000036 3300046492 Bacteria 135914
196 Ga0495585_0000969 3300046492 Bacteria 24117
197 Ga0495585_0275386 3300046492 Unclassified 833
198 Ga0495583_0012671 3300046506 Bacteria 4753
199 Ga0495606_0000034 3300046507 Bacteria 247705
200 Ga0495606_0007210 3300046507 Bacteria 10022
201 Ga0495606_0021571 3300046507 Bacteria 4717
202 Ga0495610_0011094 3300046512 Bacteria 5534
203 Ga0495616_0008122 3300046513 Bacteria 6241
204 Ga0495631_0094025 3300046518 Bacteria 1290
205 Ga0495637_0030045 3300046520 Bacteria 2413
206 Ga0495637_0080492 3300046520 Bacteria 1299
207 Ga0495644_0035808 3300046523 Bacteria 1873
208 Ga0495648_0004623 3300046524 Bacteria 11699
209 Ga0495609_0011395 3300046538 Bacteria 4236
210 Ga0495609_0078083 3300046538 Bacteria 1449
211 Ga0495633_0000157 3300046558 Bacteria 89236
212 Ga0495633_0009366 3300046558 Bacteria 5415
213 Ga0495668_0000086 3300046616 Bacteria 151960
214 Ga0495625_0000049 3300046660 Bacteria 197646
215 Ga0495625_0001164 3300046660 Bacteria 33874
216 Ga0495625_0001797 3300046660 Bacteria 24645
217 Ga0495625_0020849 3300046660 Bacteria 5053
218 Ga0495625_0113387 3300046660 Bacteria 1851
219 Ga0495658_0007122 3300046683 Bacteria 5526
220 Ga0495669_0082419 3300046684 Bacteria 1478
221 Ga0495660_0001981 3300046810 Bacteria 13342
222 Ga0495683_0013589 3300047323 Bacteria 4255
223 Ga0495683_0118857 3300047323 Bacteria 1256
224 Ga0495687_015003 3300047443 Bacteria 3956
225 Ga0495686_0001878 3300047472 Bacteria 21010
226 Ga0495686_0204407 3300047472 Bacteria 1131
227 Ga0496126_0243295 3300048929 Bacteria 1502
228 Ga0495682_0018109 3300049460 Bacteria 2653
229 nmdc:mga0k408_193039_c1 3300050493 Bacteria 1215
230 nmdc:mga0k408_475_c1 3300050493 Bacteria 21995
231 nmdc:mga07m45_281381_c1 3300050496 Bacteria 967
232 Ga0500635_0001483 3300053080 Bacteria 5644
233 Ga0500618_000202 3300053125 Bacteria 47506
234 Ga0500642_0165348 3300053130 Bacteria 1036
235 Ga0500579_150999 3300053143 Unclassified 1013
236 Ga0500616_0211442 3300053153 Bacteria 852
237 Ga0500624_000472 3300053157 Bacteria 11992
238 Ga0500634_0022680 3300053161 Bacteria 3409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10203510 Ga0105241_102035102 202
2 3300009545 Ga0105237_10001478 Ga0105237_1000147819 202
3 3300037312 Ga0395899_0064925 Ga0395899_0064925_48_716 202
4 3300048929 Ga0496126_0243295 Ga0496126_0243295_763_1431 202
5 3300053153 Ga0500616_0211442 Ga0500616_0211442_66_731 205
6 3300009093 Ga0105240_10291801 Ga0105240_102918012 206
7 3300035115 Ga0373941_0003155 Ga0373941_0003155_2908_3588 206
8 3300046492 Ga0495585_0275386 Ga0495585_0275386_78_764 208
9 3300005288 Ga0065714_10191731 Ga0065714_101917311 230
10 3300013104 Ga0157370_10075501 Ga0157370_100755013 231
11 3300039447 Ga0436361_1026784 Ga0436361_1026784_320_1123 231
12 3300047472 Ga0495686_0204407 Ga0495686_0204407_125_871 232
13 3300005329 Ga0070683_100005282 Ga0070683_1000052825 233
14 3300013100 Ga0157373_10000271 Ga0157373_1000027129 233
15 3300013307 Ga0157372_10001854 Ga0157372_1000185415 233
16 3300025944 Ga0207661_10050947 Ga0207661_100509473 233
17 3300037312 Ga0395899_0000027 Ga0395899_0000027_232439_233239 235
18 3300013307 Ga0157372_10338308 Ga0157372_103383082 237
19 3300001990 JGI24737J22298_10007477 JGI24737J22298_100074774 239
20 3300005339 Ga0070660_100308544 Ga0070660_1003085442 239
21 3300005563 Ga0068855_100393741 Ga0068855_1003937412 239
22 3300005577 Ga0068857_100174627 Ga0068857_1001746273 239
23 3300013100 Ga0157373_10032042 Ga0157373_100320422 239
24 3300013307 Ga0157372_10000241 Ga0157372_100002412 239
25 3300025261 Ga0209233_1001404 Ga0209233_10014041 239
26 3300025904 Ga0207647_10000572 Ga0207647_1000057211 239
27 3300025919 Ga0207657_10329149 Ga0207657_103291491 239
28 3300025932 Ga0207690_10008864 Ga0207690_100088644 239
29 3300026116 Ga0207674_10308593 Ga0207674_103085931 239
30 3300037471 Ga0395905_0414766 Ga0395905_0414766_73_858 239
31 3300038443 Ga0395901_0016976 Ga0395901_0016976_4780_5565 239
32 3300047443 Ga0495687_015003 Ga0495687_015003_2839_3630 240
33 iso_pu_bacteria 2919437846 2919440577 242
34 iso_pu_bacteria 2599185184 2599479796 243
35 iso_pu_bacteria 2928078545 2928084110 243
36 iso_pu_bacteria 2928147474 2928153074 243
37 iso_pu_bacteria 2932082852 2932086981 243
38 3300003320 rootH2_10223023 rootH2_102230231 245
39 3300005455 Ga0070663_100002213 Ga0070663_10000221311 245
40 3300010375 Ga0105239_10000049 Ga0105239_1000004960 245
41 3300013102 Ga0157371_10002522 Ga0157371_100025223 245
42 3300013104 Ga0157370_10042792 Ga0157370_100427922 245
43 3300013105 Ga0157369_10001079 Ga0157369_100010793 245
44 3300013307 Ga0157372_10000039 Ga0157372_10000039120 245
45 3300020610 Ga0154015_1564482 Ga0154015_15644821 245
46 3300025261 Ga0209233_1001300 Ga0209233_10013005 245
47 3300025913 Ga0207695_10207965 Ga0207695_102079652 245
48 3300026067 Ga0207678_10063496 Ga0207678_100634962 245
49 3300028794 Ga0307515_10306009 Ga0307515_103060092 245
50 3300037312 Ga0395899_0094204 Ga0395899_0094204_1150_1950 245
51 3300037418 Ga0395900_0248306 Ga0395900_0248306_814_1614 245
52 3300044684 Ga0466966_0002402 Ga0466966_0002402_8801_9601 245
53 3300045836 Ga0466958_0004917 Ga0466958_0004917_3329_4129 245
54 3300046523 Ga0495644_0035808 Ga0495644_0035808_506_1291 245
55 3300046684 Ga0495669_0082419 Ga0495669_0082419_194_979 245
56 3300050493 nmdc:mga0k408_193039_c1 nmdc:mga0k408_193039_c1_50_850 245
57 3300053080 Ga0500635_0001483 Ga0500635_0001483_281_1081 245
58 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016235 246
59 3300002737 JGI25162J39368_1004944 JGI25162J39368_10049442 246
60 3300002772 JGI25164J39214_1001942 JGI25164J39214_10019421 246
61 3300003214 JGI25165J46597_1000426 JGI25165J46597_100042637 246
62 3300003320 rootH2_10002517 rootH2_100025172 246
63 3300003320 rootH2_10144980 rootH2_101449801 246
64 3300003320 rootH2_10301812 rootH2_103018121 246
65 3300003323 rootH1_10050749 rootH1_100507492 246
66 3300005327 Ga0070658_10012179 Ga0070658_100121795 246
67 3300005336 Ga0070680_100007953 Ga0070680_1000079535 246
68 3300005458 Ga0070681_10071653 Ga0070681_100716531 246
69 3300005530 Ga0070679_100028154 Ga0070679_1000281546 246
70 3300005539 Ga0068853_100075193 Ga0068853_1000751932 246
71 3300005563 Ga0068855_100396216 Ga0068855_1003962162 246
72 3300005578 Ga0068854_100015039 Ga0068854_1000150394 246
73 3300005614 Ga0068856_100049127 Ga0068856_1000491272 246
74 3300005614 Ga0068856_100112317 Ga0068856_1001123174 246
75 3300005614 Ga0068856_100121703 Ga0068856_1001217032 246
76 3300009093 Ga0105240_10000082 Ga0105240_10000082112 246
77 3300009093 Ga0105240_10204915 Ga0105240_102049151 246
78 3300009093 Ga0105240_10267581 Ga0105240_102675812 246
79 3300009093 Ga0105240_10395688 Ga0105240_103956882 246
80 3300009174 Ga0105241_10095444 Ga0105241_100954442 246
81 3300009545 Ga0105237_10000801 Ga0105237_1000080147 246
82 3300009545 Ga0105237_10050332 Ga0105237_100503324 246
83 3300009545 Ga0105237_10056542 Ga0105237_100565423 246
84 3300010375 Ga0105239_10002742 Ga0105239_1000274220 246
85 3300010375 Ga0105239_10003605 Ga0105239_1000360512 246
86 3300013296 Ga0157374_10728339 Ga0157374_107283392 246
87 3300013306 Ga0163162_10256935 Ga0163162_102569351 246
88 3300017792 Ga0163161_10057199 Ga0163161_100571991 246
89 3300025231 Ga0207427_100204 Ga0207427_10020413 246
90 3300025233 Ga0209437_100048 Ga0209437_100048335 246
91 3300025233 Ga0209437_100119 Ga0209437_100119151 246
92 3300025261 Ga0209233_1000029 Ga0209233_100002941 246
93 3300025909 Ga0207705_10128737 Ga0207705_101287371 246
94 3300025912 Ga0207707_10287350 Ga0207707_102873502 246
95 3300025913 Ga0207695_10000053 Ga0207695_10000053239 246
96 3300025913 Ga0207695_10050585 Ga0207695_100505853 246
97 3300025913 Ga0207695_10523829 Ga0207695_105238291 246
98 3300025914 Ga0207671_10001124 Ga0207671_1000112413 246
99 3300025914 Ga0207671_10007390 Ga0207671_100073903 246
100 3300025914 Ga0207671_10029705 Ga0207671_100297053 246
101 3300025917 Ga0207660_10003999 Ga0207660_100039997 246
102 3300025921 Ga0207652_10008964 Ga0207652_100089648 246
103 3300025949 Ga0207667_10000039 Ga0207667_1000003966 246
104 3300025949 Ga0207667_10131020 Ga0207667_101310201 246
105 3300025981 Ga0207640_10013216 Ga0207640_100132162 246
106 3300026041 Ga0207639_10099715 Ga0207639_100997152 246
107 3300026078 Ga0207702_10198174 Ga0207702_101981742 246
108 3300028794 Ga0307515_10000747 Ga0307515_1000074728 246
109 3300028794 Ga0307515_10012758 Ga0307515_1001275815 246
110 3300028800 Ga0265338_10240123 Ga0265338_102401231 246
111 3300031507 Ga0307509_10090113 Ga0307509_100901131 246
112 3300033179 Ga0307507_10002469 Ga0307507_1000246914 246
113 3300046492 Ga0495585_0000969 Ga0495585_0000969_16584_17372 246
114 3300046507 Ga0495606_0007210 Ga0495606_0007210_2920_3726 246
115 3300046524 Ga0495648_0004623 Ga0495648_0004623_9826_10614 246
116 3300046538 Ga0495609_0011395 Ga0495609_0011395_2812_3600 246
117 3300046558 Ga0495633_0000157 Ga0495633_0000157_38772_39560 246
118 3300046616 Ga0495668_0000086 Ga0495668_0000086_129793_130581 246
119 3300046660 Ga0495625_0001164 Ga0495625_0001164_14032_14820 246
120 3300046660 Ga0495625_0001797 Ga0495625_0001797_2357_3145 246
121 3300046660 Ga0495625_0020849 Ga0495625_0020849_1456_2244 246
122 3300046660 Ga0495625_0113387 Ga0495625_0113387_772_1578 246
123 3300046683 Ga0495658_0007122 Ga0495658_0007122_222_1010 246
124 3300047472 Ga0495686_0001878 Ga0495686_0001878_2378_3184 246
125 3300049460 Ga0495682_0018109 Ga0495682_0018109_854_1642 246
126 3300050493 nmdc:mga0k408_475_c1 nmdc:mga0k408_475_c1_17160_17948 246
127 3300053125 Ga0500618_000202 Ga0500618_000202_6956_7762 246
128 3300053143 Ga0500579_150999 Ga0500579_150999_32_838 246
129 3300053157 Ga0500624_000472 Ga0500624_000472_1424_2212 246
130 3300053161 Ga0500634_0022680 Ga0500634_0022680_2362_3150 246
131 3300001989 JGI24739J22299_10013665 JGI24739J22299_100136653 247
132 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007166 247
133 3300003316 rootH1_10065981 rootH1_100659813 247
134 3300003320 rootH2_10062482 rootH2_100624823 247
135 3300003322 rootL2_10156444 rootL2_101564441 247
136 3300003323 rootH1_10216290 rootH1_102162903 247
137 3300003323 rootH1_10220125 rootH1_102201251 247
138 3300003323 rootH1_10220126 rootH1_102201261 247
139 3300005327 Ga0070658_10000008 Ga0070658_10000008305 247
140 3300005328 Ga0070676_10000065 Ga0070676_1000006515 247
141 3300005338 Ga0068868_100064413 Ga0068868_1000644132 247
142 3300005339 Ga0070660_100121324 Ga0070660_1001213242 247
143 3300005364 Ga0070673_100012207 Ga0070673_1000122075 247
144 3300005365 Ga0070688_100194672 Ga0070688_1001946722 247
145 3300005366 Ga0070659_100594786 Ga0070659_1005947861 247
146 3300005456 Ga0070678_100124205 Ga0070678_1001242052 247
147 3300005457 Ga0070662_100000389 Ga0070662_10000038924 247
148 3300005459 Ga0068867_100002558 Ga0068867_1000025582 247
149 3300005548 Ga0070665_100000061 Ga0070665_100000061103 247
150 3300005563 Ga0068855_100004951 Ga0068855_1000049511 247
151 3300005614 Ga0068856_100000668 Ga0068856_10000066819 247
152 3300005616 Ga0068852_100005051 Ga0068852_1000050511 247
153 3300005840 Ga0068870_10120221 Ga0068870_101202211 247
154 3300005843 Ga0068860_100465555 Ga0068860_1004655551 247
155 3300006237 Ga0097621_100000016 Ga0097621_10000001616 247
156 3300006358 Ga0068871_100000494 Ga0068871_1000004947 247
157 3300006881 Ga0068865_100000063 Ga0068865_10000006335 247
158 3300009093 Ga0105240_10006072 Ga0105240_100060725 247
159 3300009093 Ga0105240_10012288 Ga0105240_1001228814 247
160 3300009174 Ga0105241_10002710 Ga0105241_1000271011 247
161 3300009174 Ga0105241_10057888 Ga0105241_100578882 247
162 3300009176 Ga0105242_10069975 Ga0105242_100699751 247
163 3300009545 Ga0105237_10001495 Ga0105237_1000149511 247
164 3300009545 Ga0105237_10382594 Ga0105237_103825941 247
165 3300009551 Ga0105238_10045849 Ga0105238_100458492 247
166 3300010375 Ga0105239_10156199 Ga0105239_101561992 247
167 3300010375 Ga0105239_10279154 Ga0105239_102791541 247
168 3300013100 Ga0157373_10053681 Ga0157373_100536811 247
169 3300013105 Ga0157369_10176909 Ga0157369_101769092 247
170 3300013296 Ga0157374_10003346 Ga0157374_1000334611 247
171 3300013296 Ga0157374_10350419 Ga0157374_103504192 247
172 3300013296 Ga0157374_10378955 Ga0157374_103789551 247
173 3300013297 Ga0157378_10013502 Ga0157378_100135025 247
174 3300013297 Ga0157378_10214927 Ga0157378_102149272 247
175 3300013306 Ga0163162_10000012 Ga0163162_10000012259 247
176 3300013307 Ga0157372_10015511 Ga0157372_100155112 247
177 3300013307 Ga0157372_10504996 Ga0157372_105049962 247
178 3300013308 Ga0157375_10014001 Ga0157375_100140013 247
179 3300013308 Ga0157375_10446246 Ga0157375_104462462 247
180 3300014969 Ga0157376_10165330 Ga0157376_101653302 247
181 3300022467 Ga0224712_10170353 Ga0224712_101703532 247
182 3300025904 Ga0207647_10047468 Ga0207647_100474681 247
183 3300025907 Ga0207645_10000289 Ga0207645_100002894 247
184 3300025909 Ga0207705_10000035 Ga0207705_1000003547 247
185 3300025911 Ga0207654_10029822 Ga0207654_100298222 247
186 3300025911 Ga0207654_10280479 Ga0207654_102804791 247
187 3300025913 Ga0207695_10020433 Ga0207695_100204332 247
188 3300025913 Ga0207695_10021485 Ga0207695_100214856 247
189 3300025914 Ga0207671_10001012 Ga0207671_1000101212 247
190 3300025914 Ga0207671_10009740 Ga0207671_100097402 247
191 3300025914 Ga0207671_10233474 Ga0207671_102334742 247
192 3300025919 Ga0207657_10256402 Ga0207657_102564023 247
193 3300025924 Ga0207694_10110600 Ga0207694_101106002 247
194 3300025931 Ga0207644_10051440 Ga0207644_100514404 247
195 3300025933 Ga0207706_10000013 Ga0207706_10000013113 247
196 3300025934 Ga0207686_10039775 Ga0207686_100397751 247
197 3300025938 Ga0207704_10000180 Ga0207704_1000018029 247
198 3300025949 Ga0207667_10848862 Ga0207667_108488621 247
199 3300025960 Ga0207651_10006270 Ga0207651_100062702 247
200 3300026023 Ga0207677_10124020 Ga0207677_101240202 247
201 3300026041 Ga0207639_10008565 Ga0207639_100085654 247
202 3300026041 Ga0207639_10046094 Ga0207639_100460943 247
203 3300026041 Ga0207639_10162106 Ga0207639_101621062 247
204 3300026078 Ga0207702_10000861 Ga0207702_1000086131 247
205 3300026078 Ga0207702_10070845 Ga0207702_100708452 247
206 3300026078 Ga0207702_10393780 Ga0207702_103937802 247
207 3300026089 Ga0207648_10000081 Ga0207648_1000008137 247
208 3300026121 Ga0207683_10021139 Ga0207683_100211393 247
209 3300026142 Ga0207698_10009413 Ga0207698_100094131 247
210 3300028379 Ga0268266_10000053 Ga0268266_10000053100 247
211 3300028786 Ga0307517_10000447 Ga0307517_100004472 247
212 3300033180 Ga0307510_10060386 Ga0307510_100603863 247
213 3300036647 Ga0316582_0075947 Ga0316582_0075947_458_1276 247
214 3300037312 Ga0395899_0019998 Ga0395899_0019998_3094_3897 247
215 3300037418 Ga0395900_0002655 Ga0395900_0002655_15676_16479 247
216 3300037418 Ga0395900_0002728 Ga0395900_0002728_2545_3348 247
217 3300037418 Ga0395900_0007947 Ga0395900_0007947_1434_2237 247
218 3300037466 Ga0395898_0018665 Ga0395898_0018665_6119_6922 247
219 3300037466 Ga0395898_0234600 Ga0395898_0234600_80_883 247
220 3300037471 Ga0395905_0001588 Ga0395905_0001588_8321_9124 247
221 3300037471 Ga0395905_0006592 Ga0395905_0006592_4358_5161 247
222 3300038443 Ga0395901_0000565 Ga0395901_0000565_7593_8396 247
223 3300038443 Ga0395901_0025856 Ga0395901_0025856_136_939 247
224 3300042005 Ga0439448_0042268 Ga0439448_0042268_23_826 247
225 3300046460 Ga0495638_0209671 Ga0495638_0209671_282_1073 247
226 3300046471 Ga0495650_0000081 Ga0495650_0000081_171894_172685 247
227 3300046492 Ga0495585_0000036 Ga0495585_0000036_74197_74988 247
228 3300046506 Ga0495583_0012671 Ga0495583_0012671_1655_2446 247
229 3300046507 Ga0495606_0000034 Ga0495606_0000034_181171_181962 247
230 3300046507 Ga0495606_0021571 Ga0495606_0021571_116_907 247
231 3300046512 Ga0495610_0011094 Ga0495610_0011094_2542_3333 247
232 3300046513 Ga0495616_0008122 Ga0495616_0008122_2461_3252 247
233 3300046518 Ga0495631_0094025 Ga0495631_0094025_177_980 247
234 3300046520 Ga0495637_0030045 Ga0495637_0030045_675_1466 247
235 3300046520 Ga0495637_0080492 Ga0495637_0080492_452_1243 247
236 3300046538 Ga0495609_0078083 Ga0495609_0078083_477_1268 247
237 3300046558 Ga0495633_0009366 Ga0495633_0009366_1998_2789 247
238 3300046660 Ga0495625_0000049 Ga0495625_0000049_114947_115738 247
239 3300046810 Ga0495660_0001981 Ga0495660_0001981_9441_10232 247
240 3300047323 Ga0495683_0013589 Ga0495683_0013589_1956_2759 247
241 3300047323 Ga0495683_0118857 Ga0495683_0118857_323_1114 247
242 3300050496 nmdc:mga07m45_281381_c1 nmdc:mga07m45_281381_c1_13_804 247
243 3300053130 Ga0500642_0165348 Ga0500642_0165348_85_888 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00924

MS_channel_2nd

Mechanosensitive ion channel, beta-domain

110

177

0.98

PF21082

MS_channel_3rd

Mechanosensitive ion channel MscS, C-terminal

172

265

0.89

Feature Viewer

pLDDT pTM Quality
78.33 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map